KKN_Magazine_2019_18052020_interactive

51 SAN KAM - Kaleidescope - 2019-20

Republic Day Celebration - 24.01.2019 & 26.1.2020

On the auspicious morning of 24th Jan, our school celebrated Republic Day in the school premises. It was the
matter of great pride for all the students of Nursery to Class 2 to honour the day when the constitution of India
came into effect. The celebration started with the march past followed the flag hoisting and flag salute. The
children put up cultural items that included patriotic songs, dances, skit and speeches of great leaders. On the
occasion of 71st Republic Day, let us salute our mother India. Happy Republic day wishes!!! .

Republic Day is a remarkable day in the history of India as the day when finally the Constitution of
India came into effect in 1950. The 71st Anniversary was celebrated in all its solemnity and grandeur at San
Academy Kamakoti Nagar on 26th January 2020. The entire school was resplendent in the shades of tricolor. The
programme started with the march past which was led by the school band and followed by Scouts, Guides, Cubs
and Bulbuls.
Other students were dressed in their house uniforms. The rear was brought in by teaching and non-
teaching staff. Our Principal hoisted the National flag, the students saluted the National flag and pledged to up
hold the honor and integrity followed by the flag song.
The colourful entertainment commenced with Thamizh Thai Vazhthu. This was followed by a wonderful
speech by Sahana. P of Class VII B. Students from Class IV A sang a beautiful patriotic song with a strong message
by Bharathiyar. Students from V B swayed to the music beat of “Suno Gaur Se”. The little ones from class
III C enacted a skit on the importance of Republic Day, with the teacher in the skit delivering a few thought
provoking messages. The leader’s walk by class VI B had several freedom fighters on the stage, who explained
their contribution to the freedom struggle, which was very enlightening. A patriotic song by class VI students
“Mere Vatan” was quite moving. The finale dance by Tanishka and Kaviya Darshini of Class VII A was a fitting.

52 SAN KAM - Kaleidescope - 2019-20

Every day when I wake up I am excited when I
think about my school. What excites me is to
know about Japan in EVS and the storytelling
classes. Also I love the Skating and PT classes
in the school. Teachers and friends make my
every day memorable.

Aadhya Sudhakar, I A

I am writing this today as my school gave me this chance.

My School is my second home. I study in SAN ACADEMY

and that’s the best things why I love going to school the

I like my teachers Class I school building has lot of alphabets, play area, beautiful
friends that make me super happy and my teachers are
They shape my future my helping hands and I love my class I-B

When I grow up as a proud man Dhyan Guru , I B

I will never forget my school “SAN”

I learn, play, perform, skate I study and play at school. My school
Do karate and be cool teaches me discipline, respect and
And that’s why I love going to school responsibility. My school organizes the
S-Shine A-Aspire N-Nurture annual day, sports day every year.
I am a happy SAN ite. It will be fun and exciting. My school is the
best school.
Nishanth. S, I A

School is a building which has four walls Kanishka , I B

with Tomorrow inside. My school name

is SAN ACADEMY. I love going to school My school is a very beautiful place where I go every day
because it is a place to learn the Curricular I play and study with my friends at my school
and Co-curricular activities. It is place to I love my teachers and friends
learn discipline and good habits. It is a My teachers are loving and caring
place to make friends It is a place to gain My school teaches me discipline and respect
social skills. I can learn more activities in my school.

Sawika.N , I A My school is very clean and hygienic place

I go to school by bike with my mom and bro

I like going to school because it is fun I enjoy my ride to the school every day that’s why I like to

I like studying come to the school every day.

I like my Chinese dance Archana , I B
I like home work because it is fun

I like doing EVT Activity My school is my favorite place which I love. We celebrate
I like writing all events with great joy like grandparents Day and EVS
I like going to school with my brother culminating ctivity. My teachers are the best as they are kind
I like my school and thoughtful all the time.
My school name is SAN ACADEMY
Shrinika , I A Siyona , I C

53 SAN KAM - Kaleidescope - 2019-20

My school is my 2nd home The name of my school is San Academy. I love
It is neat, clean and a holy home my school so much and it is like my second
All teachers and books are my great friends home. My teachers are kind and caring and
Knowledge and Science has no end I have lot of friends at school. Our school
May are school live forever and ever teaches good moral and it is the best.
And I love my school very much. Sathvika Thiruganam , I D

Aashman , I C

My school is the best school in the city I love going to school because my school is
My school teaches me discipline, respect and hones my skills. best and really cool. I can read, write, sing,
My school is very good at extracurricular activities. play, and dance. I can learn, share, and care.
My teachers teach well very evidently caring and kind to us. I love my teachers and my friends. My
I have good friends at my school school makes me happy
I am proud of my School because we all learn here like a family. Dikshita , I D
That’s why I love going to school.
Sashi , I C

WHY I LOVE

GoiNg to SCHooL

My best friend is my school Class I
It is like a golden door
That takes me to the land where
I have never been before.

Magizh Iniya , I D

I love going to school because it’s a place I like to go to school to meet my teacher
where I can study, Learn good habits and I learn a lot. The school is the best place in the world
play. My teachers are very friendly. My We can study, play and have fun with a kind heart.
school teaches me to be Respectful, Honest They teach us as the best teacher sweet always parents
and be Creative. they we make as to study because is we grown up.
Sukriv , I D We will not know anything so that’s why our teacher
gets angry when we not study.Thanks everyone.
School is where I learn and play
Along with my friends every day
New things I learn in this way.
Aadhav , I D

54 SAN KAM - Kaleidescope - 2019-20

ZoneKindergarten

55 SAN KAM - Kaleidescope - 2019-20 April 2019

FIRST DAY at school - KG

First day of School – 03.04.2019 was exciting for both children and teachers of Jr.KG and Sr.KG. The teachers
created a welcoming environment at the entrance and in the class. The new class for the children was made
memorable with interesting activities. Children enjoyed the centre time toys and the first day take home activity.
The Jr. KG stars made a photo frame and the Sr.KG made a lovely mobile of their school.

COLOUR PARTY DAY - JrKG

The tiny tots of JR.KG children celebrated ‘Colour party’ day on April 9th 2019. Children came dressed up in one
of the rainbow colours for the party. To reinforce the concept of colours the children had fun by playing games
on colours like sorting colour balls and identifying colours of each other in a circle.

56 SAN KAM - Kaleidescope - 2019-20 April 2019

Cleanliness drive in the school campus - 10.04.19 - JrKG

SR.KG children celebrated cleanliness drive in the
school campus on April 10th . The significance of
cleanliness was discussed with the children by
the teachers. The teachers as well as children
were a part of the cleanliness drive and ensured
that they cleaned up the classroom and the front
portion of the campus. They also educated the
children to segregate garbage into coloured
bins-green representing biodegradable waste,
blue representing recyclable waste and black
representing domestic hazardous waste. The
children were sensitized towards separating wastes
as it is an essential life skill for them to understand
that they are responsible for their own clean and
healthy environment.

SCHOOL IS COOL AFTER SUMMER

“Dreams come a size too big so that we can grow into them.”
With dreams and aspirations the students of San Academy
Kamakoti Nagar, were back to school on 6th June, 2019, after
the summer vacation. The school was abuzz with activity as
the students were meeting their friends after a long time.
Stories were exchanged and all were eager to start their
lessons with great vigour. While the old students bounded
in with renewed energy, the new entrants were nervous
with apprehension. Students eagerly went around finding
their class teachers and getting information about the new
teachers.
During the assembly our Principal Mrs. Ganga Natarajan
welcomed all the new students and teachers. Introductions
were made. Students were reminded about their
responsibilities and also about their duties. With best wishes
for the academic year and the forthcoming Unit Tests, the
students were dispersed to their respective classes with
stars in their eyes.

57 SAN KAM - Kaleidescope - 2019-20 June 2019

Exploring - SCHOOL TOUR DAY…- 18.6.2019

Children of JR.KG were taken on a school tour holding
placards so that they get familiar with the essential
places in the school like the lobby, Principal’s room,
Office room,play zone, outdoor play area, skating rink
etc… Children thoroughly enjoyed visiting the different
places of the school with their classmates.

Inspiring – INTERNATIONAL YOGA DAY - 21.6.2019

International yoga day was celebrated on 21st
June by SR.KG children to create awareness of the
benefits of meditation and yogasanas for a holistic
health. The programme began with the children
assembling quietly to a meditative music. The KG
head Mrs. Geetha Raghuraman explained briefly
the importance of asanas.
Children began with the chanting of 'OM’ followed
by warming up exercises, standing, sitting and
lying asanas. It was fascinating to see the children
enjoy the asanas .

Entertaining - CLOWN’S DAY - 24.6.2019

To teach children the magic of laughter and the
value of having a sense of humour, San KKN
celebrated Clown’s Day with the little stars of
Nursery. Teachers dressed up as clowns welcomed
the children. Teachers had fun with children by
juggling balls, crawling through hoola hoops and
catching balls. Children also danced to music
with other children and teachers. The celebration
of Clown’s day was a wonderful experience for
the little Sanites.

58 SAN KAM - Kaleidescope - 2019-20 June 2019

Bonding - FAMILY TREE DAY-25.6.2019

tcstw“hbootpTIheenehorlegaoceekfalraevcu“inteoncFdhhggaabemenimbdylmrdiyoziatralewufheynsattneikdmtthshrceeeMioohlayefnefiuc”lvade.hdJmemRarTaremce.yeyKfnha”oasyGcmnfaochadenfegiemaldelayrresisatllitbihyncnesmrehggauamrie.ctrfn”eiepahmogdmmTrenibhrsF.biiseeleniyenTrds.rchgmitnhteaehThegirnelheimpddnerrrlgchboeaohyensgbtcimkrhrleb.daetelyCehrmdee-hosb”tfmnoirrTohlodanherebutrgimiyesgonhnilsy
enjoyed the occasion.

Motivating -–SHOW & TELL - 26.06.2019

To inculcate speaking skills in children, Show and Affectionate GRANDPARENTS 28.6.2019
Tell was held on 25th and 26th June. The topics
given to the children were based on the theme Have you ever stopped to think how important
-Me and my World. Most of the children brought grandparents are? Grandparents are a family’s
colourful and creative charts and models on the greatest treasure, the founders of a loving legacy,
topic and spoke a few lines with confidence. the greatest story teller, and the keepers of
traditions. They are the family’s strong foundation.
I feel happy seeing a lonely leaf swaying in the sea Through their special love and care, they keep their
I feel happy when the winds rouch me and go. family close at heart. Our children’s grandparents
I feel happy when an infant smile at me can be the most wonderful resource to our kids.
That’s why Class I of San Academy, Kamakoti
I feel happy when I dissolve in the melody of music Nagar alloted a special day for the grandparents.
I feel happy when I’m at peace with self Grandmas and grandpas love to hear about the
kids’ successes and milestones. We give them the
I feel happy when I’m in harmony with nature. opportunity to spend time with the tiny tots in the
school environment. Games conducted help the
When my words comfort others grief, I feel happy little ones rooting for their grandparents.
Happy I become when I’m able to shed my ego.

When I share food with hungry I feel happy.
When the grace downs up on me, I feel happy.

When I find happiness in other’s happiness
I feel the presence of dividing which makes me happy.

Abinav Pramod , VI D

59 SAN KAM - Kaleidescope - 2019-20 July 2019

NURSERY - BOOGIE WOOGIE DAY - 08.07.2019

The tiny tots of Nursery celebrated ‘Boogie
Woogie’ day on Monday the 8th July 2019.
Children dressed up like Rock stars danced,
swayed and twirled, jump to fast and slow
musical beats. The entire dance floor rocked
along with them, Children also enjoyed dancing
with the musical instruments given to them.

SR.KG - SENSE BOOTH DAY - 10.07.2019

There are five senses that we use to explore and interact
with the world around us: sight, smell, taste, hearing, and
touch. The body parts that allow us to experience these
senses  are the eyes for seeing, the nose for smelling,
the tongue for tasting, the ears for hearing, and the skin
for touching. The Sr.KG experienced sense booth day on
July 10th 2019. For each sense, objects were displayed
on tables. Children in groups went around, identified
the things for each sense and spoke about it. Children
enjoyed each moment they spent around the sense
booths.

JR.KG - POSTMAN’S DAY - 09.07.2019

San Academy believes in the importance of
experiential learning The children of JR.KG
were introduced to the community Helper-
Postman. First the children coloured a picture
on a card for their family. Then the addresses
were written on the card by their teachers. On
the special day the children gathered together
and each child was given their card to post it in
a post-box made by the teachers. One of our
school staff, dressed up like a postman spoke
to the children, collected the cards from the
post box to be sent to the post office.

60 SAN KAM - Kaleidescope - 2019-20 July 2019

NURSERY - SENSE ZONE DAY - 22.07.19

The special event of Nursery on the five senses
of seeing, tasting, smelling, hearing and
feeling were experienced through objects of
each sense so that were placed on 5 different
senses.

JR.KG - SHOW AND TELL- SR.KG - SHOW AND TELL-BODY PARTS - 24.07.19
COMMUNITY CONNECT - 23.07.19
‘Show and Tell’ is an important part of a child’s learning
Jr.Kg children of San Academy Kamakoti development, as it helps them to organize information,
Nagar presented what the community develop vocabulary and speaking skills on a particular topic
helpers such as doctors, nurses, policemen, and present it with confidence. Children of Sr.KG spoke on
farmers, bakers, teachers, fire fighters do for internal and external body parts such as ears and tongue, ears
us in our neighbourhood. They spoke about and nose, heart, lungs, stomach, kidney etc.
the community helpers job, skills and tools The show was a spectacular learning experience for the kids of
they use. Children also learnt to appreciate Sr.Kg on body parts!!!
the people who serve us to make the
neighbourhood a safe and friendly place.

61 SAN KAM - Kaleidescope - 2019-20 July 2019

Nursery - Puppetry Day - 19.08.2019

NaeGsstlureoasrprstnyhoedarromyynf taccLehiwoflarenaorbsamarcsnathdteKoeritndwshdfnepreoufrtlmpgoyap.tregChtrtheearniynlcddhwdrmiealadnysaroteithnninmov.1irteCo9ehu.sd0itglo8dtho.rrl1ieye9tnseeinllonlijsfoatttehyhsenetedeosdrmclyihstotootenoonttlhhtinhl.eogeAbstbtcpoohyur.tilpyhCdpewrheeisiltnttdho.srhreSryonha.wpectanoamantrtereRadnutrtpeieodasnstt.ehhdAee
Jr.Kg-Show & tell-Veggie view-20.8.2019

tsdCopihfoefielkadercreheannbotofptyutrphetseetesmhneo.tfevvdeegtgeheteataibmblelpesoswratinatdhnctcehlaeorifirteynauattinnrdigecnhotencafolitdnhetyenoncntea,2nA0d.p0pb8re.e2nc0ei1afit9tis.o.TnMhbeoaysdtsgpoeofsktewheaebrceohiugldtivrteehnne

62 SAN KAM - Kaleidescope - 2019-20 Aug 2019

Sr.Kg Show & Tell - “Around the World in 30 Days” - 21.8.2019

To inculcate speaking skills in children, Show and Tell was held on 21.08.19. The topics
given to the children were based on the theme -Around the world in 30 days. Most of
the children brought colourful and creative charts on the topic and spoke a few lines
with confidence. It was amazing to listen to children speak about the wonders of the
world, the flags, neighbouring countries…….
Appreciation badges were given to each of them.

Class I - Culminating Activity-25.09.2019

As there is no exam for EVS, the class 1 children presented culminating activities on Environmental
Science on 25.09.2019 in the school campus. The activities were based on the 4 topics that the children
learnt in the first term-body parts, plant life cycle, primary and secondary colours, extinct and endangered
animals. Parents of each section were invited to be part of the programme presented by each class. The
children prepared for the show in a short time. Parents appreciated the programme a lot as children
enjoyed putting up each activity with understanding. They are looking forward to such activities on EVS.

63 SAN KAM - Kaleidescope - 2019-20 Sep 2019

Nursery- Splash Pool Day - 16.09.2019

laNasrukgreesdeartynodcwhseimldaarrelalnpnoednobjlosriy.neCgdhaitlhdceoreilronushpraeddcrieaaslrsao.clTltiihcvkeitiynygh‘SatpdilmafsuehniPnsoptolhalesDhwainyag’teoarnnwd1i6tph.l0at9yh.ie2ni0gr1fw9ri.ietThnhdwes.actheirldtroeyns were
in a

Jr.Kg – Milk The Cow Day - 17.09.2019

eisea1tGxhsxn7opopd.nme0wlaucr9aeiiht.entdr2inheli0dtcdait1roheed9euenoa.asyfcmAfevhtwhaidclpakoleutaswheeprcevstrew.oeoclendaEofbtsuawt.rcchbahtwertsoeiactwudohngewbdfhrytgeeatestvnhohtederfgtycrihrtohoaseminsludsses.crteTheehshnone.eojoTomltfhyecJieealark.dymcKhaagtpelhnsouredonss

64 SAN KAM - Kaleidescope - 2019-20 Sep 2019

Sr.Kg–Traditional Sports Day - 18.09.2019

The children of Sr.Kg celebrated “Traditional Sports Day” on
18.09.2019 as part of their theme – Fitness Fun. Teachers
spoke about the simple and effective traditional sports
played by our ancestors that built life skills and team play.
The outdoor games children played were gilli dandu, Nondi,
Kabadi, Pambaram and indoor games like pallanguzhi,
adupuliattam, snake & ladder and Ludo. Children loved
playing Nondi and Kabadi.

Nursery Show & Tell - “Water Animals” -23.09.2019

Nursery children participated in the show and tell activity
for the first time on 23.09.2019. All the children brought a
chart/toy of a water animal and most of them spoke a few
lines with confidence. Appreciation badges were given to
each child.

65 SAN KAM - Kaleidescope - 2019-20 Sep 2019

Jr.Kg Show & Tell - “Mammalia Day” 24.09.2019

Jr.Kg children spoke about the special features of mammals for their show and tell activity on
24.09.2019. Each one of them presented their topic with confidence. Through the activity the
children understood the characteristics of mammals. Appreciation badges were given to each child.
Sr.Kg Show & Tell - “Fitness fun” - 25.9.2019

opIlgM2Tniflsao5adttomy.ehie0saeneent9.rmhS.ato2aoaonf.n0nmdctd1chhs9eeseip.lcodsoTucpfrkhhbeeteeihanaldaekcdsrfihcpenievihnegwledialrsbrdl.kkeirrnAinoealelpbnussspogpicwnrhuaoetitmcktchhectiaehoiclotedldioonorrndueneafirnsiffbdfst,ueoeaeSlrpddnheaigconucneewtpdrs.etIaawrctlsaanrweetdaderaaietkdTstiaieoagvtblnoesilvataweodfclianhnitg,nsaiaftserohomhtsoesiseentldoabsfgucfaootnhloanfl.

66 SAN KAM - Kaleidescope - 2019-20 Oct 2019

Nursery – Zoo Animal Party Day - 14.10.2019

TafcTahlahsremomeyeipcaddhlnearidnlyedetsrfidsofeiernewdedosiutttfh.phNCeeiunharaciaslnhdenirrmoeaytnnahclieewsmrleeeaaabnlncrtcdahoatscerbtohduiusimlzcdnouedroietasfaponnwrrdeiemstirhedeaenelstnzpeeotadriorfvitaeepynddaddrttatophyyae.torhTtanehincmeMiipm.paolatanelysddazinyoinn1ees4aitcnwhhgaiOhsncagstbeoaitntbauiemtpr..aaCClshhsiaiollddnzrrogeeosnn.,

Sr.Kg – Animal Needs Day -18.10.2019

Sr.Kg children celebrated Animal needs day on October 18th. The different needs of each animal was
displayed and it was explained to the children by the teachers. The importance of shelter, food, health
and protection were the topics discussed. Class wise children went around and spoke about the need

for each animals. It was an educative experience for the children.

67 SAN KAM - Kaleidescope - 2019-20 Oct 2019

Nursery – Animal Shelter Day - 21.10.2019

Animals need food, water, shelter, and space to survive. The children of Nursery were given
an opportunity to understand the importance of shelter for animals on 21st October. The
different shelters for animals were displayed like den, cow shed, stable. Children enjoyed
watching the homes of each animal and understood like humans, animals too need a home
to protect them from danger.

Jr.Kg – Let’s Go Fishing - 22.10.2019

To understand the concept of marine world, children of Jr.Kg celebrated – Lets go fishing on 22nd October.
Children were taken to the play zone where tubs having real and make believe fishes were kept .Teachers
explained the different living creatures in water. They were given hand nets to catch them and transfer
to another tub. Children had fun seeing the real fish and catching them in the nets given to them.

68 SAN KAM - Kaleidescope - 2019-20 Oct 2019

Sr.Kg – Save Animal Day - 23.10.2019

To make the world a better place for all animals, and prevent them from becoming
endangered. Save Animal day was observed on 23rd October. Animals were displayed
in a class and children were explained how to save animals and improve their welfare.

Jr.Kg – Water World Day - 29.10.2019

To focus attention on the importance of water, The Jr.Kg were told about the importance of conserving
water in today's scenario where water is becoming scarce. The children went on a rally around the street
near the school to convey the significance of saving water with plaque cards saying-Save water, save
life, Be a water saver, save water and it will save you. It was an enriching experience for the little ones

and the teachers.

69 SAN KAM - Kaleidescope - 2019-20 Nov 2019

Jr.Kg Show & Tell - “Chirper’s Day” - 28.11.2019

The Jr.Kg children celebrated chirpers day on 28.11.19 in the school lobby. A teacher of San brought
a parrot and children were thrilled to see it eat apple, carrot, guava pieces. Children were told
about the importance of caring, protecting and saving birds. Children interacted with the parrot
joyfully. They also participated in the show and tell activity with enthusiasm.

Sr.Kg – Marine World Show – 29.11.2019

OicTth.hthieMldecarrhseninsyldpbororefkonetuhogaehfbmtSocru.hKtsagparomctskepe&lehabimbbraiooatduneetsdl,tsAhroeeqfpusstaieelteaaicscawrndeiiaatmyhtuaocrllsneaslr2iiikt9ney.c1alou1ncd.dt1ion9cpgoiunsnseft,iahdsewteanserccefehdi.soshoal,nscdeaamspwpoueksee.daS,boeomtucet.

70 SAN KAM - Kaleidescope - 2019-20 Dec 2019

Nursery - SAN Express Day - 09.12.2019 As part of experiential learning the Nursery of San
Kamakoti Nagar celebrated San Express day on
09.12.2019 . A make believe traffic signal ,zebra
crossing ,traffic lights were setup in the school
campus. The teachers explained the meaning of each
traffic light, the importance of road rules. Children
took turns and drove cars,cycle,bus by following rules.
Children had fun riding the vehicles,at the same time
following rules.

JrKG - Show & Tell - 10.12.2019

Show and tell is the practice of showing a toy/prop/charts on a topic to an audience and telling them
about it. San Academy believes in introducing young children the skills of public speaking through show & Tell.
The topic given to children was related to the project theme Seasons. Each child presented the topic on seasons
with confidence. They were presented appreciation badges.

71 SAN KAM - Kaleidescope - 2019-20 Dec 2019

SrKG - Show & Tell - 11.12.2019 Expanding Expression helps children to develop
oral language skills. Children learn to express their
thoughts on a certain object or topic. The children of
Sr.KG narrated a story based on their project theme-
Tales and Fables, Children brought story charts ,story
cards, puppets to narrate the story of their class.
The Judges were parents from Kindergarten who
appreciated the children’s speaking skills.

We are cute Family ...

72 SAN KAM - Kaleidescope - 2019-20 Jan 2020

Nursery- FLY A KITE DAY - 06.01.2020

Flying a kite is a traditional folk activity in Spring after winter that brings young and old outdoor to
have fun by flying colourful kites. The tiny tots of Nursery celebrated –“Fly a kite day” on 6.1.2020.
The children and teachers had lot of fun experiencing flying colourful kites in the school campus.
They exercised and had good fun at the same time. The children were thrilled to have their kites as
take home.

Sr.Kg - HELLO SPRING - 09.01.2020

Springtime is a great time of joy to every person after winter. The flower buds, the
springy smell, birds singing, kites flying are lovely springtime charms. The children
of Sr.KG welcomed spring on 09.01.2020. The teachers & children sang together
a spring song to welcome Spring. The children represented Spring by dressing up
like flowers, birds, trees and talked about the changes in nature and said “Hello

Spring” with joy.

73 SAN KAM - Kaleidescope - 2019-20 Jan 2020

Jr.Kg - THE MAGIC SEASON - 10.01.2020

Honouring each of the four season as a time to celebrate and embrace the magic
and the miracles that unfold within the Earth, children of Jr.Kg took us on a
journey into the world of seasonal magic on 10.01.2020. The
trees, blooming of colourful flowers, the chirping of birds, the change of leaves on
beauty of snow and
summer fun were magical to our tiny tots! Each class presented the clothes, food,
festivals and experienced the magic of each
enthralling to all kutti Sanites. season. The magical adventure was

Nursery - SHOW & TELL - WINGED WISDOM - 27.01.2020

Show & tell activity gives children practise in communication skills & builds confidence to
speak in a safe environment. The children of Jr.Kg spoke on one of the travel techniques on
28.01.2020. They had brought models, charts, puppets and spoke with clarity & confidence.
Parents of Jr.Kg were the judges and appreciated the children. Children were given

appreciation badges.

74 SAN KAM - Kaleidescope - 2019-20 Jan 2020

JRKG - SHOW & TELL - TRAVEL TECHNIQUE - 28.01.2020

aP2sSppa8hpre.oe0rawne1kct.2s&iina0to2taieo0fsln.laJTafrb.ehcKaetdegiyvngihewvtyisare.dogrenibvmreotsehunecgthh.ijtluTdmhdregeoencdshepilralsdan,rccdethinsaaeorptfispnJ,rrpe.cKcuogipmapstmepedotusknetaihcnoaedntisocophnnoielksdkeorieflwlnstih.t&heCcbthrluaialidrvliderteysl nt&ceocwcnhoefninrdifeqeidungeecinsevceotenno.
SRKG - SHOW & TELL - WEATHER WALK - 29.01.2020

abitCnhbahfeidoillmigrdtmeyrefoaaentfseitoolthanfsekpoSecerfh.hcKeiiolagadmlcrhh&eeanw.v.iPemeaapgrteaohnirenttresawdnotif.tchSoTrnch.Kfleaigdrceiwthnyeicl&rdeerceitonhnnepfsijupduboedlknigecceesso.pnaEenaawdckheitnahcgtehhyiaeldnwr dwetorasepshiaogcwsiwveep&dnroaavtnteidltalhinphegpasrsdep eceitmaaaktiaiilonedndge 

75 SAN KAM - Kaleidescope - 2019-20 Jan 2020

SrKG - SPECIAL ASSEMBLY

On 29/1/2020 a Special Assembly was conducted by Sr.KG - A. All  Sr. Kg students and teachers assembled
in the lobby. It started with Tamizh Thai Vazthu. Then prayer by Sana, Akshita, Pooja, Tanishka Prakash and
Tanshika.S. Pledge by Akshita.S and Thirukural by Nimalan. Nimalan recited the Thirukural “Nandri Marappadhu
nandrandru” and explained the meaning for it. Current News was read by Jeshan A.D. Theme based Rhymes were
sung by Tharika Prakash, Shruthi, Akshara, Srihitha, Dhanshikha.V and all Sr. Kg students.
Principal Ms. Ganga Natarajan addressed the gathering and oriented them on why they have gathered and
encouraged them to discuss about their experience of an assembly with their parents and grandparents. We
concluded with the National Anthem. The assembly was compered by Keerthan.

We are cute Family ... Kavinaya Vivek Anandh Saahith Chatriyan.B.S Siddharth.S

Pukalini.S Sajiv Rajan.A

76 SAN KAM - Kaleidescope - 2019-20 Feb 2020

Nursery - Health is wealth - 10.02.2020

Children of Nursery had their special event ‘Health is wealth’ on 10.02.2020. We invited Dr. Bharat
and Mrs.Radhika parent of Ananshi JrKG to speak about basic hygiene, sanitation and healthy food.
The objective of the event was to highlight the importance of Health. At the end of the event the
children learnt about oral hygiene, techniques in washing hands and about healthy and junk food.

NURSERY – busy bee day - 11.02.2020

Jr.Kg special event “Busy Bee day” was celebrated on
11.02.2020. Children enacted as honey bees and flowers and
showed how bees work together to make honey. Children
had great fun singing bee related rhymes. Children enjoyed
doing number related activity in hexagon shaped bee hive.
All children were given honey to taste. Kids took home lot of
interesting facts about bees and Honeybee finger puppet as
take home.

77 SAN KAM - Kaleidescope - 2019-20 Feb 2020

NURSERY – SAN CHEF day - 17.02.2020

Nursery children had their special event “San Chef day” on 17.02.2020. The objective of the vent
was to enhance healthy eating. We had veg sandwich corner, fruit salad corner and sweets made
fruit salad with healthy fruits. In sweet corner we had sweets like puffed rice balls, chikki and sesame
balls, thus avoiding sweets made of sugar. Children enjoyed the event and also ate healthy snacks.

JRKG – the hungry caterpillar DAY - 18.02.2020

The popular story- The Hungry Caterpillar  by Eric Carle,
was enacted by the children of Jr.Kg on 18.2.2020. Children
presented the life cycle of a butterfly in a story sequence
which was related to the theme of the month - Creepy
Crawly. The children, memorized the dialogues and spoke
with confidence. They also understood about the importance
of healthy food.

78 SAN KAM - Kaleidescope - 2019-20 Feb 2020

SRKG – International language day - 21.02.2020

International language day is a worldwide annual observance held on 21st February to promote
awareness of linguistic and cultural diversity and to promote multilinguals. Students of Sr. Kg also
observed the International language day on 21st February and presented a variety of programs.
Students dressed in traditional dresses of Andhra Pradesh, Kerala, Maharashtra and spoke few
sentences in their own language.  Students also dressed  in traditional dresses of  various countries
like China, Japan, Germany, France and taught us the magic words Thank you, Please, Welcome,
Sorry, Excuse me in the international languages  Japanese, Dutch, French. This celebration  gave
children an opportunity to know the role of languages in our lives and the importance of preserving
linguistic diversity in the world and in our local community.
SRKG – national science day - 28.02.2020

Sr.kg celebrated National science day. All the students had assembled in the lobby . Students from
each class demonstrated 2 science experiments to everyone. These are the experiments done by
the children. Few experiments were- 1.Baking soda , vinegar volcano experiment , 2.Traveling water
experiments etc.

79 SAN KAM - Kaleidescope - 2019-20

Intra Competition-30.07.2019

NURSERY - COLOURING A CAT JR KG - COLOURING A BUS SR.KG - COLOUR BY NUMBERS

The Intra Competition of the The Intra Competition of The Intra Competition of the
first term for Nursery was held the first term for Jr.Kg was first term for Sr. Kg was held
in their respective classes. conducted in their respective in their respective classes. The
The topic was colouring a cat classes. The topic was topic was colour by numbers
and the children enjoyed with colouring a bus and the and the children enjoyed
different colourful crayons. children beautifully coloured colouring a duck in a pond with
the given outline picture of a the given outline picture.
bus with crayons.

CLASS 1ST PLACE 2ND PLACE 3RD PLACE

Nursery EVANGELINE SHERLY.P VISHNURAM.V THUKILAN BALASETHU.G

Jr. Kg A AKSHAYA MARY JA DHANVI K KEERTHIK SHREENIVAS K

Jr. Kg B KRISIKA SREE K RUTHVIKAA N SIDDARTH R

Jr. Kg C HARPITA R SRI SANJANA A SANJEEYAN S

Jr. Kg D YAZHINI T DHIYA K SAMYUKTHA S

Sr. Kg A NIMILAM PRAKASAM ARTHIK SIRNIVASA VARSHINI M I

Sr. Kg B DEEKSHITA MEDHA DIYA MADAN

Sr. Kg C PRITHVI E HAIRUN AFEELA MF VETRI NITHILAN SP

Sr. Kg D YAKSHITHA R JERUSHA CAROLINE J ZAYNAB KOUSER J

Sr. Kg E JEEVANI SANSRITI SAMRUDH SIVASANMUGAM LAVANYA H

80 SAN KAM - Kaleidescope - 2019-20
Intra Competition-22.11.2019

When children face  competitive  activities at  school, they not only gain individual skills, but also build
on important interpersonal skills. These skills help children prepare for later life. To promote a platform for
creative and speaking skills in children, intra competition with their class children is held term wise during the
academic year. This year Nursery had clay modelling, Jr.Kg - Fancy dress on Ariel beings and Sr.Kg - tangram.

CLASS 1ST PLACE 2ND PLACE 3RD PLACE

Nursery VISHNURAM.V AADVIK.S ANANYA .S
Jr. Kg A JENISHA JOIESTIN ADWAITH.S SHASHWATH.V
Jr. Kg B SIDDHARTH.R SAMSHITHA.M AVANTHIKA.M
Jr. Kg C DARSHAN.S HARPITA.R KRITHIK KRISHNAN.P
Jr. Kg D MOHAMED IHSAAN.S ARRUSH.J.S MOHAMED AFFAN.M
Sr. Kg A JESHAN .A.D KRITHIKSAI.S VARSHINI M.I
Sr. Kg B HEERAN.G DIYA MADHAN SUHANA.K
Sr. Kg C SANJAY.D HAIRUN HAFEELA .M.F VISHAL.H
Sr. Kg D IBRAR KHAN HARSHANTH.R AYRA SING.H
Sr. Kg E JOANNA ANGELIN.G SABAREESH KARTHIK.A SAMRUDH
SHIVASHANMUGAM

81 SAN KAM - Kaleidescope - 2019-20
Intra Competition-24.02.2020

When children face competitive activities at school, they not only gain individual skills, but also creative skills.
The topics for Term -2 intra competition were Rhyme time for Nursery, clay modelling for Jr.Kg and word whizz
worksheet for Sr.Kg

CLASS 1ST PLACE 2ND PLACE 3RD PLACE

Nursery AADVIK S SATHYADEV C PUKALINI S

Jr. Kg A AKSHAYA MARY JANE AARIDH.A AARIZ AHAMED.M

Jr. Kg B VARSHITHA GANPISETTY SAMSHITHA M JHAVAN.S
KAVIYUVAN.K
Jr. Kg C KRITHIK KRISHNAN.P HARPITA R SAI KISHAN .V
REINO ADEN.P MOHAMED IHSAAN NAZZAR.S
Jr. Kg D SAMYUKTHA .S AASHIKA MAHESH AALIYA .M
KAVIN KUMAR .S AKSHITA.S
Sr. Kg A JESHAN .A.D DEEKSHITHA S KEERTHAN.P
HEERAN.G
Sr. Kg B CHETEN SRIRAM INTI MAHATHI.S
MOHITHA.S
Sr. Kg C YAZHINI.S AYRA SINGH
IBRAR KHAN
Sr. Kg D ADVIK PRASHANTH REYA SHREENITHA.S
Sr.KG E VARSHIKA. K
SAMRUDH
SHIVASHUNMUGAM

82 SAN KAM - Kaleidescope - 2019-20

Living EAT WELL COPE WITH YOUR DIABETES
• Make a diabetic meal plan • If your life is stressful try
Diabetes
containing more fruits and meditating or yoga or you can
Diabetes is a disease which occurs vegetables. get some counseling.
when there is too much of glucose in • Avoid food which contains less
our blood stream (blood sugar). This saturated fat and salt. KNOW WHAT TO DO EVERYDAY
usually happens when insulin is not • Choose food with more fibre. • Take pills for diabetes or insulin.
produced or is inefficiently produced • Drink water instead of juice and • Take aspirin to reduce the risk of
or the cells can’t use it. You must regular soda.
be wondering why this hormone is • Portion size matters. heart attack.
important. This is because the insulin • Stop smoking.
allows glucose to be used by the cells. BE ACTIVE • Brush your teeth and floss every
• Set a goal to be more active by
When people find out that they have day.
diabetes it is common to find people going to the gym or walking. • Check your feet for cuts or
shocked but with some lifestyle • Twice a week do muscle
changes you can lead a healthy life. bruises or blisters, etc., and than
Some of them are given below. strengthening or yoga. call your doctor.
Enjoy a diabetes free life. Keep active
and healthy.

Abhinav P. D, VII B

Diabetes can be hereditary. Remedies : Class VII
That doesn’t mean that you are Consuming Aloe Vera pulp may help
guaranteed to get it if it runs in your repair and protect the pancreas.
family. Instead it means you have a Cinnamon, the fragrant spice, bitter
greater chance of acquiring it. But it guard, milk thistle, fenugreek and
can be stopped if you follow certain ginger are also good.
remedies to reduce it from a very
young age. Explanations:
For blurred vision: It is caused because
When Does Diabetes Occur? What of Blood Pressure that is caused by
are the early signs? diabetes. It breaks the nerve which
Diabetes occurs when your body is present in the eye causing blurred
cannot make or effectively use its vision.
own insulin, a hormone made by
special cells in the pancreas. Insulin For slow healing of wounds: High levels
serves as a key to open your cells in of blood glucose caused by diabetes
the body to allow glucose from the can, over time, affect the nerves and
food you eat to enter. Early signs are lead to poor blood circulation, making it
excessive thirst, frequent urination, hard for blood - needed for skin repair
weight loss or gain, irritability, to reach areas of the body affected by
blurred vision and slow healing of sores or wounds.
wounds. Diabetes is the major cause
of blindness, kidney failure, heart Your body is the best machine! Protect
attacks, strokes, blood pressure and it !!!
lower limb amputation.
Balasankari. G, VII B

83 SAN KAM - Kaleidescope - 2019-20 Class VII

Increasing Obesity in Children

Obesity is the condition where excess of fat is accumulated in our body. It is caused by
the carelessness of every individual. Obesity is dangerous when it crosses beyond a

lCwatiuTtmhhnhpheaideieiltitgdyn.vhcrtibeahttsh.ernietbecRtaaooeowtnhmdhtdoyulhedercsektrlioaeenagmzstrgyesymte.wswatOikaeahmeininlogdeiduhtssepftaia,tmelatswivnrosgeeheanbfirutncyoahsdshnedtojitadusuvrolneutaifnskdptrgefheiionaanaeotlbttlcdhyahaoelcehmaliaoiranrnptrcbaudoecoctafdtdweiujyvrduosiianeatreiknsketa,d.slcfacToiwwaydhoenioehdtrryesbek.wrneoewhefahriifsctegahhltytphoogceeuaerdtnettmbhnaiyenecocrccveguraixeynmreagbirusscofelionhasrohyetedt,ihsdryou/aohuastgeenersadrsd.

Pdbinhoesynthse’itecaraadelltcthaohcygetniyavinzictdeaienafsintpc.dlaaCanyhpimoplduraretkedcenioaoatserlhl ogufiauntml.tdi‘leTntsihmooeterypgaaloarneydobvuHeitdeinefaogolrtdhgae’apwmalreaeetlsket.dwoR.roeSwomparcetehcmcihilbodTeureVrsn‘atBshsehseeoHetusenldattilhrtaehalwtyd,awaByyees,
Alamukrithika. S, VII B
Happy’.

He who has health, has hope; and He who has hope has everything – Thomas Cartyle

Obesity in Children a Global Warning

There has been a dangerous rise in obesity among children all around the world because of rapid, unhealthy
nutritional transition. More than 40 million children are seriously affected by obesity, making obesity the “most
common type of malnutrition” (nutrition deficient) among developed and developing countries.

Causes for Obesity

The urban life style (junk food) and special economic status (more of hotel food) lead to unhealthy obesity. Due to
high intake of energy dense food (high sugar content) and less physical activity (long hours on electronic gadgets)
children become obese.

Prevention is Better than Cure

Educate the kids
Follow traffic light eating habit
RED: STOP (sugary, salty, oily food)
YELLOW: CAUTION (meat, dairy, processed food)
GREEN: GO (fruits and vegetables)
Weight management is a suitable goal rather than weight loss.

Conclusion

Every human being is the author of his own health or disease – Buddha
Keeping this in mind, our school is providing us a holistic development in aesthetic sense in balancing scholastic
and non-scholastic activities and thereby moulding us for a strong beautiful future.

K. Kaviya Darshini, VII A

84 SAN KAM - Kaleidescope - 2019-20 Class VII

“Few die of hunger, Many die of eating” – Facebook
Benjamin Franklin Friendship
Obesity is a disease of positive energy balance,
which arises as a result of deregulation in People say, “I have 873 friends”, “I have 1023 friends”, and
the energy balance system – a failure in the when I ask, “Really?”, they add, “On Facebook”. ‘Facebook’ is
regulatory systems to make appropriate one of the biggest part of social media but when it comes to
adjustments between intake and calories ‘Facebook friends’, most of them are people we don’t know.
burnt. We accept a friend request just because we want to brag
World Obesity Day is observed globally since about the number of friends. Study after study confirms that
2015 on the 11th of October to educate and most people have about 5 intimate friends, 15 close friends,
raise awareness among the general public 50 general friends and 150 acquaintances. Only these are
about the dangers of obesity and the ways to meaningful relationships.
control the growing epidemic.
Obesity is weighing on education productivity Then what about the rest of our Facebook friends? Who are
and the economy. Childhood obesity has they? If we are not careful, some people may misuse our
assumed epidemic proportions today across information. We post almost every activity of ours. We may
the globe and it is imperative to correct the want our friends to like it or comment on it. But what we
situation. Obesity is now so normal that, are actually doing is, telling thousands of unknown people all
parents cannot see it in their kids. our activities and daily routines almost in real time. All this
Food is powerful. It has the potential to heat information can be misused for various crimes like identity
and to cause sickness. “Eat a rainbow everyday” theft. There exist many cases where people get fooled by
because if you eat a variety of colours everyday, fake profiles on ‘Facebook’ and in the end suffer huge losses
you are getting all the micronutrients your both mentally and financially. Whenever you post a picture
body needs. of yourself, discern that millions of people who don’t know
In conclusion, Education is the only viable, you and whom you don’t know are going to see the picture
universal solution to the obesity crisis. and may use / misuse it. I leave it to your imagination.

Siona Crystal, VII B

Childhood obesity is a serious medical condition that Friends are important. A friend in need is a friend indeed.
But what if the so-called friend is unknown and virtual
affects children and adolescents. Children who are or sometimes, even fake? So, control what you post on
‘Facebook’ and whom you share it with.
obese are above the normal weight for their age and
C. M. Narayani, VII B
height. Childhood obesity is a particularly troubling

phenomenon because the extra pounds often start

children on the path to health problems like diabetes,

high blood pressure and high cholesterol. Many obese

children become obese adults, especially if one or

both parents are obese. Childhood obesity can also

lead to low self-esteem. We should stop eating junk

food or else we will become fat. It may even cut short

our life span. S. Abishek, VII A

85 SAN KAM - Kaleidescope - 2019-20

Class VII

INTRODUCTION: Facebook friendship has become a new trend with the advent of social networking websites.
Facebook is one of the most popular and common social networking websites. It is easier to be connected to
people via Facebook these days. With the help of only a few clicks, one may be able to build up friendship with a
person residing in another continent.

REAL FRIENDS AND FACEBOOK FRIENDS: There is a huge difference between friends in real life and friends in
virtual life. Real friends are usually our buddies, pals and acquaintances whom we have known for the better part
of our lives. They are people who know us as the person we are and they understand our feelings and emotions.
However, in Facebook we could be friends with people whom we have never met or seen before. Our virtual
friends do not have a clue about us nor do we have about them.

FRUITFUL FRIENDSHIP: It is very rare that friendships created on Facebook get to the point of realization when two
people actually meet each other in person and hang out with each other. Other than this, a majority of friendships
fall short of being called an actual friendship and is only limited to chatting over Facebook.

DISADVANTAGES OF FACEBOOK FRIENDSHIP: The disadvantage is also that if we accept a friendship from unknown
people, they will have access to our personal data and it could be misused. Even the photos and messages posted
by us, is open to all and the photos can be misused.

CONCLUSION: Facebook friendships are virtual friendships and nowhere near the actual friendship, where there
is a lot of sharing with another person. The emotions and feelings of a person cannot always be expressed on a
portal, joy and happiness cannot always be experienced by typing those words on a chat box. It is high time that
people realized that Facebook friendship do not reach the point of bonding most of the time.

Sathya Sathish, VII B

Facebook friends are the same as a real life friend. These aren’t
people you met on Facebook. Once you determine that the
person sending a friend request is a friend of a friend, you can
accept the request and engage in a conversation with them.
Facebook has a lot of fake profiles that have been made by
malicious users, criminal and other stalking men and women.
These profiles bear the same information and photos as that of
one’s friend to lure the innocent people to accept their friend
requests. Once the request is accepted, these fake profiles
get complete license to view all the personal information of
the targeted persons and they may indulge in objectionable
behavior. Such fake profiles have been the cause of misery
and trauma of many people on Facebook, especially girls and
gullible boys.
To prevent from falling prey to the fake identities on Facebook,
one has to change his or her privacy settings on Facebook.
Better yet, think twice before accepting requests.

K. S. Neeraj, VII A

86 SAN KAM - Kaleidescope - 2019-20 Class VII

Diabetes is a metabolic disease which is caused due Life
to the excess flow of blood sugar (glucose) in humans.
It is also called as ‘Diabetes Mellitus’ (DM). Our body Without Internet
produces insulin, which is caused due to our activities
in our lifestyle. It is primarily responsible for carrying Internet is one of the greatest inventions of all time,
glucose present in our blood to the cells, to be stored especially in the field of communication. With inter-
and used as energy source. The symptoms are: net, we can do many things. It is a very useful tool.
Excessive thirst and hunger, frequent urination, weight With internet we can shrink the whole world – Mean-
loss or gain, fatigue, irritability, blurred vision, slow ing that you can have access to the entire world by
healing of wounds, nausea, etc. just sitting at your home. But, if internet didn’t ex-
ist, our lives are in trouble. Take a breath and think.
There are two types of diabetes – Type 1 is a chronic Without internet there are both advantages and dis-
condition in which the pancreas produces little or no advantages.
insulin and Type 2 is a chronic condition that affects
the way the body processes blood sugar. Children get If internet didn’t exist, our work will multiply mani-
diabetes and most of them suffer from Type 1 due to fold consuming more time. Children will not be able
excessive eating of sugary food and carbonated drinks. to complete their assignments on time. We won’t get
Few of them suffer from Type 2 also. The disease enough information about any given topic. Internet
sometimes leads to death too if the children do not helps us to gather loads of information about any-
have strong immune system. thing and everything.

Diabetes cannot be cured completely. Yet, it can be Apart from this we have online banking, booking tick-
managed with medicines and lifestyle changes. It is ets, payment, placing orders, etc., which make our
estimated that total number of patients suffering from life easier. Things will be delivered at our doorstep.
diabetes in South-East-Asia alone is 92 million and it Not only can we know about the earth, we can gather
may rise. Let us take an oath that we protect ourselves information about the entire universe, which is un-
and others from the wrath of diabetes. believable! People can find out what is happening in
their city, country and other places, they can update
P. Varunika, VII A themselves on current affairs.

Diabetes is a disorder which affects the way the body Unfortunately, there are some negative aspects too.
uses the food for energy and growth. Living with it Too much of internet has made people addicted to
changes the lifestyle of that person. It is a life-long it. Small children watch things which are not for their
disease that cannot be cured but can be controlled. ages. It is now a trend to use the net for even a small
The peron should do exercise regularly to stay fit and thing. Apart from addiction, vision is affected too.
healthy. They should take medicines, check their body People do not move around and their body becomes
sugar level regularly as advised by the doctor. They unfit for physical activity.
should avoid junk food like burger, pizza, etc. They
should not have any stress in their mind and should So I conclude that Internet is very useful but exces-
lead a stress-free life. They should not take excess sive usage can be dangerous. Thank You.
of sweets. They should choose their food wisely and
maintain their weight. If they follow balanced diet, I. Pranav Kumar, VII B
living with diabetes will be much easier.

J. Jothi Prabha, VII A

87 SAN KAM - Kaleidescope - 2019-20 Class VII

Internet has become very important in our Internet and computers have already filled all
daily lives. It provides us trillions of information within the needs of human life. We can find jobs in cities with
a nanosecond. But, there were times when people the use of internet and computers. Communication,
did not have internet and they were able to do their education have benefitted from them. If Internet
work without any browsing. So let us now see how the was stopped for a day, communication will suffer;
internet helps us and how it doesn’t. online transactions will not take place. We have come
to depend on internet a lot that we cannot think of
Internet can be useful in many ways. life without them. In order to avoid this, we have to
Researchers use internet to collect data on the topics reduce the amount of online time used by us.
they are researching about. It is used in communication.
Satellites transmit signals and connect the research Let us have a very simple rule in our family. In
centers around the world. They even connect the this case we can use the traffic signals:-
space stations with that of the ground stations. These RED: STOP (using mobile phones, television)
missions would help us know more about space. YELLOW: CAUTION (radios, video games)
Internet is used for communication in personal level – GREEN: GO (indoor and outdoor games, reading books
that is with our friends and relatives. We can reserve and newspapers)
tickets for transport, book hotels, and order items.
We must follow the above rules to live a life without
But there are various ways for internet to internet. These days even one year olds are addicted
corrupt our minds. Internet has some restricted to internet. So, from now we will lead a life without
websites. Sitting a long time browsing will strain our internet. Promise everyone!
eyes. Children play games without parents’ knowledge
and permission. YouTube lets our imagination run and S. Tanishka, VII A
sometimes in the wrong direction. People become lazy
and stop various physical activities. This is really bad.
The bad things in internet should be banned.

I would like to conclude by saying that, if
internet is not there in the present day, many things
could not be done easily. But in olden days, people
survived well without internet. So it is not definite that
life will not survive without Internet.

Aditya Tarang Bhamidipati, VII A

The modern world will look void without internet and computer. Internet and computers have created such an
order in every field. But if anyone asks “Is it possible to live without internet?” the answer is ‘Yes’, we can live without
internet.

Internet is not a basic essential like food, shelter or clothes. Think about India, before the launch of Jio, a lot of Indians
didn’t have any access to daily mobile internet. Even today it is not available to everyone but they still survive. As far as
I know, there are no efforts to eliminate internet. So, you have no reason to worry. But it is interesting to know how our
life would be like without internet, right? Life without internet will be a lot more different than it is today. If there is no
internet, people will relate to the nature and their environment better. So, according to me internet is not necessary for
our day to day life.

S. Arshitha, VII A

88 SAN KAM - Kaleidescope - 2019-20

PRIMARY, MIDDLE SCHOOL & SECONDARY

The day at SAN begins with the Morning Prayer. This daily feature serves as stage for the
students to overcome their inhibitions and express their talent. Thematic Assembly was
introduced this year which help in creating an awareness among children regarding National
and International days like World blood donor day, International dance day, World tradition day,
World humanitarian day, World senior citizens day etc.

89 SAN KAM - Kaleidescope - 2019-20 April 2019

HEALTH AND HYGIENE (08.04.2019) – CLASS VIII WOMEN EMPOWERMENT (15.04.2019) – CLASS VII B

World Health Day 2019 was celebrated all “Women’s empowerment is intertwined with
over the world on April 7th. Keeping this in respect for human rights.” We belong to a
mind, students of class 8 talked about ‘Health country where in our teachings women are
and Hygiene’. They expressed the result of given the place of Goddess. However, they
poor hygiene and the need to follow a proper are treated very badly in many departments.
routine to keep sickness at bay. Few facts Discrimination on the basis of gender is
were given on the importance of keeping something which will bring cultural, social,
one’s body healthy and the important role economic and educational differences in the
that hygiene plays in the same. The speech society, that will push back the growth of the
given by the class teacher Mrs. Vasundara Nation. In order to enlighten the students,
created awareness in the minds of all both boys and girls on the theme, students
students concerning the do’s and don’ts in of class VII B grabbed the opportunity with
our daily life, to maintain a hale and healthy both hands to put forth the message
existence. strongly. Their thought for the day, speech
and the class teacher Mrs. Vijayalakshmi’s words,
proposed loud and clear that in order to build a
strong society every section of the society should be
developed.

HERITAGE AND INDIA (22.04.2019) –CLASS VI A MOTHER EARTH DAY (26.04.2019) –CLASS VI B

World Heritage Day falls on 18th April. To Earth Day is celebrated on April 22nd. Students of
commemorate the occasion Class VI A headed Class VI B conducted the assembly with the theme
the assembly with the theme ‘Heritage and India’. ‘Mother Earth’. The students were enlightened about
India is a land of rich heritage. We feel great pride the need to protect our environment, the birds,
just by talking about it. The morning encouraged animals and trees, saving the natural resources,
the students to know more about our rich heritage etc. It was explained why the term ‘Mother Earth’
and garner great satisfaction that regardless of is used and we as its inhabitants, what should be
ages gone by, regardless of the hardships endured our contribution to make this a better place to live.
by the people under foreign rule, we were able With emerging consciousness globally on certain
preserve our culture and heritage for the world pressing issues, we at San Academy, Kamakotinagar
to see. Thought provoking speeches were given did not want to fall behind. Taking the stage were
by both the class teacher Ms.Nityasundari and not only the students but also the class teacher,
Principal Ms.Ganga Natarajan. Ms.Vijayalakshmi propagating the agenda to ‘Save
the Earth’.

90 SAN KAM - Kaleidescope - 2019-20 June 2019

WORLD ENVIRONMENT DAY - 11.06.19 Blue Planet - WORLD OCEAN DAY
- 12.06.19
A Special assembly was conducted by students of
Class III B of San Academy Kamakoti nagar to mark World Ocean Day for Schools is a day to celebrate
the ‘World Environment Day’ 2019. Discussions the role the ocean plays in all our lives, to learn
and speeches on the plan to support sustainable more about our blue planet. Students of Class II C
life on this beautiful earth were well presented by conducted a knowledgeable assembly by present-
the students. Students enacted a very informative ing a role play where children, along with teachers
skit which provided an opportunity to broaden the guidance presented how humans are related with
basis for an enlightened opinion and responsible the ocean.
conduct by individuals in enhancing the environ-
ment.

Humane - WORLD DAY AGAINST CHILD
LABOUR - 13.06.19

A Special assembly was conducted by students of
Class III B of San Academy Kamakoti nagar to mark
the ‘World Environment Day’ 2019. Discussions and
speeches on the plan to support sustainable life
on this beautiful earth were well presented by the
students. Students enacted a very informative skit
which provided an opportunity to broaden the basis
for an enlightened opinion and responsible conduct
by individuals in enhancing the environment.

91 SAN KAM - Kaleidescope - 2019-20 June 2019

Inspiring - INTERNATIONAL YOGA DAY - 21.06.2019

Yoga is an invaluable gift of India’s ancient tradition. It embodies unity of mind and body; thought and
action; restraint and fulfilment; harmony between man and nature; a holistic approach to health and well-
being. It is not about exercise but to discover the sense of oneness with yourself, the world and the nature.
By changing our lifestyle and creating consciousness, it can help in well being.
The purpose of International Yoga Day is to promote yoga and endeavor towards making it a part and
parcel of everyone’s daily routine. It was celebrated by the students and teachers at San Academy, Kamakoti
Nagar with great enthusiasm. Every child from the Nursery to Class 9 was an enthusiastic participant.

Special assembly was conducted to commemorate the occasion and every student participated
actively in the program. Thought for the day, facts and speeches threw light on the topic. According to their
ages, children were taught several asanas. Students spoke about the importance of exercises and the need
to keep our mind and body healthy.
Yoga instructor guided students from classes 6 to 9. Starting from the warm up – pranayama, followed
by several breathing exercises and some standing / sitting asanas, he was able to capture the students’
attention. The importance of these, were also explained simultaneously. He encouraged students to practice
regular yoga to remain fit and improve concentration. It was all together a rejuvenating experience for the
participants. Children got the chance to know how yoga embodies unity of mind and body.

92 SAN KAM - Kaleidescope - 2019-20 June 2019

Heart rending - WORLD BLOOD DONOR
DAY - 24.06.19

World blood donor day was observed in the
special assembly organized by Class VII B in
order to motivate all students to thank the blood
donors, promote voluntary blood donations to
ensure the sufficient blood supplies worldwide.
Students along with teachers well presented
the assembly to uphold the importance of
blood donation. Principal Mrs Ganga Natarajan
encouraged the students to explain parents
about the importance of blood donation.

Graceful - INTERNATIONAL DANCE DAY
- 25.6.2019

International Dance Day seeks to promote the
art of dance around the world. In San Academy,
Kamakoti Nagar, to give knowledge about
different forms of dance special assembly was
hosted by students of Class IVA where they
demonstrated different dance forms. Students
along with the class teacher took tremendous
effort to convey the different art forms and it was
well appreciated.

93 SAN KAM - Kaleidescope - 2019-20 June 2019

Nutrious - WORLD MILK DAY - 26.06.19

World Milk day is a day filled with dairy related
activities all around the world. In our small
world, our primary tots of Class IA took forward
the assembly highlighting the importance of
dairy products in day today life. The young minds
grabbed all our attention by their phenomenal
rendering of a song on “World Milk Day”.

Authentic - WORLD TRADITION DAY - Beware - INTERNATIONAL DAY AGAINST
27.6.2019 DRUG ABUSE - 28.06.19

A tradition is a belief or behaviour passed down International  Day  against  drug abuse  and the
within a group or society with symbolic meaning. illegal drug trade. Students of Class VIII united
Students of Class IVB redesigned the traditional day themselves and organized a special assembly
by presenting a fashion show with lot of innovative portraying the black shades of drug usage and how
and fruitful ideas to retain our traditional identity. to stay strong in spite of many distractions in front
of them through a mime.

94 SAN KAM - Kaleidescope - 2019-20 July 2019

NATIONAL DOCTOR'S DAY - 01.07.19

In a special assembly, students expressed their desire to
become a doctor when they grow up. Students of Class IXA talked of
several important doctors from various fields including, Dr. B. C. Roy,
Dr. Jayachandran, Dr. Rajan Santhosham, Dr. Cherian and Dr. Naresh
Trehan. The class teacher slowly unfolded the leap strides taken
in the field of medicine from Ancient times. She enlightened the
audience on several modern doctors and how their dedication has
created wonders. Other events included a mime programme which
commemorated the entire medical industry and its advancements
and the efforts the whole team put in not only bettering people’s
lives through technology but also in case of emergencies.
There was also an inspirational speech by the Principal, Mrs.
Ganga Natarajan, who encouraged the students to chart out a future
for themselves and act accordingly.
Theme of Doctor’s Day 2019 was “Zero tolerance to violence
against doctors and clinical establishment” and at the end of the day
the students were able to recognise and appreciate the significant
roles and responsibilities of doctors.

INTERNATIONAL JOKE DAY - 02.07.19

Laughter is a universally recognized expression of amusement,
and joke telling can become a professional gig for those that truly
have the humorous touch. International Joke Day is the perfect day
to let out all of the guffaw producing jokes you’ve collected over
the years, sharing them with friends. This is what the students of
Class VA produced when they conducted the special assembly.
Students entertained by telling humorous jokes in Tamil, English and
Hindi and brought laughter in each and every student and teacher
present there. Our Principal stressed on the fact that ‘Laughter is
best medicine’ and reminded the students the value of laughter and
the difference it can make to our lives.

WORLD CHOCOLATE DAY - 04.07.19

Mesmerizing word of each and every child is chocolate. Flavouring
the day celebrated as World Chocolate Day, students of Class VB
conducted a special assembly. Several interesting facts including some
mouth-watering ones were shared with the chocolate loving group.
Students also informed their audience that there is some benefit in
having dark chocolate. The speech by Pooja was informative. The
well planned skit was quite entertaining.

95 SAN KAM - Kaleidescope - 2019-20 July 2019

WORLD POPULATION DAY -15.07.19

San Academy Kamakoti Nagar observed World Population
day on 15.07.2019. As we know this day is celebrated to increase the
awareness of the people towards the worldwide population issues,
we decided to ignite the young minds. the Students of Class VIII A
conducted the special assembly. Students were alerted to the fact
that the growth in population is leading to numerous problems such
as unemployment, poverty, rising global warming, deforestation,
rise in pollution level, and rapid consumption of natural resources,
deforestation and decline in biodiversity.
Several charts and posters were made by students to illustrate
how the rapid growth in population has become a huge challenge
for the development of countries. It has resulted in the quick
depletion of natural resources and this is dangerous as it hampers
sustainable development. Students also shared their knowledge on
the consequences of increasing population and how it affects the
overall development plans and programmes. Principal, Mrs. Ganga
Natarajan threw light on the fact that we should channelize human
resource which is available in plenty and use it for the advantage of
the country. The session was informative and thought provoking for
the students.

WORLD YOUTH SKILL DAY - 16.07.19

Students of Class IVA clearly demonstrated the importance of
celebrating World youth skill day. This assembly showcased that job
creation is vital to the survival of youth across the world. The thought
of the day by Neha enlightened all that for achieving the desired fruit
one needs to work hard. Speeches by Rithvik and Sanjive looked into
the problem of unemployment, its cause and ways to counter attack
it. Towards the end of the programme, thought provoking ideas
were provided to uplift youth skill.

NELSON MANDELA DAY - 18.07.19

Nelson Mandela International Day is an annual international day in
honour of Nelson Mandela, and to do the same, Class IVB students
organized a special assembly and highlighted his contribution towards
African people. A very informative speech on Nelson Mandela was
given by Shravan. As the theme was on a freedom fighter, the class
teacher enlightened the students regarding the India Independence
Act – 1947.

96 SAN KAM - Kaleidescope - 2019-20 July 2019

World Nature Conversation Day - 19.07.19

World Nature Conservation Day was observed on the 19th of
July 2019. It recognizes that a healthy environment is the foundation
for a stable and productive society and to ensure the well-being of
present and future generations, we all must participate to protect,
conserve, and sustainably manage our natural resources. Students of
Class VIIA conducted the special assembly.
Speeches and talks were given to educate the students on how
we all depend on natural resources like water, air, soil, minerals, trees,
animals, food, and gas to live our daily lives. And thus we must strive
in preserving our natural resources for future generation to sustain
human species. It was ingrained in the students’ mind that to keep
the balance in the natural world, we must also help various species to
continue to exist.
Posters and charts were made and displayed to show how
human greediness is leading to mass extinctions in the near future.
Our main objective was in increasing awareness about and protecting
the natural resources that the Earth is bestowed with. It is necessary to
understand what ‘Sustainability’ truly means and also it is important to
inculcate environment-friendly habits to lead a Green Lifestyle. Several
scenarios from the present situation, like the omnipresent water
shortage, global warming, storms, was touched upon so that the
children may be able to relate themselves to the impending disaster if
nature is not conserved, and why we should not waste them. 
At the end of the day the children realized that they must
make a conscious effort to contribute to the local, national, and global
efforts in conserving nature and the benefit the present and future
generations.

International Tiger Day - 22.07.19

There is nothing like the thrill of walking through the jungle looking for
a tiger and knowing they could be watching you already.
  International Tiger Day, is an annual celebration to raise
awareness for tiger conservation, held annually on 29 July. The goal
of the day is to promote a global system for protecting the natural
habitats of tigers and to raise public awareness and support for tiger
conservation issues. Tiger, being our National animal, San Academy
Kamakoti Nagar created an awareness programme for the protection
of tigers on 22nd July.
Students of Class VIIB conducted the special assembly. The
students were familiarized with the condition of this endangered
animal. The causes of the decline in their numbers like poaching,
habitat loss and climate change was discussed. With ‘World population
day’ recently celebrated students could correlate between the two
and were able to conclude that with people and tiger competing for
space, forests shrank and prey animals depleted.

97 SAN KAM - Kaleidescope - 2019-20 Aug 2019

World Senior citizens day - 02.08.2019

The World Senior Citizens Day is celebrated on 21st of August
every year. We at San Academy set aside August 2nd to raise awareness
about the factors and issues affecting older people, such as deterioration
with age and to examine issues that affect their lives such as abuse of
elderly people. Opportunities were created in order to let the students
recognize and appreciate the contributions that older people make to
society. 

The special assembly conducted by class VIA, centred on this theme
wholeheartedly. They presented a well scripted and enacted skit to raise
awareness about the conditions of the people who are old and those
who are entering old age. They even touched upon the deteriorating
relationship with grandparents and the measures that can be taken to
rectify it. Their messages were strengthened by thought provoking charts.

International day of Friendship - 05.08.2019

As the saying goes “Friend in need is a friend indeed” which
means that whenever you are in need, a friend is there for you. Friendship
Day is celebrated on the first Sunday of August. This year in 2019, it was
celebrated on 4 August in the special assembly conducted by Class VI B.

San Academy Kamakoti Nagar had a cheerful look on Monday (5.08.2019)
with students wishing each other and the teachers on the occasion.
Hands could be seen with several friendship bands of varied designs
and colours. A beautiful poem on Friends was recited by Joshitha.
Shakespeare in his poem ‘Friends and Flatters’ explicitly brings out the
difference between the real friend, who is the one to stand with us in our
ups and downs and flatterers, who stand with us only when we stand. In
a beautifully conducted group discussion titled – “Is friendship relation
is more precious than a blood relation?” – the students put forth their
strong points and made it quite interesting for the audience.

Hiroshima day - 06.08.2019

Hiroshima Day is observed on 6th August. It is the day when in 1945
an atomic bomb was dropped in the city of Hiroshima, Japan. On
this day first time use of nuclear weapon was seen. To enlighten the
importance of the day. Class VB students enlightened the audience
regarding the before and after effects of nuclear attacks happened
of this event. Students also highlighted that in the current scenario
Hiroshima day’s focus is for anti-war and anti-nuclear discussions
and demonstrations.

98 SAN KAM - Kaleidescope - 2019-20 July 2019

Quit India Movement - 08.08.2019

Being the month of our Independence Day, many activities related to
the occasion was held by many classes. Class IVA, came with a thematic
assembly of Quit India Movement. The students enacted a small skit
to demonstrate the movement, which made the students realize the
efforts put in by our leaders during the period. Principal appreciated
the students and the class teacher’s efforts and highlighted the
importance of ahimsa in each and every one of them.

International Youth Day - 13.08.2019

International Youth Day is an awareness day designated by the United
Nations. The purpose of the day is to draw attention to a given set
of cultural and legal issues surrounding youth. This theme was taken
over by Class IVB for their assembly. Students along with class teacher
highlighted the efforts to make education more relevant, equitable and
inclusive for all youth, including efforts by youth themselves. Students
also listed out the youth strength in the world as a whole and how
they can be used in right channels.

International Day Of The World’s Indigenous People - 16.08.2019

The International Day of the World’s Indigenous People is observed on
9th August each year to front up and protect the rights of the world’s
indigenous population. This event also recognizes the achievements
and contributions that indigenous people make to improve world
issues such as environmental protection. Having been given a tough
topic beyond their comprehension, the students of Class VIC rose up
to the challenge and presented a splendid thematic assembly based
on the topic.

World Humanitarian Day-19.8.2019

World Humanitarian Day (WHD) is held every year on 19 August
to pay tribute to aid workers who risk their lives in humanitarian
service, and to rally support for people affected by crises around the
world.
Students of Class VI D, did extensive study and during the
assembly on this day informed their peer group that over 130 million
people throughout the world are currently in crisis, either through war
or natural disasters and are in need of humanitarian aid.

With the help of a mime, they displayed that kindness goes a long way in helping others in need. Their
commanding performance sent the message that strength, power and perseverance when added to kindness,
moulds dedicated heroes.

99 SAN KAM - Kaleidescope - 2019-20 Aug 2019

Sadbavana Divas or Harmony Day - 20.08.2019

Sadbavana Divas or Harmony Day was the theme taken up by Class
IIIB students. It is celebrated in the remembrance of birth commemoration
of the youngest Prime Minister of India, Rajiv Gandhi. Students prepared
various charts to explain his role and contribution to our motherland.
Students along with teachers carved the inner meaning of Sadbavana divas -
Means having good feelings for other’s.

Jal Sakthi Abhiyan - 22.08.2019

In a talk given by a Middle School Teacher, she addressed the importance of the objectives of JAL SAKTHI
ABHIYAN. The talk started with a small interactive session where students were asked the use of water and water
resources. The children were even asked why the mammoth water storage in the sea/ocean is not usable. Next the
focus shifted to the major 5 aspects – water conservation and rainwater harvesting; renovation of traditional and
other water bodies; reuse of water and recharging of structures; watershed development; and intensive afforestation.
 
After having faced an acute water shortage during summer, the students were able to relate to the information
being shared. The fact that though 70% of Earth is made up of water, only 2.5 of them is fresh and only a fraction
of this is available for human use was explained to the students. Ideas on how they could save potable water and
spread awareness to near and dear ones were discussed. Towards the end the speaker enlightened the children
regarding the crisis faced by Cape Town and urged the students to preserve the water bodies so that Chennai do not
travel the same path.

Women’s Equality Day - 26.08.2019

A gender-equal society would be one where the word ‘gender’ does
not exist: where everyone can be themselves. 
Women’s Equality Day commemorates 26th August 1920 when votes
to women officially became part of the US constitution. This day marks a
turning point in the history of the struggle for equal treatment of women
and women’s rights. As it was believed that woman’s inferior status in society
was completely logical and reasonable; women were ‘beautiful’ and ‘not fit
for serious employment’, was seriously believed, it took tremendous effort
of great women to prove that these views are wrong.
Students of Class IXA presented a very thought provoking thematic
assembly by asserting that women were indeed capable of great deeds and
they deserve to be treated as an equal to man in all fields and purposes, if
not better. Achievements of several women were talked about the necessity
to provide women across the globe with equal opportunities to education
and employment highlighted. Their debate on – Do women have equal pay
like men? – exhibited the in depth research they had done on the topic.
At the end of the day the students realized that discrimination and
stereotyping of women needs to be curtailed and it is essential to think about
treating people (men and women) as equals. It is critical that supporting
women’s empowerment projects in developing countries is given a big boost.

100 SAN KAM - Kaleidescope - 2019-20 Aug 2019

Small Scale Industries - 27.08.2019

Small scale industries are those industries in which manufacturing, providing
services, productions are done on a small scale or micro scale. They are the
livelihood for many Indians. To pay a tribute to these industries students of
Class IIIC dedicated their assembly to them. The captured the theme that
these are the industrial undertakings having fixed investment in plant and
machinery. Students with the help of teachers got us the overall picture of
many small scale industries and its importance in our locality and why it has
to be uplifted. An informative assembly.

National Sports Day - 29.08.2019

The National Sports Day in India (also called Rashtriya Khel Divas) is
celebrated on 29th  August every year with a lot of enthusiasm and
sportsmanship. This day was well celebrated by the students of Class
VA. They highlighted the contributions of Dhyan Chand a legendary
hockey player who brought glory to the nation by winning three
Olympic gold medals. Students presented the assembly with beautiful
charts and speech.

International Day of Girl Child - 11.10.2019

International Day of the Girl Child is an international observance day declared by the United Nations; it
is also called the Day of Girls. Class VI A withered their thoughts by their phenomenal speeches and role play
by group of students. Students took home lot of pride being independent girl and boys felt being supportive to
women in their class and society.