The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.

OttawaJazzFest_MediaMarketingReport_2016

Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by graphics, 2018-01-30 09:27:36

OttawaJazzFest_MediaMarketingReport_2016

OttawaJazzFest_MediaMarketingReport_2016

Keywords: Ottawa,Jazz,Media,Marketing,Report,Sponsorship

MEDIA
MARKETING
REPORT

2016 TD Ottawa Jazz Festival

© Photo Andre Gagne

602-294 Albert Street, Ottawa, Ontario, K1P 6E6
T: 613-241-2633 │ OttawaJazzFestival.com
Registered Charitable Organization #:
11907-1637-RR0001


TD Ottawa Jazz Festival
June 22 - July 3, 2016

2016 “Rare in delivering lineups that seem
to get better and better every year,
OVERVIEW it’s truly a luxury to live in a city
where the jazz festival has remained
In 2016, the 12 day festival unequivocally a jazz festival...”
showcased 875 MUSICIANS – John Kelman, All About Jazz
performing in 116 CONCERTS in
the heart of the Nation’s Capital 2
on 9 DIFFERENT STAGES in 10
UNIQUE SERIES. O’ CANADA!

To celebrate and encourage the richness
of music in Canada, more than 500 of the
musicians were Canadian including Grammy
Award winner Sarah McLachlan and Golden
Globe winner Buffy Sainte-Marie.

1 3 TOP 20
FESTIVALS
4 NEW SERIES & EVENTS IN
ONTARIO
Jazz 2016 was a celebration of some new vibes
and new concepts. Free Jibber Jazz Jam Alongs The Province of Ontario
at Confederation Park’s fountain, an intimate continues to bestow a Level
Discovery Series at the National Arts Centre of Distinction in the top 20
Back Stage, a Jazz Warriors Series at the NAC category to the TD Ottawa
Theatre and a free Mystery Series all made Jazz Festival.
2016 a truly innovative year.

01 2016 Media Marketing Report │ TD Ottawa Jazz Festival


8 FREE 7 INNOVATIVE
CONCERTS PROGRAMMING

In 2016, the OJF The OJF presents diverse, daring and cutting edge
presented 52 free programming that attracts audiences of all ages.
concerts out of 116!
“The TD Ottawa Jazz Festival has always been a
place to discover new music with enough choice
and selection overlap you’d need a couple of
clones to really take in all the festival has to offer
each year.” – Andre Gagne, Ottawa Life

4 SOCIAL MEDIA 6 © Chris Parker
With over 17K followers on Twitter and 7K
likes on Facebook, the Festival has grown 4 SOLD OUT
tremendously throughout the last few years SERIES
on Social Media. A new OttawaJazz Instagram
account was created in 2016, drawing 1,500+ The three series held at the
followers in only a few months. National Arts Centre and the
OLG After Dark series at the
Top June Media Tweet Tartan Homes Stage were
completely sold-out.
earned 6,040 impressions
5
Mayor @JimWatsonOttawa
just declared June 23, 2016 SALES
#CatherineOGradyDay! RECORD
Congrats @jazzcog!
Early bird pass and ticket
sales were higher than ever
in 2016. Gold circle tickets
sold out in record time.

22001616MMeeddiaiaMMaarkrkeetitninggRReeppoortrt││TTDDOOttatawwaaJJaazzzzFFeesstitvivaal l 02


© Brian Goldschmied

FRONTLINE © Brian Goldschmied

BOARD OF VOLUNTEERS
DIRECTORS
More than 640 people dedicate their time, services and expertise to
President the Festival. Volunteers eagerly anticipate the start of the Festival
Gavin McLintock and often take vacation time, some traveling from overseas, to
participate. Their contributions result in a collective 24,000 hours of
Past President volunteer time.
Louise Meagher
2016 STAFF Artist Liaisons
Vice President Matt Gower, Caalvin Jno-Finn, Ben Emond
Rick Brooks Executive Producer
Catherine O’Grady Special Events Coordinator
Volunteer Co-ordinator Cheryl Mihalin
John Cvetan Programming Manager
Petr Cancura Media & Marketing Coordinator
Treasurer JM Francheteau
Lee Tessmer Director of Marketing &
Partnerships Media & Marketing Assistant
Secretary Suzan Zilahi Nick Schiavo
Tom Burrow
Sponsorship & Business Operations Coordinators
Executive Producer Development Manager Chris Elms, Charles Meness, Jordan David
Catherine O’Grady Dawson Hamilton
Box Office
Chantal Smith, Eric Sladic, Artistic Associate & Julian Selody, Joey Gagnon,
Peter Stephens, Poppy Vineberg Programming Coordinator Lovedyne Dumont
Jacqie MacKay
© Chris Parker Bookkeeper
Creative Director & Webmaster Jacqueline Embleton
Julie-Anne Madore
Production Manager & Backline Coordinator
Graphic Design Assistant Grant Young
Su-Hui Chu
Community Coordinator & Artist Liaison
Operations Manager Julie Campbell
Adi Cajo

03 © Photos in report by Julie-Anne Madore except where otherwise indicated.

2016 Media Marketing Report │ TD Ottawa Jazz Festival


SUPPORT 2016 SPONSORS

Supportive sponsors like TD, OLG and the

CF Rideau Centre, and funders like Celebrate
Ontario, allow the Festival to present a lineup
that focuses on artistry above all else.

DONORS & FRIENDS

Donors and Friends of the Festival contribute PANTONE CMYK 1COL
nearly $30,000 toward our youth and jazz
outreach programs. This funding is critical to Black
the overall success of the event. It provides the CMYK
resources to allow the Festival to continue to Pantone
reach out to up-and-coming young jazz artists
and to give them an opportunity to participate
in the Festival in a dynamic way.

Outreach programs include:

a Youth Series
a TD Jazz Youth Summit
a Stingray Rising Stars
a Presenting more than 500 local and

Canadian jazz musicians who rely on

festivals for their livelihood

GOVERNMENT SRE SRE
SUPPORT
EMBAJADA DE MÉXICO EMBAJADA DE MÉXICO
The Festival continues to receive vital support EN CANADÁEN CANADÁ
from all levels of government. We gratefully
acknowledge the following: SRE D.E. Systems Ltd

Federal: EMBAJADA DE MÉXICO solutions driven
EN CANADÁ by technology
a Department of Canadian Heritage
a National Capital Commission

Provincial:

a Trillium Foundation (Ontario)
a Yours to Discover Ontario
a Ontario Arts Council
a Employment Ontario

Municipal:

a City of Ottawa
a Community Fountation of Ottawa

2016 Media Marketing Report │ TD Ottawa Jazz Festival 04


LAUNCH © Suzan Zilahi

Wednesday March 16th, 2016 CBC’s Alan Neal and the Festival’s Programming
Manager Petr Cancura on All In A Day
For two years now, the Festival’s lineup has
been announced live on CBC’s All In A Day – Top Tweet earned 12.7K impressions
Ottawa’s #1 drive home show with host Alan
Neal. The announcement was also streamed Ottawa Jazz Festival @OttawaJazz
live on ottawajazzfestival.com. Check the lineup! We have a ltd number
of Early Bird Passes available at last year’s
According to Google Analytics, the website price! ottawajazzfestival.com
earned 4,119 visits that day, that’s 20% more
than in 2015. Top Facebook Post reached 11.6K people

Launch activity resulted in 67K+ Twitter Ottawa Jazz Festival │ March 16, 2016
impressions and a Facebook Total Reach The 2016 line-up is on our website now!
of more than 32K. Exclaim! News, Ottawa Buy your early bird passes before they are
Magazine, Ottawa Tourism as well as all gone! ottawajazzfestival.com
numerous festivals and international artists
participated in the conversation online. 455 Likes 183 Comments 110 Shares

Our launch announcement was covered on Photo below: Programming Manager Petr Cancura
local CBC News and then appeared online discusses the 2016 lineup on TV with Adrian
nationally. Articles also appeared in the Harewood on CBC Ottawa News. © Suzan Zilahi
Ottawa Sun, the Ottawa Citizen, Ottawa Start
and Ottawa Life just to name a few.

05 2016 Media Marketing Report │ TD Ottawa Jazz Festival


BIG-NAME JAZZ RETURNS

Wilson, Marsalis among stars C1

YOU LEGALLY SPEAKING LTDLBHAPRRRAGOIVAGNOIEpNLKhRGIEeFnEom

High school production inspires C2 BeoydeiseRs itoa kBe1on

new meaning C2

T H U R S D AY, M A R C H 1 7, 2 0 1 6 MARCH 1 7, 2 0 O1 6T T A W A CITIZEN ESTABLISHED IN 1845 SECTION C
O T TAWA C I T I Z E N T H U R S D AY,

OPINION BASE RENOS GO UNUSED

G L AV I N The Liberal government spent millions of dollars renovating
buildings at six military bases to house Syrian refugees, but none
Inside Obama’s of them needed to use the facilities. Hundreds of soldiers were
foreign policy moved to accommodate as many as 6,200 newcomers. NP4
depravity A9

CITY COUNCILLOR RETURNS FIRE Ottawa Citizen front page top banner and YOU section cover. Thursday, March 17,

Sarah McLachlan will play the TD Ottawa Jazz Festival, which runs June 23 to July 3. Venues include the National Arts Centre and Confederation Park.  FILES

ALL PETER HUM T D OT TAWA
I N T E R NAT I O NA L
Big-name jazz will return to the JA Z Z F E ST I VA L
2016 TD Ottawa Jazz Festival’s
mainstage in June, along with When: June 23 to July 3
Sarah McLachlan, Buffy Sainte- Where: National Arts Centre,
Marie and Brian Wilson. Confederation Park, Marion
Dewar Plaza
In recent years, the festival has Tickets and information:
ottawajazzfestival.com
THAT tended to fill its main concert se- Buffy Sainte-Marie
ries in Confederation Park with National Arts Centre. For the first
mainstream and crossover acts. time, the festival is making use of
This year’s event, which will run the NAC’s Theatre, where it will
from June 23 to July 3, will fea- hold three shows.
ture three all-star jazz groups
in the park — the eight-piece SF The first, on June 22, a day before
Jazz Collective, playing Michael the festival officially gets under-
Jackson songs and original music,
on June 24; the Jazz at Lincoln

Center Orchestra with Wynton way, features Los Angeles-based
JAAttZemptZed murder charge Tough sell for BrownTONYCALDWELL
Marsalis on June 29; and pianist saxophonist Kamasi Washington,
Coun. Jody Mitic, practiCshinickgCaotretahweitShtbiatstssisvt CilhlreisS- hooting Ranges on Wednwehsodseaygr,osoavyysthtrheee-CrDe rieslease
nothing wrong with hisBttilaaandlMekocinBnrJigudneaeabn3od0.durtumhmisernBreiawn handguns on social medilTaahs.te yEeApair4c. Wwaasshaincgrtitoincsh’ afasvaoluortiotef
Five other mainstage concerts hip-hop cachet because he has
will showcase singer-songwrit- Brian Wilson
NEWS worked with such artists as Ken-

ers. Vancouver-based McLachlan drick Lamar, Lauryn Hill, Snoop

performs June 25. High-ener- fellow Beach Boys Al Jardine and Dogg and Thundercat.

gy R&B star Sharon Jones and Blondie Chaplin. On June 25, the reunited quar-

on carbon pricing to PCsOnJune23blueslegendsElvin

Bishop and harmonica king Char-
lie Musselwhite take the main-
stage, and organizers say they may
CITY follows attack on teen girlthe Dap-Kings return to the park tet of guitarist John Scofield and
June 26. Sainte-Marie, the winner saxophonist Joe Lovano, another
of this year’s Polaris Prize, plays jazz all-star formation, plays the
June 28. NAC Theatre.
Genre giants Marsalis, CoreaBail fix needed U.S. rapper and musician Michael
have a surprise to announce for On July 2, the London, U.K.-
to ease jail FrTahnetiipnlvaeystJigualtyio2n, awnadsocnoJnutilnyu3-,
TOM SPEARS that day, as well. On June 27, the based singer Stacey Kent, who

top fest alongside pop of Sarahcrunch, Naqvi ifnorgmanedr mBeoarcehcBhaorygWesiclsoounldwbielllcaeidl-, always popular Trombone Shorty tpievrefsorremaleidzea,tatshtehofessethivaabliitnua2l014,
The day after a 16-year-old girl was peborliacteestahied.50th anniversary of his will be back. Tbroirniegss thryertosmfigouortehousot uwnhdatttoothe
McLachlan, Brian Wilsonsays A4
stabbed near a tent village before claOsnsiWc PedetnSesoduanyd, sGaltbinuemaubpyopleicre- As in previous years, the festival dTohewaitrhea. leader who wants to
she fought off her attacker, Gatin- sfoaridmBineglliftoiyn’sitlsaestnktinreotwy,njoaidnderdebsys is staging indoor concerts at the fSiEgEhtJ AcZliZmOaNteCc3hange by making

Patches the eau police charged a 49-year-old was at Le Gîte Ami, a nearby home- greenhouse-gas emitters pay.
with trying to kill her near a tent less shelter at 85 Rue Morin. Those loyalists were stunned

village behind her school. A relative of Bellfoy told the when leader Patrick Brown
Marc Bellfoy, 49, was charged
Cwiittihzeandtrhuagtatdhd2eimc0taion1nh6faodrMsyteraeurgsdgbleuidat │aOntTntaoDwuanOscpedetehtcihsafsowurpupasoirntJginacaazrmbzoanjForestival
Wednesday afternoon with at-
Film warns of songbirds’ declinepupthawsand MD AaV IrDkMTReHEEtEESinVSEgELNYRGeEpRort 06

recovers A3
tempted murder, two counts of declined to comment further. Me- You know who liked the envi- permits to fight climate change.
aggravated assault, assault with lissa Bellfoy said she hasn’t spoken ronmenWth?eRno: nMaalrdchR1e8atgoa2n1and
His own MPPs didn’t see it com-
PATRICK LANGSTON athiwnegasptoocnomaned, atkwinod ochf caarngaersy oinf toRheeardcionugsSinileinc2e0oyfetahresS, bountgbaircdk, MargarWethTerhea: tBcyhTeorw,nthe eCiOnenmtaario ing, let alone the rank and file.
bthreaccohailnmgibnaeilocf othnediptliaonnest’isnetchoe- tbhyeBnrihdegedtrSatnuktchebauvriyl,yonane dofwthaes ProgresInsfivoermCaotniosne:r6va13ti-7v8e9s-a3r4e56, Brown had opposed carbon pric-
It’s a heartbreaking piece of foot- asyttsateckmo.f a girl who was on her way ocoftmenmveinotleantotrws hinenthheefwilmas, ilnetoRxyi- very kebeyntotwonhea.cvae you realize.
ing when he ran for the leader-


AUDIENCE © Photo Andre Gagne
DEMOGRAPHICS

AUDIENCE RESIDENCE

Locals - 209,144 (82%)
Ontario
(beyond 100k) = 11,481 (5%)
Other Canada - 20,447 (8%)
United States - 5,029 (2%)
International - 7,874 (3%)

254K +

attended the

Festival in 2016

50% 50% 35% 31% 22% 55% of
18% 78%
tourists
18 - 34 35 - 54 55 - 64 Locals
Tourists stayed in
hotels
100km + from Ottawa

73.7% post-secondary $ 55% 19% of tourists
education or above 75K + income
stated they will return to

visit the 2017 Festival

For the second year, visits from the US and overseas 2016 statistics compiled by
substantially increased to return to numbers experienced Survey Monkey
prior to 2011 as a result of the 2008 economic downturn.

07 2016 Media Marketing Report │ TD Ottawa Jazz Festival


MARKETING ECONOMIC
IMPACT*
BUDGET
$825,000 (including in-kind) $22 $25 $47
million + million = million
CAMPAIGN TOTAL REACH Tourists Locals Total

407+ million*

*amount derived from total of pages 9 -10 *Based on 2016 spending.
Statistics compiled by
PROMO MATERIALS Survey Monkey

© Suzan Zilahi

Brochure design by Julie-Anne Madore World’s Best
Tourism Brochure
PROGRAM BOOK PROMO VIDEO Awards - 2015
Regional Winner
Printed on recycled FSC-certified Our promotional video received
paper, our 72 pages program a total of 5,201 views through The International Association
book was widely distributed in our website and social media of Professional Brochure
key locations in the Ottawa region channels. The 30-second Distributors (IAPBD) revealed
and handed out extensively at the montage announced our major the winners of the annual
Festival to our attendees. It was headliners for the 2016 Festival World’s Best Brochure
also available online as a flip book. and appeared on CBC’s website. Contest in late 2015. In
total, 77 brochures were
POSTERS BROCHURE nominated from across
the United States, Mexico,
Three thousand copies of the This year, 50,000 brochures were Canada and Western Europe.
Festival’s 11” x 17” poster, designed printed and distributed accross The 2015 TD Ottawa Jazz
by Sean Brady, were distributed the Ottawa/Gatineau region, Festival brochure, chosen by
accross the National Capital Kingston, Rochester, Syracuse, the CTM Media Group, was
Region. Buffalo, Niagara Falls (NY). awarded Regional Winner for

its design and layout!

2016 Media Marketing Report │ TD Ottawa Jazz Festival 08


ADVERTISING CAMPAIGN
In 2016, the Festival’s worldwide advertising reach was more than 407 million
Amount derived from the total of these two pages

LOCAL ADVERTISING Insertion Period Circulation Insertions Total

Media Outlet April - June 520,900 14 7,292,600
Print Only Jan - June 60,000 4 240,000
Ottawa Citizen
Metro Ottawa: 2 page centre-spread & 1" pop-up May - June 65,000 1 65,000
Magazines
Where Magazine May - June 623,900 24,000,000
Transit June 147,680 1.5 221,520
OC Transpo / Pattison - King
Astral Media Outdoor - airport carousel April - June 19 3,064
Local & Tourism Displays
Ottawa ExploreBoard Network June 22,000 42 924,000
Radio June 145,000 50 7,250,000
CBC Radio One, 91.5 FM promos June 155,000 50 7,750,000
Majic 100.3 June 100,000 60 6,000,000
CFRA 580 June 150,000 48 7,200,000
CHEZ 106 university
Rouge FM June 306
radio
CHUO June 41,903 60 2,514,000
June 150,000 504 75,600,000
Jewel 98.5
CHIN Radio (podcast info not available) Impressions Click Rate %
Online Advertising
Ottawa Citizen - mobile campaign June - July 175,249 0.63
Ottawa Start June 80,000
Ottawa Showbox 37,800
TV
CBC Television promos June 324,000

Arrivals carousel banner at
the Ottawa Macdonald-Cartier
International Airport.

© Suzan Zilahi

09 2016 Media Marketing Report │ TD Ottawa Jazz Festival


Bus signage is a
powerful medium to
encourage word of
mouth and is a veritable
roving banner.

OUT OF TOWN ADVERTISING

Media Outlet Insertion Period Circulation Insertions Total

Magazines April, May, June 500,000 2 1,000,000
May-June 68,000 2 136,000
Jazziz Magazine (US) 2 960,000
DownBeat Magazine (US) 2015 Guide 480,000 1 250,000
Exclaim (national) May 250,000 1 216000
Summer Fun Guide 216000
On-the-Go
May - June 150,000 180 27,000,000
Radio (International)
June 2.2 million 65 143,000,000
CHIN (podcast info not available)
May - June 125,000 30 3,750,000
TV & Video Displays
Impressions Click Rate %
WPBS
Toronto Video Displays: 3 screens @ Richmond May - June 285,907 .29
Adelaide Center; 3 screens @ Toronto Stock
Exchange Tower, 2 screens @ Royal Bank Plaza; May - June 458,107
2 screens @ First Canadian Place; 10 Tornoto
PATH Screens, 82 Gateway/International May - June 376,000 0.38
Newsstand screens April-July 52,513

Online Advertising Jan - Aug 1,610,385

Ottawa Citizen - Postmedia digital awareness
500 Premium Brand Friendly Sites associated
with Postmedia Trading Desk
CBC.ca
Ottawa Tourism
Social Media including Twitter, Facebook,
Google Ad Words and Instagram

GEOGRAPHIC FOCUS : Posters were
distributed across
a National Capital Region Ottawa/Gatineau.
a Ontario and Quebec more than 100k from event
a North Eastern US
a France, Austria, Germany, Great Britain,

Australia and Japan

a Eastern and Western Canada

2016 Media Marketing Report │ TD Ottawa Jazz Festival 10


Attracting local residents and visitors, PAGEANTRY
pageantry is a siginificant focus of the
CITY WIDE
Festival’s marketing campaign.

Lord Elgin canopy banner. Size: 400” x 60” 11” x 17” posters. Quantity = 3,750

Street pole banners. Vertical street pole
Prince of Wales Dr., banners: Sir John A.
& Wellington St. Macdonald Parkway,
Laurier Ave., Albert
Quantity: 67 St., Slater St., Bank St.
S. Size: 29.5” x 60”.
OC Transpo bus banner. Size: 135” x 26” National Arts Centre large banner. Quantity: 168
Size: 288” x 336”

ON-SITE FESTIVAL SIGNAGE

Main gate top & side banners. Size: 2 x 292” x 33’; 1 x 141” x 100” Laurier/Elgin and Slater OLG After Dark Site Map
entrance banners. Size: 2 x Series activity activity tower.
292” x 33’; 1 x 141” x 100” tower. Size: 41.9”x Size: 41.9” x
95” 95”

Box office A Frame in front of Box Office banner and activity Late Night Jamming activity Mackenzie Bridge activity tower.
City Hall
tower. Banner: 26.7” x 247”. tower at Lord Elgin Hotel’s Size: 41.9”x 95” «

Activity tower: 41.9”x 95”. Grill 41. Size: 41.9”x 95”

11 2016 Media Marketing Report │ TD Ottawa Jazz Festival


« MORE ON-SITE FESTIVAL SIGNAGE

OLG After Dark Series/Tartan Homes Stage banners at Marion Dewar Plaza in front of City Hall. Quantity: 4. Size: 86” x 126”

Photo: Adam Hughes

Discovery Series, OLG After Dark Series, Jazz Warriors Series & National Arts Centre Studio and Theatre NAC Back Stage
generic festival pop-ups placed at the NAC. Size: 33.5” x 84.5”
coroplasts. Size: 41.9”x 95” coroplast. Size: 41.9”x 95”

Merchandise activity tower. Size: 41.9” x 95”.

Beverages activity tower.
Size: 41.9” x 95”

Jazz at noon Series activity tower. Size: 41.9”x 95”

Main Stage Gobo Directional NAC Canada Day activity tower. Big Screen & Left/Right Scrims by Main Stage in
signs. Quantity = 5 Size: 41.9”x 95” Confederation Park. Scrim size: 132” x 192”. Ad
rotation totaled 189 times throughout the Festival.

2016 Media Marketing Report │ TD Ottawa Jazz Festival 12


« MORE ON-SITE FESTIVAL SIGNAGE

Jibber Jazz Jam-Along First Aid TD Green Chair at the National Arts Centre Studio Laurier Ave. Music SoundCheck
Series activity tower.
Size: 41.9”x 95”.

SPONSOR SIGNAGE

Tartan Homes Stage Gobo OLG Pop-Ups on Tartan Homes Stage TD Flag
TD Comfort Zone Tartan Homes banner in front
of the Marion-Dewar Plaza

OLG Banner at OLG Stage Entrance

NCC sign and City Bike Racks TD Music banner

Downtown Rideau ©©AAnnddrreeGGaaggnnee Downtown Rideau BIA Tartan Homes pop-ups on the Rendez-vous Rideau
BIA pole banners Take 5 Before Jazz Tartan Homes Stage. Jazz Series signs in
TD Umbrellas. Size: 72” h. CF Rideau Centre
Quantity: 55

13 2016 Media Marketing Report │ TD Ottawa Jazz Festival


Performers included: TD WINTER
Carol Welsman, Fraser Hollins JAZZ FEST
Quartet ft. Joel Miller, Jon Cowherd
and Brian Blade, David Virelles and FEBRUARY 4 - 7, 2016
Roman Diaz, Montreal Guitare Trio,
Mouse on the Keys , Mike Murley Trio In its 5th year, the 2016 TD Winter Jazz Festival
and John Geggie’s Journey Band ! at the National Arts Centre was completely
sold out.

© Andre Gagne

OVERVIEW PRINT MATERIALS

As one of the few winter music festivals in 350 posters and 2,000 flyers were distributed
the city of Ottawa, TD Winter Jazz Fest warms accross the National Capital Region. A program
the capital during the cold weather with book with complete artist biographies was also
loads of jazz music in cozy venues. available online and at the venues.

Total Attendance 1,244 Total Advertising Reach 3 million +
Total Website Visits 8K +
Total Facebook Reach* Ads appeared in Metro Ottawa, Exclaim,
Total Tweet Impressions* 76K + Ottawa Citizen blog takeover, Ottawa Start.
127K +

*From January 1st to February 13th, 2016. Total Media Reach 9.7 million +

Top Twitter mention earned 420 engagements Ottawa Citizen, CBC Radio (various shows),
DamnMag.com, Ottawa Start, CTV Ottawa
Andre Gagne Such an intense, Morning, Metro Ottawa, Ottawa Showbox,
high energy performance by @ North Country Public Radio, CHIN, 1310
mouseonthekeys @OttawaJazz. News, CHUO, Radio-Canada, Rogers – Entre
Utterly blown away by this show! nous, Ottawa Life Magazine, Centretown
News and Montreal Gazette. See some of
the coverage on page 30.

2016 Media Marketing Report │ TD Ottawa Jazz Festival 14


GREENING

© Andre Gagne

© Chris PArker

Every year, the Festival works closely with it’s volunteers, vendors,
suppliers and partners to reduce its carbon footprint.

Twenty eight recycling stations, for a total of 40 a 95% of food ware from our vendors was either
bins, were spread around the Festival grounds re-usable, biodegradable or recyclable.
encouraging patrons to stay green in 2016. Everything
from the biodegrable wine and beer cups supplied to a Paperless Volunteer Program.
our attendees; to cardboard and glass/plastic/metal a Program Book available online - printed less.
containers from our food vendors were proudly a Paperless ticketing system (tickets are emailed
recycled with the help of the OJF green team.
then scanned on patrons’ mobile devices).
Highlights of our greening efforts a Use of efficient print methods for marketing
during the Festival:
materials on recycled FSC-certified paper.
a Use of 100% biodegradable and compostable
a Festival situated adjacent to major public
beer and wine cups made from 100% renewable
resources (from Green Shift, Canada). transportation (OC Transpo).
a 1.5 metric tonnes (MT) of mixed fiber materials & a Multiple bike racks provided by both the
2.76 MT of recyclable materials collected.
a 28 recycling stations were strategically located Festival and the City of Ottawa.
around the festival site.
a Volunteer & staff t-shirts had messages on both a Wine/liquor bottles donated to local charities
sleeves encouraging everyone to recycle.
a Leftover water, food, t-shirts donated to the
Ottawa Shepherds of Good Hope.

a Beau’s All Natural Brewery, our official beer
sponsor since 2009, brews with organic malts

and uses local spring water.

15 2016 Media Marketing Report │ TD Ottawa Jazz Festival


ON-SITE Sponsors and
ACTIVATIONS businesses find
activations effective
CONFEDERATION PARK & for product sampling,
MARION DEWAR PLAZA promotion, awareness
and sales.

For two years now, TD has been Some of the on-site activations
providing the TD Comfort Zone, an at the 2016 Festival included: TD,
area for all festival-goers to take a OLG, LCBO, CBC Ottawa, Dove
break and relax! Canada and more.

2016 Media Marketing Report │ TD Ottawa Jazz Festival 16


WEBSITE

2016
STATS

From Jan to

Aug 2016

471K

pageviews

1,938

average a day

Mobile friendly. Engaging. Interactive. Visual. 187K
visits
Ottawajazzfestival.com continues to be the principle source of information for 769
our audience. With a strong focus on engagement and usability, it continues to average a day
be one of the top ranked Ottawa festivals on Google searches. New features this
year inlude a blog and an interactive map. 120K
visitors
HIGHLIGHTS 494
average a day
a Mobile friendly (in 2016, 34% of visitors a Interactive program book
a New interactive map 2:30min
viewed the website on their phones) a Superior SEO (Search Engine
avg. duration
a New blog page and posts Optimization) strategies
a Excellent social media integration 7K
a Lots of video and photo content a Easy online application forms
a Tourism slider section on home page a New online donations most visits in
a New Instagram feed integrated a Major sponsor logos on home a single day
a Fast and secure e-ticketing system
page

Top Website Referrals

Website statistics compiled by

17 2016 Media Marketing Report │ TD Ottawa Jazz Festival


SOCIAL MEDIA

NEW

7.2K Likes 17.2K Followers 1.5K Followers

1+ Million Reach 1+ Million Impressions 3,316 Total Likes

September 2015 to August 2016 September 2015 to August 2016 September 2015 to August 2016

Top Facebook Post Top June Mention Top Post

reached 11.6K people earned 486 engagements earned 65 Likes

Ottawa Jazz Festival Fashion truck, food trucks, and
July 3, 2016 a whole lot of fun. Join us at @
A little taste of Michael Franti and OttawaJazz tonight if you can.
Spearhead from last night! #ottawa #Jazz

31,729 People Reached ottawajazz #TBT with this great
11,192 Views │ 985 Likes regram from @eliduern [...] eliduern
77 Comments │ 89 Shares Many thanks for sharing this photo
:)! As always, it was an amazing day
listening to great music. The city is
lucky to have a fantastic festival!

2016 Media Marketing Report │ TD Ottawa Jazz Festival 18


MEDIA © Suzan Zilahi

«

CBC News, Radio-Canada and CTV covered the opening night of the Festival with live coverage throughout the news.

HIGHLIGHTS CBC OTTAWA

Total media reach was over 570 Million* Total CBC Impressions

a Received extensive coverage on CBC.ca/Ottawa, Provided by CBC

radio, social media and TV. CBC Radio One, 91.5 = 1,506,200
CBC Television = 1,222,000
a Critics from all three major daily newspapers;
The TD Ottawa Jazz Festival had a
The Ottawa Citizen, Ottawa Sun and Le Droit filed significant online presence on cbc.ca/
daily reviews in print, online and on their blogs for ottawa, as well as the Twitter accounts of
the duration of the Festival. our shows and their hosts. A prominent
home page button featured Jazzfest on the
a Joel Hurd from North Country Public Radio (New heavily-used main page of cbc.ca/ottawa.
The button linked through to a dedicated
York State) and John Kelman from All About Jazz Jazzfest page for the full 12 days of the
attended the Festival several times. Festival, plus the week leading up to the
festival.
a CHIN Radio, Ottawa’s multicultural radio station,
CBC Ottawa’s tweets received more than
covered the Festival daily and interviewed several 45,600 combined impressions with an
international artists. overall engagement total of more than
1,110. These statistics show that audiences
a CHIN’s reporter did regular reports about the are directly interacting with CBC Ottawa on
social media.
Festival on CTV Ottawa Morning.

a Metro produced a six-page special insert section

published on June 22.

*Media tracking commissioned through Meltwater

CONTESTING

Media ticket contesting included: CBC Radio, The
Ottawa Citizen, Magic 100.3, CFRA, Rouge 94,9,
The Jewel 98.5, CHIN and CHUO.

19 2016 Media Marketing Report │ TD Ottawa Jazz Festival


CBC’s © Suzan Zilahi NEW
Hallie Cotnam SERIES
& THE
interviews MEDIA
Programming

Manager
Petr Cancura,

live on-air at
The Record
Centre

24H JAZZ RAMBLEB7 B7S AT U R D AY, J U N E 1 1 , 2 0 1 6 O T TASWAAT UCRI TDIAZYE,NJ U N E 1 1 , 2 0 1 6 O T TA WA C I T I Z E N

nd’s O T TAWA JA Z Z F E S T I VA L OTTAWA JAZZAFEfSrTeIVeAL24 hour improv jazz session
24-HOUR JAZZ RAMBLE
24-HOUR JAZZ RAMBLE
Saihkaoleysted by John Thompson at the
d can T U E S DAY T U E S DAY
out to be 10 a.m.: Adam Saikaley 10 a.m.: Adam
11 a.m.: The Chocolate Hot Pockets Record Centre11 a.m.: The Chocolate Hot Pockets featured all of the
Noon: Tim Bedner, Mark Alcorn,
Marilee Townsend Noon: Tim Bedner, Mark Alcorn,
1 p.m.: Michel Delage and Steve Festival’sMarilee Townsend local artists and friends and

ary suitor 1 p.m.: Michel Delage and Steve
Boudreau

NO SLEEP? NO SLEEP?2 p.m.: Michel Delage,Alex Bilodeau
Boudreau hadDelage,Alex aBilofdueaull house well into the night
2 p.m.: Michel
NO SLEEP? with about 25 people staying through3 p.m.: Michel Delage, Lucas Hane-

man, Dave Schroeder
3 p.m.: Michel Delage, Lucas Hane-
man, Dave Schroeder
NNoo pprroobblleemm No problemuntil dawn4 p.m.:ChristineFagan,RoddyEllias

5 p.m.: The Steve Berndt Group
metroLIFE6 p.m.: Rob Frayne’s Drum Swamp 4 p.m.: Christine Fagan, Roddy Ellias
5 p.m.: The Steve Berndt Group
6 p.m.: Rob Frayne’s Drum Swamp
metroLIFE7 p.m.: Peter Hum, Charles Gordon, 7 p.m.: Peter Hum, Charles Gordon, metroLIFE

John Geggie John Geggie
8 p.m.: Roddy Ellias, John Geggie, Y O UOt«tawBBRRaEEXXIITT8 p.m.: Roddy Ellias, John Geggie,
Petr Cancura, Mark Ferguson
9 p.m.: Atlantis Jazz Ensemble Petr Cancura, Mark Ferguson
9 p.m.: Atlantis Jazz Ensemble
OOttttaawwaaSriHghEt,Rprogramming manaPgetrroCfatnhceuTrDa,Oritgtahwt,apJroagzzraFmesmtivnagl,maanndaTgheer Roef cthoerdTCDeOnttraewoawJnaezrzJFoehsntival, and1T0hpe.mRe.:cHoredlloCneinoturseFoownnqer John 10 p.m.: Hellonious Fonq
11 p.m.: Petr Cancura’s Bang, Bang,
e staging the inaugural 24 THhooumr JpaszoznRaaremsbtlaegJiunngeth14e-i1n5a.ug JuUraLlI2E4OHLoIuVrEJRazz Ramble June 14-15.  JULIE1O1LpI.VmE.:RPetr Cancura’s Bang, Bang, Bang, Bang!
W E D N E S DAY
Midnight: Alex Moxon, Zak Frantz,
line Dating Com- Bang, Bang! GORY VICTORIANS
ve had one of the best
Jane Austen gets the zombie treatment D3
le to featureRvaamriebtley toof fjaezazture variety of jazzsothescariestdate
W E D N E S DAY Ottawa Citizen

tickets and gift certificates to lo- Mticidkneitgshat:nAdlegxiMftocxeornt,iZfiackaFtreasntzo, lo- YOU se‘TcHEtRiIoGHTn cover
cal restaurants. The person who KceailthrWesatlatounr,aMnitcsh.eTl Dheelapgeerson who Novemi‘‘sIInntT$Ibn4Hhttd0IiN0eeaeeKGnrr’rvarilnniblsaegdaai1ef roDttrt47iihoo,rnni2gaa0llhiiss1tmmo5f
ismthyegbeSiEnrCTtIeOhN Drraigtihotno. f
Keith Walton, Michel DelageO T TA W A C I T I Z E N M O N D AY, F E B R U A R Y 1 , 2 0 1 6
1spae.mnd.:sLtinhseeymWoesltlmtiamne at the Ram- 1 a.m.: Linsey Wellman New play
2blae.wmi.l:lArnedcreeiwveKtnhoexLaansdtFFeaenlinS’tand-
NinosgtparlgiziceS, wexhteicth is to include a gold
3paas.ms t.:oStehaen Dfeushtaivimale aTrniod a dining-
me guy, whom I met OOmrr ssyoogwweeenetthhraootuuioggnhh.tt..’’tJrAuZmZ pFeRtOeMr CBh1arley Gordon (7 p.m.spends the most time at the Ram- 2 a.m.: Andrew Knox antldahyeFselaedwloinw’n
ble will receive the Last Fan Stand- Nostalgic Sextet
1d his picture on my Tuesday) to the electric funkinessitnrgupmrpizeet,ewrhCihcahrilsetyoGinocrlduodne(a7gpo.mld. 3 a.m.: Sean Duhaime TrioPATRICK LANGSTON ROSEMARY WESTWOOD
ebook, and sent him a pTausesstdoatyh)etofethsteivealelcatnridc faudnikniinnegs-s The law — arcane, precedent-lov-
sdatgoeh(ehlep owuats, agnodoOd-tta- metroVIEWSof “tIhtefeCelhsogcooldattoehHeloptoPuot,caknedtOs t(t1a1-aonfdt-hheoCsphiotacloitlyatpeaHckoatgPe.ockets (114anad.m-h.:oJsupliiatanlSiteylopdayckage. 4 a.m.: Julian Selody ing, sometimes overwhelming in a ROSEMARY WESTWOOD
hiseswtaaryvethdafot rabttirgakcotosky Your essential daily news metroVIEWSaw.mai.nTgueensedraayl)istosttahreve’7d0fos-rfbeieglksooukl-ya.Amls. To,uferosdmay10) tpo.mth.et’o760sa-.mfee. al stothuel- Kafkaesque way — has a fun side?
rties,” said Chocolate Your essential daily news Your essential daily newsjawzzeosof mthe Apatlratnietsi,s”JsaazizdECnhsoecmolbalteeRjaezczoordf tCheenAtrtleaenvteisnJt,abzrzoEnnzseepmasbsl-e
geuraitlatreixstsAbleaxckMaonxdon, e(s9tpo.mth. Teufesdtiavya)lt,ontohremavaallnyt-$g2a0rd0e, You bet, according to Ian Stauffer.
ms eindveoalvseiemr ebnetc.ause (H9 po.tmP.oTcukestsdagyu)itaortihsteAavleaxntM-goaxrodne,wpillalybiengsoolfdaflotor s$a1x5o0p. honist Linsey
owrimll eptroedsernivteathweide [email protected](t1mae.dmia..Wcoemdnesday). The veteran Ottawa litigation
nnceobf ejtawzzeeinnuOs.ttawa Park projectpelxapylianignionfgahltiossinavxolpvheomneinstt.LinseytwBitetetwr.ceoemn/speettsetrhheurme will be hourly lawyer and small claims court dep-
fpid-benastewdoomraigni,nhaalvseof Park projectWeTllhmeaenv(e1nat.mw.ilWl epdrenseesndtaya).wideodtrtaawwsacfoitrizperni.zceosmi/njcalzuzdbilnogg concert uty judge premieres his latest play,
nd felt comfortable A New Paradise, at Ottawa Little
y was in my friend’s Park projectcrBoestsw-esenctsieotnstohferjeazwzillinbeOhtotuarwlya 5 aA.mlso.:,TfrhoemJu1li0anp.Cmal.etnod6aars.m. at the 5 a.m.: The Julian CalendarsMONDAY, JUNE 27, 2016 High 29°C/Low 14°C Chance of showers

m at a bar, then we FHFaAtGJhooleoldeIuunosaBnnjtefoieltdrtyyadohBafimuuentbisloyuEcilsnnoyslooimCRsocucuaofnamlpnOldeupJMfatexonotrepAdatMvirittweeetsryoeortrraZnsidate1.No,dtnorcRemroRmecb0i1aeZooxoxaeecy0yeewaammdaappneggvvj0mmtoJosaaaammuhParrJiiiimypepepCntntniiearsllssssabboeeeoaaArssrrysysCarvoyyiikue1eoot$g$giielofnnion7nnrr22trlclMmtttoohMMssee,ndieehPoourupr2agggmaennt0arrtqqhgddiiSabb1nttfuieeyynte6tuun,svs4bbititPjtioyeeveMyyiadnss.lii.ettnndiiggoonnss OOJJttttaawwAAwwaaiifftteehhssaattoremRcZZiinnoxvveeamiaipaagnvnmollamsseeriiDttepZtZnnnirrlssbeuuccRasrysyomomieoE$giuuneenr2lrrAtoMsnneIIaaeorurSSttggYegMnttoproiqiooMMuonndinbtrgpgpgtytThe,YYullaawteaabEanniwyytJJphAyyreuimmysoosblMtannl.seeipcAAieettsrrtnaaoonniNNddgEoEeeWWMMvvneeSSrryysoonneeOJttawAa festZivdfraowmsftohrepbriozpe-sbiansceluddoinriggcionnaclserotfRecord Centre event, bronze pass-6 a.m.: Mike Essoudry, Don Cum- 6 a.m.: Mike Essoudry, Don Cum-MONDAY, JUNE 27, 2016 High 29°C/Low 14°C MChOaNncDeAoYf,sJhUKohNwaEleee2rfs7a,H2a0m1d6an,
ner. It was all very Theatre, Feb. 3-6. A fundraiser for
d promising. the Ottawa Mission, the comedy aa..CCwkwkJJK((..ooiicacaaatthnnememhhAAaffnneett--plpttehAhAddororeeeeleleelloofll))rJrJooaonn,,aaiinbpbpgHgtttthhiibebeSoaobbeerreeumnnaaffrrCnCoonnPPdJJdrhrhddaaaaammaiizrzraalnlyddkkszsztt,.
d to drive to my place stars area lawyers, judges, police
date. He was vague
me, so that day, I mesintgos the festival, normally $200, mings officers and others whose day jobs
o be specific. He never involve the law.
ut I had things to do.
, he said he was ten Set in the fictional legal offices
ay. I said I was out
ds. He got instantly 7wail.lmb.e: Msoéladnfioera$n1d5K0e.ith Hartshorn- 7 a.m.: Mélanie and Keith Hartshorn-of Paradise, Morgan and Bright-
ent texts every min- man, the 23-character play finds
d to meet him at a an evil leader plotting to create a
now uncomfortable [email protected] Walton new master race on Earth. Pitted
alone in my apart- against the evil-doers are a couple
im. of bumbling barristers and a clever
d out as soon as I
ng he’d gone to ‘great 8twai.mtte.:r.TcBomA /peterhum 8 a.m.: TBA scientist, with love, solar farms and
9otat.amw.a: Mcietigzaenn.Jceormom/jeazzblog alcohol getting in on the action.
meet my girlfriend and
so badly.’ “The human side of the law isn’t
d? He then loudly often displayed when people en-
that we were OVER! 9 a.m.: Megan Jerome counter the law. It always seems
eived angry texts dry,” Stauffer says. HALEY RoITnCSHIuE nMdETaRyO.
the night. “But judges and lawyers are peo-
ow that even if some- ple who bring their own emotional
n to a friend, he’s still and mental and historical baggage

n’s morbidly obese. to the picture.
0s, but I’m afraid “I wanted to show the irrever- Joel Miller on sax, left, and Fraser Hollins on bass, seen at the 2012 Ottawa Jazz Festival, are part of a quartet set
o young because of ent side lawyers have, that there to play the TD Ottawa Winter Jazz Festival that also includes John Cowherd and Brian Blade.  JEAN LEVAC/FILES FRASER HOLLINS HALEY RITCHIE METRO
on. She’s good at her
k job), has two won- is some fun in law practices and QUARTET
and a husband who’s Featuring Joel Miller, Jon
ing to get her to lose dealing with (clients).” Cowherd and Brian Blade

A New Paradise is Stauffer’s third

play and the final instalment in his When: Friday, Feb. 5, 9 p.m.
Paradise series. Where: NAC Fourth Stage
Tickets: $32
A longtime community theatre
actor, he debuted his first show

MOONEY’S BAY dents shouldn’t expect Marleau’s decision Lost in Paradise as the 2009 pro-

duction of the annual Lawyer Play,

aaqatmrotdpliddAMapilniwiMmwpapqArnoaMatditldaliidinaneftsantefsoaaoeetnnntbnbuoeuoaooeoaoolylytMgtiMgiOiiiocipiocpiaacctatnnal,tnnaneyol,tnaeyBTBSoennBTBStetnnbstbsaalylyaaoohoyhoyOlsldsdsufboseufboeuhytuy’hyfutye’umve’mv’llccccbbiiitintntrftatgerftgeiivvwo’uwold’uldoiNoietotetootaoliaelielllltstlselrerckrokroererooeooeeadeadnkninikitnictcdxudxu.e.eEddieiiciciinanonanollynllynrwrnbnwnbneetrftrftneetneeaogpaceogpceininYhahah’h’ugageugageasotbsotb.t.tryryi,stia,stshiashbiboeoel’ylcyc’nn’ten,nte,nsSesSewywnySn’M’MwswsrCbrCybweiaywoe’iat“o’t“stsRBtRBcacaiydiyydii’s’lsltthhdedsesnnBn$syn$syfrfrLMSdaMSLhdaahaao.ao.iBoiBofflrmlrmlilicrrietiefti2fi2kakAgacirgotncirontnynybeebeeptpftnfaeunhaeuihpnponcochehlelp-tpo-tfoifitibibYtptpteeateemaeycmdeycrdrrrchngchingeieyffPdPrdrhht-et-eencencbhbhucruecroieaodioaodoossrroogegetaPgtatsPgtsttaaeifrceyiircyditudtulndlnodoryaryayyiicacoaliolrjerruiojerauioasirsMiirMimcSmctStnlutlutun--un-e-etontkloniklicscistri|tr|sfhsfhlolohhthsShtsySlaylaoceochhco,ecoc,agecnakagOgnakOghhyyeeeemmai’aSi’Staitsaippntkntttkstntrsennrensnslnltp.tp.aaaat.hothoiciicvitpvoltpoloyoy-l-elenn’’onioniepwkepcwklMctlptloplaomamtnetneeenbhSnblhStltrornonaaaataetanenkaaikaaiymyhmheeccrriiiibbtnabtnoabccubsuwwtbswwtccJenyvJnenyvngigiioiododoeeuusosyosytsontbcnbagcag,y--,yg-g-ggryroykmokmtataimiomlollnlylyglogaroa”r”ssSySyflfiliaaeerrmomioiene-etn-mtumuhphppnwppnwpvSvSt.t.11udyYuedYeggnnuhuhiiaelaelphgphge3e’3spsnpnaasndndnnnneotpeotpna.Sna.iS.i.yyrrddohohppBviviyWyWnnhWhWtutugsgsnnppr,r,uuioeioeahhyoiyowilrowlernoenEEeresrsepyepeeeeoommnnplpcoalcoaenrenrosomsmGaGagguuraaooyyssjdojdvovttttuttuttteeeefefltltnsmnsmeueuhieheiereraasosohnehneisil,l,ccoortrtldddlddodddoyyayyeiaerrttttll,---,----wwtteeGGaaiiiwiwoofclbbduinbppotftedcgtttmritcnbdtcecmobtlfttpubgrpfttananouieohouiieohiuuoooilrorplrrpemeymrreeyporreopoooonnhhwtewennuunoninonirrloomrrloonmmclmcly“GMTHG“HM“TGG“thdntChdnClleceeceaeaettubtubunmtunmloibsldoisbsMdsIMtIi’ihthsotsynaaoayiniaasiaiaisiwauweoutseotpsspes,e,eemnamnasosdeoaiaodeaoia””iillullnunrarbaenoebenoecwacwiayaiyaosnotnlttbdtlrbddlrdnntltmlmssededststoeunhetuhsnshnatssnaunnungngonosnsaaln,pln,tptaeaOeoOoetaetlaaGlaGdpbd.pd.ydeyoteotdoedwdhedwhoinoinoioi..yyvevaeiaeienimnbimebettcbotcspaotspafufhoihoiooecInecIsntaisctainceilneilhhdhhdtfsstfssuoouaoocacccscysnmconmolloloininaabaabajraaajratatGGadaitaitaoslpynsoslpsyncsrtscrtaiauu,h,htlvtlwvmawfmanigfnnigononhiihlisilbsnbn,in,eiueouoleiltoeidutodurrnbsntbstereagragseseaoauoucdcdi,iag,elaelyao’gyasoglotslo‘tn‘nssn.pnl.pellneolntioiyyttdttdrbmtstMloIrmbMstoltIhhtttttbtbetse,t,s,r,vrmvm,o,oiwiiswisahsrshaaAr’rnaaA’ndnaanidgeaighghgffimoim,io”f,ir”frhirrwhiewssbessbseouseolfltffacntsfxacnsnrneeatregaeaotgfaoafaeeaaetaTTaektpTTnkepnaeiaoniyonyggeakeak.t.sotlosoowlrwplrihrihrceccacarecca.ark.aisktainstneyesiyeshaidhaldaarslhliaarshlililieeuue-eit-ci“oedtttgc“odttgscsfseacfseanntecstdetcrsadtemrtsriaemtriyatyatooihoihcoocsosEotEoctetnhanetnhhanhvthhhmivthemoieoooatooatttagatgoutouslsslsoode’tde’thhahahtsaatsnmvhnmivhisdosdosnedsran’tedera’tnaaehnaahuhu,,chmcrthmrtcectetttGttMcG:c:,em,emeemtemytcoeeycodeedetthoheeoteesatsai’ao’aocotccmhotcmhlbeplbeptntnttttttRoRrsoshrsihil.l.adosoadosnwoanwbhvbihvcomiSciohmiSihimotmehluotehlutoteeoererooututcectewtiawiraoayncoaotnchotiehieesdiesndiernoeroryreyerrnbagynbagyhhesalesahhcancanndrxndrxotpeotptptapasnsntedtedej’grjy’agryasssbsibiilcilcbabdiaeodivdeovdsohtsoeo.oahtoe.okmckmclllvlatFevltFelioioanocaenoceooayysayysflyfylyoiayyoiacrfyoiIcfoiuInbunbou.oea’.iea’bibggaaarcfarcf.fof.olytnlymtnnt.mnts,sb,nb’nt’tpnpilnilnwnwfc.fcsr.gfsrgfBe’ehsBeehstwyLltwyLliio,o,nlnlftofstoooininttrcekorcoekogoagiaaiafehfeah’a’tolTtoohluTpcohulpceleiewoiewoinintemot.remo.grfdgaafbaaobehobehunbteunrte”r”ftftoiorisrbsabitareitreeeShShatmawtmcgwdcgeeadebabinitnbbptbbplbe.lbe.yyyyetcretcrnhnhttsbasbahdrhhhdrpkhhptcktdldlbocbocohyyohohyyt.ohpht.phofyofyhsphywsppywpeieyMyMhmiihm,eii,eryrayailnislfnufuccuomuompttpetirteiratacatltsacailtsaoioaardriidpiefpefiiiyiynnianniahenheth’nthah’nhaontnitncntitnc..ttwttawotaotcmcmtrtrsistiotooo.yae.yaeici’’c’’rrhkhnkdgdgyyggeegeeyaeyeyygyeeeeeaeyeyyesrsssrss,,,,------------ a fundraiser for the Great Cana- T D O T TAWA
WINTER JAZZ
dian Theatre Company and com- F E S T I VA L

munity causes that Stauffer had Ottawa-raised Fraser Hollins has assembled
co-founded several years earlier.

dents shouldn’t expect Marleau’s decisionMOONEY’S BAYHissecondshow,StillLookingfor

Paradise which he produced him-
self at OLT in 2013, raised an ex- a superstar jazz quartet, Peter Hum writes. All concerts unless noted
are in the NAC Fourth Stage

traordinary $50,000 for the Union to halt the playground project, either.easy,” Hollins says of Cowherd.

“He’s a great listener. When
Mission. He hopes to match that You could look at it this way: from Wayne Shorter to Chick Thursday
Corea to Joshua Redman to ■ Petr Cancura with Lynn
this time out. Fraser Hollins is just getting
Guy Giorno, co-author of LobbyingWhile the plots have evolved, a together this Friday with his old you’re in a conversation with
Kenny Garrett. Miles, 7:30 p.m.

law firm is at the centre of all three roommate, his roommate’s friend him, he’s a great listener, and you “Brian is a really beautiful, giv- Friday
■ The Chocolate Hot Pockets,
feel that when you play with him. 5 p.m. (free concert)
He’s just there. He’s just very ■ Mike Murley Trio, 7 p.m.
present. It’s the sort of playing I ■ Fraser Hollins Quartet, 9 p.m.
plays. and a longtime buddy to play like a lot. There s a lot of listening ing, generous soul,” Hollins says.
Such a setting makes for good some tunes. and a lot of dialogue going on. “Very in the moment, very,

theatre, according to Stauffer, Talk about an understate- in Canada and a partner at Fasken Mar-very present. And again, like Jon,
who should know: He’s a partner at ment. Pencil in the names of the
Tierney Stauffer LLP here in town. folks playing with Hollins, and always about serving the music.

tineau Ottawa, says the company maySometimes it might be to try and
S E E P A R A D I S E O N D2 ■ Florquestra — Forró Party,
10 p.m., Mercury Lounge
be banned from communicating withyou realize that the Montreal-
“Jon is so quick, if you give him lift it, sometimes it might be to

based, Ottawa-raised bassist has a piece of music, he just gets to create space. ■ Jam session, 10:30 p.m.,
ARC The.Hotel
I wanted to assembled a dream-team quartet the heart of the music so quickly,” elected officials for a month. But that’s“Hejustalwaysseemstoplay
show the to play the TD Ottawa Winter Hollins continues.
Jazz Festival. the perfect thing.”
“He’s worked extremely hard at Completing Hollins’s quartet
“I’m happy and very excited,” his art and his craft, so his skills probably about it.is saxophonist Joel Miller. HeSaturday
says Hollins, 45. “I’m seizing the are really, really developed. And ■ John Geggie Journey Band,
might not have the international
he’s got a spirit where he’s all 5 p.m.
■ Carol Welsman, 7 p.m.
■ David Virelles and Román
Díaz, 9 p.m.
■ Jam session, 10:30 p.m.,
irreverent side opportunity.” jazz stature of Blade and Cow-
herd, but he is a leading Canadian
His ex-roommate is New York about serving the music. It really
Giorno has long said the city’s lobbyinghornmanandcomposer.
lawyers have, pianist Jon Cowherd, who has feels like it’s all about the music.”
that there is Joining Hollins and Cowherd His talents won him the 2013
some fun in law Lucyplayed with Rosanne Cash, Iggy
when they play at the National bylaw sanctions are too lax. In Toronto,JunoAwardforbestcontem-
Pop, Cassandra Wilson and, most Arts Centre’s Fourth Stage will be ARC The.Hotel
none other than Blade himself. companies that fail to comply could faceporary jazz recording for Swim,
Scholeyfamously for jazz lovers, the The Louisiana-raised drummer/
which also featured Hollins. Hol-
group he co-founded with drum- Sunday
mer Brian Blade, the Grammy- ■ Mouse on the Keys, 6 p.m.
■ Montreal Guitar Trio, 8 p.m.
practices and Metro | Ottawanominated Fellowship Band.bandleader and singer/song- prosecution under the city’s bylaw.lins and Miller have been playing
dealing with Hollins says that he and Cow- writer is renowned for a singular
together in Montreal since the
mid-1990s.
herd became close friends when combination of groove, dyna- However, given that Sinking Ship is“We’ve just hung out so much,

listening to music, goofing
they were among several people mism and sensitivity. Tickets: Single concerts
who shared an Upper West Side Blade has accompanied Bob
apartment during stretches of
Dylan, Joni Mitchell, Daniel
A children’s production company may(clients). ($22-$32, plus fees), nightly
passes ($40-$50, plus fees),
full passes ($77.50 plus fees)
at ottawajazzfestival.com
Lanois and Seal, not to mention around, doing silly things,” Hol-
most of the jazz world’s greats lins says. “Joel’s like a brother, a
only face a “slap-on-the-wrist” punishmenttimebetween1999and2005.
“Playing with him, it’s very funding almost half the cost of the play-musicalbrother.”
ground, it could be that the company didSEE DREAM ON D2
if it violated the city’s lobbying rules for not need to be registered as a lobbyist.
a Mooney’s Bay Park playground, says a “It is possible, theoretically, for some-
legal expert. body to say, ‘I wasn’t lobbying a city
Several critics of Sinking Ship Enter- decision. I just wanted to give the city a
tainment’s $2-million mega-playground million dollars,’” says Giorno.
deal with the city have called the com- Meanwhile, his advice to any company
pany’s lobbying rules into looking to engage with city
question. Sinking Ship has officials: Read the bylaw,
not filed any lobbying activ- talk to a lawyer or phoneOTT10653142_1_1
ity, but city officials knew Marleau’s staff to check
« about its Canada-shaped the do’s and don’ts.
playground project last The more lobbying
winter. breaches a company
The city’s integrity com- makes, the stiffer the
missioner, Robert Marleau, Guy Giorno sanctions.

is tabling a report on the Those who break the
Mooney’s Bay Park playground project rules a second time may be banned from
at a council meeting on July 13. We still communicating with city officials for
don’t know the content of the report, three months. After a third breach, it’s
including whether Sinking Ship violated up to the integrity commissioner to rec-
any codes of conduct or bylaws. We also ommend sanctions to council.
don’t know if the company even needed “Most businesses do comply with these
to be registered as a lobbyist. laws,” says Giorno. “Even though the po-
By law, Marleau can’t comment on the tential penalty is light, there’s a reputa-
not face any city fines. Mooney’s Bay resi- city’s lobbying rules this year. report ahead of time. tional damage that can be done if you’re

But if he finds that Sinking Ship vio- found to have breached the law.”
lated lobbying rules, the company would Three companies have violated the
not face any city fines. Mooney’s Bay resi- city’s lobbying rules this year. with an
20
the younger cousin 2016 Media Marketing Report │ TD Ottawa Jazz Festival
admired her - she was

y, slim, and beauti-

busive boyfriend

er that she was ugly


MYSTERY SERIES

A 5 concert series of free, noon time shows
featuring artists as special guests from any of
the 15 shows from the day before! Mystery
artists were announced only on the CBC
Morning show with host Robyn Breznahan.
Thanks to Celebrate Ontario for offering A list
artists to audiences old and new.

« Mystery Series explained on the CBC
Ottawa website.

DISCOVERY SERIES © Andre Gagne

A tribute to those artists who continue to forge WARRIORS SERIES
the way for all those intent on breaking down
barriers and boundaries and taking the music First time for the Festival working in the National
into new places. This series took place at the Arts Centre Theatre for a superb showcase of
National Arts Centre’s new Back Stage. artists who continue to reimagine their music, their
visions, and their relationships to the great artists
“Finally, the NAC Back Stage concerts seem to be who work in this explosive and expansive world
victim of their success. I learned that the hard of jazz! This series was sponsored by Celebrate
way by showing up late for the again sold out Ontario.

concert of Colin Stetson… Congratulations to the “Epic opening night for the Ottawa Jazz Festival
festival.” – Bernard Stepien, CKCU’s featuring Kamasi Washington” – Joel Hurd, North
Rabble Without A Cause Country Public Radio

© Dan Nawrocki © Dan Nawrocki © Dan Nawrocki

21 2016 Media Marketing Report │ TD Ottawa Jazz Festival


YOU AND MOR

O T TAWA C I T I Z E N T U E S D AY, N O V E M B E R 1 7, 2 0 1 5 Songwriter
busy is bet
MEDIA
SAMPLES Bach
passio
not pe

BIG-NAME JAZZ RETURNS Ottawa Bach Cho
J.S. Bach’s B Mino
Wilson, Marsalis among stars C1 At Dominion-Chal
Church
Reviewed Sunday

NATASHA GAU
OTTAWA CITIZEN

Lisette Canton a

Bach Choir joine

cians sending tri

dedicating Sund

of Bach’s B Mino

tims of the Frenc

Swelling the ra

were the York U

ber Choir — anot

projects — and E

the exuberant lit

DRIVINGorchestra from M
flutist Matthias M
Canton, the ch
director, has spo
deep affection an

BROOKEfor this monume
sacred music. He
work translated
mance that had p

LPGA phebut also excess a
First the good.
singing was supp
eyes Rio Bvibrantly respon
sounded particu
assertive, while t
DEAR JOHNSMulti-instrumentalist jazz musician Petr Cancura, who grew up in Orléans, has returned to his roots — and roots music. JEAN LEVAC/ OTTAWA CITIZEN a lovely, balance
pure but withou
ton’s conducting
if a little strident

She is skilled a
T H U R S D AY, M A R C H 1 7, 2 0 1 6
the work’s intim
O P I N I O N TBbuhielAdLiinbSgesraaEltTgsooiixlveeRtmsrcniolmEuitlRPJadernAEsNyaRtTvbseZUpaOO1.seR5ZenmDNstSiMtlmloIOioGihnFlolAGliiuATovsenHNseLsO ESCo3yfrdioUalnlarrNesfruMegUOneoOevsRS,aEbtGLAVIN the tasty little di
noble plainchan
of them needed to use the facilities. Hundreds of soAldNiDerMs OwInside Obama’s richly textured c
final Dona Nobis
Y O U moved to accommodate as many as 6,200 newcomSeornsg. wNrPitforeign policy slowly in an imp
expansive and em
busy is bedepravity A9
PETEROHTUMT A W A C I T I Z E N E S T A B L I S H E D I N 1 8 4 5 cura will do that will feature him There was sup
teaming up with an Ottawa singer- ing from the orch
OTTAWA CITIZEN songwriter. ing masterful flu
Maute, and virtu
Before Petr Cancura moved in July Petr Cancura, back from With this series, Cancura is trio of natural tr
from Brooklyn back to Ottawa, he Brooklyn, mixes jazz and roots practising what he teaches. At light was the sple
was having his “best musical year.” Carleton, he gives a class that he with Louis-Pierr
PETR CANCURA WITH IAN TAMBLYN has created  called Developing a ing his curly pug
After more than a decade in the Personal Style: Jazz and Roots. horn and backed
United States, the Orléans-raised Cancura’s Down Home disc took chattering basso
reed player and multi-instrumen- the roots and blues sounds of the Bach’s most ima
talist was connecting with fellow southern United States as its inspi- mentation).
jazz musicians and improvisers ration, and before that, Cancura
in the upper echelons of the fer- also delved into the folk music Young bariton
tile Brooklyn scene. Playing with of Czech Republic, where he was stood out among
such widely celebrated musicians born. not only for his i
as were milestones. Meanwhile, he He possesses an
was growing more fulfilled with the “I love combining roots and special voice: tau
projects he led. jazz,” Cancura says, adding that exotically colour
there have been some high-level grandeur, power
But late last year, several offers precedents for jazz and roots/folk
that came from his hometown were mash-ups. He says he looks to what Then there wa
too good to refuse. jazz trumpeters Dave Douglas and Some of Canton
Wynton Marsalis have done with tions were so fas
In  December, Cancura began singers Aoife O’Donovan and Wil- neither the musi
talking with his alma mater, Car- lie Nelson respectively. In the late
leton University, about becoming 1970s, Joni Mitchell was making
its artist-in-residence for a year. fantastic music with jazz greats
At the same time, an opportunity Wayne Shorter, Herbie Hancock,
to stage several concerts as part of Pat Metheny and Jaco Pastorius.
the National Arts Centre’s NAC
Presents series emerged. With Tamblyn this month, and in

“The combination of these things

was just too good to turn down,” When: Friday, Nov. 20, 7:30 p.m. 2016 with Lynn Miles and Jeremy cians, and seeme

Ottawa Citizen YOU section cover says Cancura, 38. Where: NAC Fourth Stage Fisher at the Fourth Stage, it will be pure showiness.
OTuTeTsAdWaAy, CNIoTvIeZmE Nber T1U7,E2S0D1A5Y , N O Tickets: $35 at the NAC box office or nac-cna.ca 
Add the work at Carleton and up to Cancura to “set their music detail can border
steps away from his old apartment. out music-making, Cancura says: to jazz,” he says. some articulatio
Nta1AwC7a tJ,oazCz2aFne0csutri1av’as5ld’suptrieosgaras mthme Ointg- “That’s stuff I don’t miss for a sec- “I kept playing these great gigs but chiselled — the o
Tamblyn has been great to work was one example
manager, for which he spent a week with, Cancura says. “He gave me 15 up Bach’s majest
CDs, I took them home and spent lines.
weeks listening to them, put stars
next to the songs that spoke to me,” The ensemble
CITY COUNCILLOR RETURNS Fsontouproothisfamilyandcome V E M B E R

each month back in Ottawa, and

there was more than enough rea-

back to Ottawa with his wife, Liz, ond,” he says. still coming home with $50 at the Cancura says. this beast of a wo
BachBecause there was no sheet mu-
and their four-year-old daughter, He’s kept busy this fall, biking most.” the previous eve
Annabelle. from home, to the festival’s down- Cancura says that, despite his sic to work from, Cancura had to Ottawa all day Su
town office, to Carleton. On Mon- transcribe the songs from the re- fatigue was undo
“Ever since we had Annabelle, days, Tuesdays and Fridays, he move, he still wants to play with cordings and rearrange them for in some shakier
our outlook on lifestyle became splits his time between the festival his Brooklyn peers, and he is work- his jazz peers. eminent bass-ba
different,” says Cancura. ing to set up a Canadian tour and

His wife gave up her teaching job and Carleton. The festival has him perhaps a recording session with Cancura, who will be joined for music specialist

normally rock so
tired; even coun
Taylor had a rare
although in both
and taste compe
technical glitche
and its punishing commute, and Wednesday, and on Thursdays he’s them next year. passthose concerts by guitarist Roddy
his family left their tiny apart- at Carleton all day. “I’m by no means ready to give
ment in Brooklyn. “We squeezed Ellias, bassist John Geggie and
our way into Westboro. It’s  a very Cancura says that his musical life up those musical relationships. I Montreal drummer Greg Ritchie,
small house, but coming from New in Brooklyn had been “creatively realized I can base myself here,” says it will take a lot of creativity to
York, it feels like a mansion. unbelievable but financially unsus- he says. balance the demands of the sing-
tainable.” er-songwriter and jazz musicians
But returning to Ottawa has also

On one hand, being in Brooklyn made him keen to find new collabo- Overall, this B
allowed him to record his 2013 al- rations with musicians in Toronto, more celebrator
bum Down Home, which was nom- Montreal and Ottawa. Up next is a strange but not u
inated for a Juno Award in the best Nov. 20 concert at the NAC Fourth ing in these days
instrumental album of the year Stage with Ian Tamblyn, the first of hours enough sp
category. But of his  day-in, day- three Crossroads shows that Can- reflection.
“We have a driveway. I don’t have not ponstage.
to look for parking for 45 minutes “I want Ian to be at home, and re-
after a gig,” he adds. Nor does he ally express his stories,” Cancura
have to drive a beat-up car, foresee- says. “But I also want to let these
ing that it could be vandalized, or great jazz musicians really play and
fret about gunshots that he heard shine.”

2016 Media Marketing Report │ TD Ottawa Jazz Festival Ottawa Bach

22J.S. Bach’s B M

At Dominion-C
Church
Reviewed Sun


23 2016 Media Marketing Report │ TD Ottawa Jazz Festival


YOU MADNESS

BIG-NAME JAZZ RETURNSO T T A W A C I T I Z E N T U E S D A Y, J U N E 2 1 , 2 0 1 6 Acting approach
still influential C8
Wilson, Marsalis among stars C1
SECTION C

DEAR JOHNS DRIVING
BROOKE
TOoT TilAeWtAs cC oI TuI ZlEdNsEaSvTeA B1.L5I SmH EilDliIoNn1 8li4v5es C3
LPGA phenom

eyes Rio B1

T H U R S D AY, M A R C H 1 7, 2 0 1 6

Y O UO P I N I O N BASE RENOS GO UNUSED

G L AV I N The Liberal government spent millions of dollars rMeOnoOvRaEting

Inside Obama’s buildings at six military bases to house Syrian refugees, but none
foreign policy
depravity A9 AND MOREomfotvheedmtnoeaecdceodmtmo uosdeatthe easfamcialnityieass. H6,u2n0d0rneedws ocof msobSeloudrnssiyge. wriNssrbPiwte4etertersrea yCs2

CITY COUNCILLOR RETURNS FIREOTTAWA CITIZEN TUESDAY, NOVEMBER 17, 2015 SECTION C

Bach Choir
passionate,
not perfect

The SFJAZZ Collective, from San Francisco, is scheduled to play the OtOJ.ttSat.awBwaaachBJ’saacBzhMzCiFhnooerisrMtaivssal on Friday with a salute to the music of pop star Michael Jackson.

At Dominion-Chalmers United

Church

Reviewed Sunday night

NATASHA GAUTHIER
OTTAWA CITIZEN

Lisette Canton and the Ottawa
Bach Choir joined the list of musi-
cians sending tributes to Paris,
dedicating Sunday’s performance
of Bach’s B Minor Mass to the vic-
tims of the French terror attacks.

Swelling the ranks of the OBC
were the York University Cham-
PETER HUM them to reunite twice a year in San ever, in a first for the collective,
Francisco to rehearse 16 substan- he and drummer Calvaire made
SFJAZZ Collective plans a thrillerInthedozenyearsthattheSFJAZZ tial new pieces of music before a track containing electric guitars
going out on tour. “We just kind and keyboard-produced textures
Collective has honoured jazz’s most of jump right into it. It is pretty that the group plays along with in
significant composers by perform- intense,” Simon said. concert.
ing arrangements of their work, the
all-star octet’s choices of annual Through its different iterations, Overall, the music nudged
honourees have usually been no- the band has developed a large the collective to add more elec-
and recognizable sound for itself, tric sounds to its previously all-
EMBRACINGbrainers.
Canonical artists such as The- ber Choir — another of Canton’s with original songs and arrange- acoustic sonic profile. “That has

projects — and Ensemble Caprice,
the exuberant little baroque
orchestra from Montreal led by
MICHAEL JACKSON’STONYCALDWELL with the world. But last year, the been one of the cool things about
lonious Monk, Ornette Coleman, ments that can contain bar-raising working with Michael’s music,”
Wayne Shorter and Herbie Han- complexities that require precise Simon said. “It has provided an op-
execution. portunity to delve into that world
cock got the nod, and all was right flutist Matthias Maute. a little bit more, because the band
Simon said he likes the musical has that capability.”
Canton, the choir’s artistic challenges that he and his peers
director, has spoken about her throw at each other. “It’s one of the Although the collective is in a
fAotltleomwpstaetdtamcukrodnertecehnarggirel MoTonucgaUhrbsoeSlnl fpoIrriCBrownwas understandable. At the proj- things that I really enjoy about be- sense widening its own musical
Cnoouthni.nJgodwyroMnigtpsbiowoacmnp,iputdehrloaadhnrceieittcsyiiws,dtiwaehnldaokgs,intanfo’totgtrpphaaaaberyloltStuohtrfitiitsbththusgievsltoejinabllzteaeozwlShhaonotdignugnRsaonngseoscoinalWmeeddniae.swsfdoade orcerAratpkehydait4sfr,mfamsencuaostsliyniaocutns.emHadtenehinrndtlteaooodrvfameeEpfiuoerirrarsofttoiphoreen-an ing in the band,” he said. “It’s kind embrace, Simon is not that keen
tribe — none other than the King of nerve-racking ... when we first on jazz festivals increasingly pro-
NEWS mance that had passion and joy, start rehearsing, trying to get all gramming non-jazz acts.
that stuff together.”
CITY of Pop, Michael Jackson. but also excess and inconsistency. “What can I say? I guess they’re
If jazz fans were skeptical, it First the good. The choir’s The preparation before the just trying to get more seats filled.
Jackson-themed concerts was “a
singing was supple, nuanced and

vibrantly responsive. The men

ect’s outset, so too was the group’s

cing to PCspianist, Edward Simon.
Bail fix needed sounded particularly rich and
assertive, while the sopranos had
a lovely, balanced sound, clear and

“I was one of the ones that was ued. “It’s all played instrumenptuarellbyu,t without spikiness. Can- bit smoother,” Simon said, because It’s kind of odd that they still call it
Mtouleti-ainssetrujamielntalist PewTTesstthrahOiaueCtebMhafbpdonteaourcSdylyugiPaichrnnEafetetg,AeaocwrtrhfRhofaaaohS1krte6ggierl-erlnyeadhtewtaetavuarri4lc-pptimlnok9niaireloe-ngIdityaorennOne,grecGbirar,aerl”eertéalvt-fwathSeweooiinnneraldiesdehsm-tw,ihvin.aocoilpwsgsnehnaotasOTrgileiwssdishamnntcasnauBeeithWgrdtieLuiesndnhlmaeleelpstvidfdGeidooiernanrc.rtîyseotoeat’iessalitccahgdoAlh8iraeaansmt5ateyssrirt,Rioooctgs,GknoeuahefnatstennwsettocoeiM—orwantacuseerodpnaolbacrpdnheyuaiolndbidtnhlop.deedreotoonilramcranloeiei---tcusedses--,muteSjwsahniocstcizeiou.tt nzIanrhJkmagkEitiwmAshiwn,nNrtoiidgilopntmlLueordEhkproofV.eweAitvttaiCashti’/rsohkasOtaiaelkTtowntoTidisiOnAolnolWtdontfMnAaen.owaeCStiIfaiucbTotsrrIhyi,eZeniaEwtthgfNeh’erisimrleit-’asssftdgThiiroghombvdTehrrtittneswaiefihhohiitsounocfenaSinnoeecrbfhtshhsmslg’lehewtsldliiteoeeaiaytm,rrcaoctus.llyipeot”lIi-otrsal.seezlynetkyetasxeosae’dalk-is,ttidnglfuuiartciiilaetcCSnisgchsrldlsrhetetuteatseidiaedwhrnnFmdOnwnmeoagchgittastseooeoiJsasetqtrdLuutbeontweuyrhnteyAnddalosaarwteLamwettensabunhatirgtiipZsaatnpcntasgEaikiueetnorogltyifssaZeotinenf.o:,nolsedCsgtaustchlai.ttlveTniTevdh.ee,I the band members didn’t get “too a jazz festival, though. If you want
crunch, Naqvi jazz musician Ottawa Citizen YOU section cover, June 21, 2016 crazy” with their interpretations to open it up to other genres of mu-
of Jackson songs. sic, maybe it should just be a music
PsaEyT sE RAH4U M festival.
“When we’re talking about pop
OTTAWA CITIZEN music, there are very specific “If you’re really going to be a jazz
elements that really give the tunes festival, just have some jazz music,”
Patches the their character,” he explained. “It’s he said with a laugh. “If the audi-
RETURN OF THEpBfreoufmoprBetrPhoeoatrkwClyasnnabcuancrdkamtooOvettdaiwnaJ,uhlye V E much more produced. There are ences are going to be smaller, that’s
abYDolyAphCeTuVraaSWnkahsrIFncltDiceetotJrtiohwgseoRAfianrwntEZt,othgehEhhZiudoseVw e,plcgiEhsSakiOewavlLealrtedeYtinasedthtshsaaFeD,elwcraetCelaeavunaasaenvnnsclJiocc-htcapuhiehsziarsnact.ezgohAdiFaes’tsiOpawenneethsrntfse2eqtiamlxonnowiTu0puaivwlhtaanlie0salneDvscaytr4lpsed-ooie,idenevnfwereihaagcPanaihhNssTWantifsotsmdDocruubhlirepppiiceOsmmupkrenPesrotabBislar:ttnarsrcteaatFigoeiviccrwwnvcmeihienandacaarguprnamb.nleJgoaysfaaeyn,ucj.-zoeJrnlrzueddnFoee, s2t4i,v8a:l30 p.m. specific little riffs, there’s the bass just what it is.”
rweaschoavveinrgsh isA“b3est musical year.” line that has to be very specific, that
village behind her schotoilv. e would AforceulastivoenofnBeexlltf,oySitomldotnhe Simon’s own jazz credentials are
WMedanrecsBdealylfoafyt,e4r9n,owodansidwchnitah’rtgaectda- stwChiittihizseandbtrahulagltaotdhtdeifmcotaironnJhfaaodrcsyktersaurogsgnbleu.dt
United States, the Orléans-raised
reed player and multi-instrumen-

PRODIGALtalist was connecting with fellow
After more than a decade in the tempted murder, two“Icotuhnotsuogfhtdietcwlinoeud ltodcbome ma ednatnfugrtehreor.uMse- w3rMPor0tCPanhohre0mageigrrncaeserccrnohsoueosntotri?ntvaaTnsRel’cshoaoCSeaDnntwotrdyaocntlhlwbsdesepel:nRrure,rJveeHtaaeasahzotcgsesizmavhoeOneuaennsynandtantddearisdssreaRicoormoftooitnohtoske.rtHiBnehrigosMiie,nntwolggaehSwntufmaanrhatoealnnaMom,sdantPenotePrhpdtfsepTWuhvdoloeiirifhscrrdltecuaukendhntoer’eetcksetsaosotas:erbrtnbe:Cabudo,oilrotiinfngnticnlsatpcoeaftlbr.moueiwycddb--ta-yhejeraaztziofensPtiavarkl.com
baagrwegareacavhpainotengdbaaansilsdacuotwlntd,oiatspacisohrranatousrilpgstientows,”tsihtoihhetfieosttlniohaseshjiaundeBrs.hecteloltfudoosyritansanainikkd2esh0heoeyanehvaiaalrsysnn,’abytnusppdtobowkapecanks
FversroayunktehceeinrsntcoUohnaBivteadyySotuaarteesaalaiszaeitn.s idnsapti-iintgstrwinoheonwf nhaetruarnalftorrutmhepeletas.dAerh-igh-
creoOroalOuanlfrsct,Cvcoitroazaeenndetrrhtec,thealPtvrnhrhR,eodtdaeeghbprleileyeuny,sfb’etsortolieahrivcektere,hetsCweheS,onhaSFfnteto,soJrFleCekhAJrahvaAmZnave-ecuZZwusZariCacsSshehE EniawlipinRsgtigltEheehrhEtsrVesiLw.sEto-achLusuYaitrnshOl-yNaePpAiyseupe2rglare-rentaaBdgieilodro.gQfeaurbooannripoalqmauy,e-
mcrjbuauo“zsriIznti,”ce.loiCdvaaentnocscouptmro-abfslfiaiinglyilsnh,tgtahdrAedoiombntgsaentarhndiacd’tsanrhcBahoajnarcatnhktz’easszrnm.idnogbsabtcaimksesaodgobinnysatt(wisvooemaimnesoitafrbul-y
Tthherechoalvleecbeteinvesomhae shigphl-aleyveld tmwenitcaetion).
bdiepjmfarffzaeoezschrrter-eeduunempnitsptn.sHleifteoneOrsreasjtayuDtzsapazhvwaseen,lDoadao,ortkuoswCogtltoeaisstw/nfhahotnalrdktselpisngotoohYitonotodutlnnoyelygutfboaarmrihtoiosnnigmetGhpeereossfofslrioeviyestShsie,raiegnthtdt.
TWheynattorneMianrsa2li0s 1h1avae ndodneDwoitmh inHieopnos-sesses an extraordinarily
jazz musicians and improvisers people recognize, like for Thrill- impeccable. Born in Venezuela in
i$n1.5th2epluups ptaexraetcrehtealiol ns of the fer- er, for example. There’s specific 1969, he moved to the U.S. as a teen-
$ti1l.e76Birnooouktlyyingsacreenaes. Playing with grooves, and of course the melody. ager and honed his jazz piano skills
such widely celebrated musicians You can’t really alter it too much, at the Manhattan School of Music.
as were milestones. Meanwhile, he is what I’m saying. You have to be Leaders such as saxophonist Bobby
was growing more fulfilled with the very careful. Watson and trumpeter Terence
Blanchard hired Simon for their
There areprojects he led. “But then at the same time, we bands in the 1990s, and as a leader,
don’t want to sound like a disco Simon has worked with the cream
There are many gJoodAreasZons tZo imMprove yAour hNearingBut late last year, several offers band, you know? That’s going to of his jazz generation, including
sound dated and cheesy, that’s not saxophonists Mark Turner and Da-
that came from his hometown were really what we do. So that was the

specific littletoo good to refuse.

In  December, Cancura began

Why do youPwetar Cnatntcourhae, baarckbferotmter? riffs, there’stalking with his alma mater, Car-
attack of a girl who was onBhuertwSaiymoonftehnavsiocleonmt wehaernohue nwdas.iTnthoxei-
home from École secbonadnadir,ehdee saScaEiEtdeC,dA.hMaPsO NbAe3en
l’Île. true to Jackson’s songs able to be
— includ-

ing such hits as Rock With You,

Smooth Criminal and Thriller —

while presenting them instrumen-

tally within arrangements that

allow the octet to revel in its big,

horn-heavy sound and stretch out Cls1hTi9iena7hNgl0eemesrl,gssJeoArornoonsriuifeUeMpsOpnite’tDhccithtoaieenvtldeolilvwsyCa.atnIhsonaumtnphdraleckWalihaynitlegC-ino2gesnprx0afoeenct0iiddca9eal-.ulvlroy,icpcooel:wotuearureatldny,dfhopecrrueossiecednin,ceit.s
leton University, about becoming
its artist-in-residence for a year.

Brooklyn, mixes jazz and roots the bass lineAt the same time, an opportunity
improvisationally.
Audiences who have heard the

to stage several concerts as part of erfaantitoasntiPc amruksiicnwciltuhdjaezszsgarxeoatpshonTihsetnsthere was the not as good. challenge. How to bring that ma- vid Binney, bassist John Patitucci
Jackson pieces since the group terial, maintain its integrity, but and drummer Brian Blade.
Davidsonthe National Arts Centre’s NAC bring it into our own realm and
that has to bebegan playing them last fall have into today, so that it doesn’t sound The collective’s concert in Ot-
Presents series emerged. cheesy, for lack of a better term.” tawa is a one-off special request
P E T R C A NrCeUacRteAdWpoIsTitHiveIlAy,NSimTAonMsBaiLdY. N by the festival for the band to
wa“Ts hjHuescetoatmoriobnigngoaAotidoindtooCfttuehrnensterdetohswinng,”s MPWiagatyuMneeeltShZheeonrnyteóarnn,dHaJeanrcbdoiePDHaasatvnocirdoiucsSk.,antScioohmnesezwo,ef rCeasnotofans’ts tempo selec- For his part, Simon arranged play. More frequently nowadays,
th19a4t3 t-h2e01y3 served Jackson’s piece This Place Hotel, bands play a run of Canadian fes-
613-688-3244says Cancura, 38. vt7hear0yt psepoepcilefic,NowTwickietths:Wss7$toh3rWAe5lnuonha’:tscecrFtrkraehemide:tlbaNaNiuyyoAA,tsCNtCinihvoFcbsvoeeo.,ux2-rSa0tolvhhi,fafm7Siiat:cst3eeamo0igotcnperood.nmmmsaa.ca-veeicdninrdat.hcstsaeoo o’snfJahbaueecdeakinr--ingWpisaeF2tutiao0ptidsrjeM1hta6rsorzee.wzraCcn,aSi”toatththneWtmhecaLPuesyonarFefnayloonnfsutJ,.roMrmpo t“mhiinslaaeSeeosnttnaastrgihn,seaeed,tnviiriJtSindewmbirfimeulrodlmsabiroryecpmunhm,acpdsoboieutamnamtrinaeosiseielsss,nahcar-tranotndwicbsiuneoleearmdstiseo.ernHdEoYsXetnoEoCrfAEoabuLRtbestLSssebEeynNaOs,tsCwsFieiEovidtneholtyno also known as Heartbreak Hotel. tival dates as part of a cost-efficient
Add the work at Carleton and troWmitbhoTnamisbtlyRnothbisimnoEnuthb, aanndkins, tnreuitmher-the music nor the musi- Simon said he was drawn to it by circuit.
NAC to Cancura’s duties as the Ot-
recognize, likeences latching onto pop hits from

a snippet of bass line or a few bars
tawa Jazz Festival’s programming OCwbODiTetnhasd,m,lICyCbtaoSlanyoiclnkmvuhtrahaaoisesrnmabeyel.sehi.nvo“HmegreseeganaatnvetdeoasmwrpeoeSnr1a5ktn chiselled — the opening KyrieOTT10642875_1_1
manager, for which he spent a week
each month back in Ottawa, and FuwprasBaoannc-he’esxmamajepslteic—, atrhcahtiittebcrtuokrael
there was more than enough rea- for Thriller, forsteps away from his olod afpmartemloendty. . out music-making, Cancura says: ciwseceok,s laisntedninhgetoothnelmy, pmutostvaersd tlihneesr. e

“oTnHhdea,”’tsh’skesetsupafytfsbI.udsoyn’tthmistiusfsa“nlfEloe, rbvsai,eksaiernncyg-dbpoms“tIedioklolsyetcpp.o”tlmperliealniycgkinohegogttmnhoeeishwzeeiegtarhser$a5tmtg0hiugaste-bthuet iadlnCmaeaBxnwoetcctsuioattrutahhstseewahtsyhooisens.rgyewsewthiaafasretnsspaoaonskghdeeoteoftfammrmoeu,”-milyttF.hhTTielsohphberreeee-avnsitsoeoumfsaebwvleeonhriakndignp, teTrroafrvooernlmltineodg to
son to uproot his family and come some of the tune’s harmonies, by Simon said he’s pleased that this
back to Ottawa with his wife, Liz, its groove and bass line, and by group will enjoy pride of place on

example.and their four-year-old daughter,

Annabelle. from home, to the fesstiivcal’tshdoewyn’r- e faCmanicluiararswayistthh,a”t,Sdiemspoitenhis otshicetro bwaonrkdfrmome,mCabnecurrsaahraedstocatOtettraewda all day Sunday, and sheer its horn arrangement, penned by the main stage, potentially playing

“Ever since we had Annabelle, town oTffuicees,dtaoyCsaarnledtosFnar.iiOddna.yM“sY,ohnoe-u cmhaisonBvers,oehokeelsyttnhilpleewierarsnr,taesnatdochpteiliaosywnwo.ritkh- amtcroaorndnsicngrgiscbeiatntihdeersesoiannrrgcaslnufgrdeomtihnteghmeNfroeer-w ifYnatosigorumkee,wsahsaukniedrosuebcttieodnlys.aTfhaector Quincy Jones. for thousands rather than a few
our outlook on lifestyle became days,
splits his time betweeYn tohue fcesatnivafleeilntghtoeyse’truepwaiCtahnaydoiaun. tour and Nheiws jaJzezrpseeerys,.Baltimore and Atelamnintean.t bass-baritone and early “I actually stayed fairly close to hundred indoors.
different,” says Cancura.

His wife gave up her teaching job WaneddCnaersldeatyo,na.nTdhoenfeTshtuivr“aslBdhauayssthhtiehm’sis iptsheedrmhiafnpfeesxrateryneecator,r.”dhinegcseosnsitoinnw-ith tBhCoesaiennccguonriacn,ewrtthshobewy icgluloibtlealerjiocsittnRievodedfdoryreqnmuouirsrmiecassllpyercoiaclkisstoDliadn, sieoluLnidcehdti, the original,” Simon said. How- “Cool, that’s great,” he said.
and its punishing commute, and

his family left their tiny apart- at Carleton all day. “I’m by no means ready to give Ellias, bassist John Geggie and tired; even countertenor Daniel

ment in Brooklyn. “We squeezed Cancura says that his musical life up those musical relationships. I Montreal drummer Greg Ritchie, Taylor had a rare vocal hiccup —

our way into Westboro. It’s  a very in Brooklyn had been “creatively realized I can base myself here,” says it will take a lot of creativity to although in both cases, artistry

small house, but coming from New unbelievable but financially unsus- he says. balance the demands of the sing- and taste compensated for any

York, it feels like a mansion. tainable.” But returning to Ottawa has also er-songwriter and jazz musicians technical glitches.

“We have a driveway. I don’t have On one hand, being in Brooklyn made him keen to find new collabo- onstage. Overall, this B Minor Mass felt 24
2016 Media Marketing Report │ TD Ottawa Jazz Festivalafter a gig,” he adds. Nor does he bumDownHome,whichwasnom- Montreal and Ottawa. Up next is a ally express his stories,” Cancura strange but not unwelcome feel-
to look for parking for 45 minutes allowed him to record his 2013 al- rations with musicians in Toronto, “I want Ian to be at home, and re- more celebratory than reverent; a

have to drive a beat-up car, foresee- inated for a Juno Award in the best Nov. 20 concert at the NAC Fourth says. “But I also want to let these ing in these days when there are

ing that it could be vandalized, or instrumental album of the year Stage with Ian Tamblyn, the first of great jazz musicians really play and hours enough spent in grief and

fret about gunshots that he heard category. But of his  day-in, day- three Crossroads shows that Can- shine.” reflection.


Online articles about the Festival appeared on Downbeat.com, Macleans.ca and CBC.ca.

25 2016 Media Marketing Report │ TD Ottawa Jazz Festival


terms

YOU ■ C5T H U R S D A Y, J U N E 2 3 , 2 0 1 6 O T T A W A C I T I Z E N We’re not ‘alt,’
say Arrested
BIG-NAME JAZZ RETURNS C6 W E D N E S D A Y, J U N E 2 9 , 2 0 1 6 O T T A W A C I T I Z E N Development

Wilson, Marsalis among stars C1

C2 T H U R S D A Y, J U N E 3 0 , 2 0 1 6 O T T A W A C I T I Z E N

KRISTIN M. HALL
KinkyS P O T L I G H T
BRIEFS
BootsM U S I Cin Happy Birthday fees

A U.S. judge has approved a
settlement that will put Happy

A R T S BirthdaytoYouinthepublicdo-
DRIVING steps upmain. U.S. District Judge George
Warner to repay $14M N ACSOH VNI LCL EE TRhTeS hip-hop

gmornCTaeodHantuanUhtaDpRdeaiSasyiArDGPsAraootrYreiwtsleyl;CsnRmtooeutraneydktrGrimyaDnradgestinvpmberereylTu-orCrisoapei,nc---
DEAR JOHNS W E E K BROOKE Htoenirpmthhsoeipr at DorasTHURSDAY, MARCH 17, 2016
LPGA phenom King approved the agreement leAansgienlagMtwaroie aDlubou, pmarksintghliostypearatyr, Three wins fo
eyes Rio B1 Monday. It ends the owner- a—nFT5ooiitcvontkehe1eA1teslpaa:r.rFmmforer.n,eeFTuebehnuefkdtoC,moaDrubwRssinAatn,Ebl9le,eo5p.raYreoodsgrek-rafvSunetnd.dk. , musical inclu
ship claims of Warner/Chappell top productio
GALLERIES Music, the music publishing 9Tph.me.,gRritouaul,p13’s7 B1e9s9se2rerdSetb. ut,
company that has been collecting 3 TYicekeatrs:s$, 152. Months, and 2 T O R O N T O The Toronto p
TOoT TilAeWtAs cC oI TuI ZlEdNsEaSvTeA B1.L5I SmH EilDliIoNn1ISN8lHi4OAv5WNeDSsA ANCROD3UENVDENTS royalties on the song for decades. DmC8Aao8hlylr5usSecBtkiaatnKnrhakBartSlnhnut,e.9eTsfpiocSL.kmuhieof.rt,wesIm:rceNoanoisfelec’l…soiwPov,ieutnsrhb.o,alld- of Kinky Boots was amo
O T TAWA T H I S W E E K : The company has agreed to pay buTmD OstdtauweatJoaztzhFeeisrtihvailt:sBiunggalae-s winners at the Dora Mav
I’ve Got Some Bad News: back $14 million to those who TeVnalniheorsas-Gereig, lEákvTeriroy(d6 ap.ym.P, NeAoC- Awards.
Marc Adornato, opening have paid licensing fees to use Buffy Sainte-Marie sang and shared personal ssptotlrBMNoeieaAsoocaCaskdtcn)t,oShdEoewtsajauJmMgzazetezf)errz,isi.InntOgivWeoractl(roh7heBn:e3nueTsu0ttedmrrspadaaa.a(mnlyp7,n.ap,iwggnM.hmdetha. .tnr ,ihiTocerOnNheY CALDWELL
the song. Last year, King ruled The Mirvish musical,
that the publisher did not own a score by pop star Cyn
the lyrics to the ditty, one of the nabbed three awards in
best-known and most-beloved
songs in the world. He said the
company has no right to charge
for the song’s use. The melody
had previously been ruled to be
in the public domain.
BASE RENOS GO UNUSEDGallery,2DalyAve.
say ArBreUstFeFd Y, AUDIENCE SLAYERCorrespondence:Gail
Bourgeois, conceptual works
event June 23 at 6 p.m., wDitehwatrhPelaizra)s,pAnirait tFuorat lanadnGdiasnolu- cal theatre division at a
ciiaglilTyrocvoesni Dsucoio(8ups.mly.,rNicAsCaBbacokut held at Harbourfront
We’re not ‘alt,’exhibit to July 23, Ottawa Art GoSpCT.todmahng,.f,eaepM)dt,o.aCPvrhiaoemircnrkk)Dte,CyeJsowimarsaenaraBPgdTrylreaisfozoaa(nm)8h.(:T13ia0i0lc:syk3p.en0.mts’.t:, Concert Stage in Toront

O P I N I O N TbuhieldLiinbgesraaltgsoixvemrnilmitaernyt bspaseensttmo ihloliuosnesSoyfrdioalnlarresfruMegOneoOevsR,aEbtuintgnone DevelopmentGLAVIN Buffy Sainte-Marie, Digging Roots abeSsvtiDtreyeanuoesruttwih’fccndmeargoehorrRT$xhommalpeahi5alnn.eraie0enc,nnwrtt,dcbSeofgpmrmdntotoaoediewamwseviaad,nrsnaefd7ienu-nS6tys,lgoefcas-MfeRoooearvlnaemouetfrr-brmrtehyhretaoS$lhys9up,eS09getvSmo-.sahftp$AeuaTlii’.n3gsstimctxiedctt0chh.eikha-.g0ne,leepet.tc,Tnt-aohsoihmlreo:tueeenus$hoctsucs6feueetod-.lhftTeutahrbreeatniahnndutsHahbreoaemnftedhes-etsi- day night.
TD Ottawa Jazz Festival Kinky Boots won for ou
of them needed to use the facilities. Hundreds of soAldNiDerMs OwReEreInside Obama’s Reviewed Tuesday
production, outstanding
Y O U moved to accommodate as many as 6,200 newcomers. foreign policy formance for Alan Ming

C5, J U N E 2 3 d, ep2ra0vi1ty6 A9O T T A W A C I T I Z E N affected by the Firestone Bud Spencer K R I S T I N MLYN. NHSAAXLBELRG choreography honours
Collection of Canadian Art, Mitchell.
CITY COUNCILLOR RETURNSBaFchIRChEoirOTTAWA CITIZEN TUESDAY, NOVEMBER 17, 2015 June 24 to Sept. 18, Ottawa and-wife duo of Raven Kanetakta
Art Gallery, 2 Daly Ave. and ShoShona Kish. Kanetakta The Canadian Opera
On the Grid: Jerry Grey, June tBf‘GoourdrodSuospbpdebnaegcdgiehtarh,neae tb“tgtu’ogNirkolrwyAndcogSoeoiumaswHntiptVcne”arIfcoLAn-rLsrEregTwothTslfhaiehttsechTeueherDvneddherOeerur-atfacfdtDlioalehliwoednedlaiiwBntvpJhhugaeefez-afnzyoplhppFaSoeeeaotnpaesintrcipinat-hvengna-clsiMecooanaanlrtgie sic industry definitely has.rceemrt,inthisecseFodnRagbIwoDruiAttiwnYrgilteingegnhder was the front-runner i
24 to Sept. 25, vernissage on htlaNtmiiuekttaanlhretereieckNotsmor,nPonbdSasesocchNlctepiekaahTAAfBou“rsrrrfeanelheKrmaileTmttsoldnufeneee-wmoJbwrsshd!rcReahtsaaaiol,Bstneaeioihzsahrlogencseinzsfeevteti,fgkdaFnstimesydPohwhiendgeeo,neoaxveasfaoarnnurpinlhhltrrtb’CinsrideocseinusecolnranetdasmgSoivhFmnsnssc(ee,otniswdeaer4edan-csandirggittpetislrnye,ha.rementbBdTssatttbicdh.Aatoarouoh)liytlieunrsrnew.,adopesmaTddfwnCalinsdatdhyvtt-he(edycoaraeeri2,eeodhnnl”ympymLedc,ctpbaFkpeKearaasi.oakarssehmtirneratsehrwletiyhecamahi.ileci)teesnedrusbs,arrseollanaenbadgr-llieufslwaiylosnteihweagtchdtehwlrorpaeiietctnordhosgohfiuhbtefiiuiu-vssn-t era division heading int
June 23 at 6 p.m., Ottawa Art SongwNrPit4er says ment ispunching out bad guys on the stilTlu“meHsodawaykd. oinyogu lmikeushsowicbiz emony, and emerged as t
Gallery, 2 Daly Ave. busy is better C2 biggest winner with a tot
Still Moving: Robbin Deyo, screen, often in a long series awards.
drawings and watercolours, SECTION C oipnfeasIptcaealfgyuh. lHelytetoiwnwaMess8ote6nolr.ednHnasaye, ,shdthaiiihesnsddsegioeindtr, woowansScnholrwebama?tun”ebdmslhrehedmesjrtootbksfaheinxdibdtashmsyeyaaptetreresoaecbwhr-lneeirmcei.awnell
experimenting with the Super — one a free download andGiuseppe Pedersoli, told Italian into It’s My Way, building to a hUmPlreeionsTegnwsihshdvspeaiepatrotrogifhTlwiosseieneaonneaosltCPCStnctlrhohSafptgodotetaefuoenfawtuilnlpnddrBthdgwnaHheltaleeieeessoreeaTodgccseroasansalr,mdaahhhihaaOlatb.sioealsDesen7rClwroyoidcsdlcban,opmg-habebtSgyphl.sauea,ihmiwtnutltotasaaalattiina.tnit(ikgsnsnsdfhro6iueag,sn.tadlm.pgh“itTo.aeNwmhuknHeeo.esicmbg)aitNoroaltiyaBHweoltmncvhaamolaeiwdelnetgcvetiooi-mhrkdeionhhrlae,rlnltpaiiinbdnghtebbgpaeuthaheblrerhteteotdslywces.wroeMAaawsouinminaTrsfteaaulhttctoaelnsui-slliv.nreultrtey-nbddsoatye.onudbdgmtlhu,hateechksireer-ersiaotetcnivk-- The COC scored five
Spirograph®, June 24 to Aug. Siegfried, including ou
14, Ottawa Art Gallery, 2 Daly news agency ANSA. Born Oct. 31, powerful crescendo when things production and directin
Ave. 1sB9ou2ldi9, ShipneeaNndacopeprlte—esdattshhaCeeafnsirTrtlsoaotghtPneheaendmaeemegrr-eroonueusponOfn’rsonga.vcr1eel9stlehad9elaf2ienxd.wdsahseembstaoudpetp, et,hdethbeold for Francois Girard; and
You Are Me: Paula Mur- wOteteakweandg.uOitnarFrsildinagye, rshJee’sssoenGereoef ntheeshacotwssaotftfhteheMnoeuwntiidScltaanarupesniislettnnpiisngtcietohrcMaaseetlthedreaaofdTcbrnnrcamyrooldaMatumucihiorcmyueh.hshSsUaeiospeiil.f3DmbdSucefrta..dnhubFvseaceoYoeedoemeuyprsrhpreru’stsiieahbsmtiamnveloiid,dratocsmInt,vthsltuabhiaioer,uleane,ts-rt5hnetCoeaafMscasFmnllteltsoaabaoaLoerhttrbsurmuehmoteeideomerdefriniagbdoinwne,arwctitmtitFeicatohmnhhhkomieds(ndatihifrpmsMrhtdlatiofe,efliw…ip,otrsIdifeaetaoutoodidn-,hlnfTllndkeiinetosknythgSoaetdnaoneafuolagiiiuNdselnsnlgtlmoiod2otaesmh-wemwgnb-t.eechaMe,eretent,hamrwfreineai,ie-gscteivtsCt“ethhtianhinrAeersliidc.lkesuwslimiivornongiSiebrigdgentllu,vnddoes,wICpSoaScpwnvjliyheiowoAcDurdreieoreceei’nTnirnfafsssaeueeolpgthSUctnhrwlroiwavidemmvReniddoCaneimsremnesDtaiirktltbegotcenpoyhohAo-imirlMinc,neiieYprpdteeA.edW”yaansrliemwtaiteeire.betbidxAt’os.yhade”ruNtentLneeodevbtsMsjuukHhsaMCebeuynnyutsaTteaa,gcKtr,ywtleuAavMiicsAncioBsrloseiedhy.hgnvear’xeHasewbrlbnrrgpCeaeaierosaeieesuarrifassdancssStbetea,shidpitoanpnoamern-,tttniuinaowsarttglleeahsasdstestceoerihinen’rnson,sgteohp’hsxlcei.erCparelewoldrevaide-ilr- La Traviata.
ray, using the clay vessel to
explore life’s paradoxes, June The Canadian
24 to Sept. 25, Ottawa Art Opera Compa
Gallery, 2 Daly Ave. emerged as th
The game doesn’t start night’s bigges
until you say YES: Alana winner with a
total of eight
passionate,Latincic,digital prints,sculp- awards.

ture and installation, erasing
the utility of objects; exhibit
to July 3, Studio Sixty-Six,
cptnho.ememwb.)alw,alfbcitokuhlslmoahwneineeocpdpoiebnrnpynio.ancrogagmtisgee)sa.t RecblreyeocmtsohsreedtnheOtedsttorlaiifvvwereaerogbafgfatanttehhd,eesHfoBoluolwalocarFknawrdSitThfAoAooohooewpuprelegeOMonkenhrcpet,snkeoditMnFIx’asbsnnrtaiywm’iconsadrAsoaoa.hii‘e,yl.nrltprae- ioobhtnrWrWshoocmNeubdaAdkwspTmtoilkrtYuur6itheleetun0icNeodeh’sftnemsk’ciEAdoheirycoarltnfoldutCmaDfndsltmemeeUfteehbdéoeeoymsDasotnrelhrsruneDeMe-orieS.sItpWrTNaeriahstG,.nutcSepTsaEWarDuSiioOdtngrrvnaahNteheieetsytt-anesutMreunthrddyaerdihagiraladaniiilhsegylbpahtta,lGotsay(snwocghl$,ekktodPe1hhbistw0eeneeaisqglcauslrosolaitidhtenmn--auvssordatttrhrniosioaduct,aese,ttha8et:nt3hiE0peieargrolbicfgvweauroonenBCiSAidnnnjnunopotaDctykerrnhcJsr-igfeeakifea,iigeltdrezdlir.TedhvneizTdoeabgeeesFnclRarpBeehrieafndolsleotmegoeaatit,btodr,ctasyrunhnaMkokstetwfdeo,iiPhfiWoceactanrueeRihhoerntdrifketar-&riEleeaMbinlmtBuceoviagFn8oftrirrglihnie:icsai3gssxeetuSnarth0.oiiogttitmcsrapaintfairga.ahnnmappenedglntd.odeldafhaeratepu-emsg-,hotteior’nsaplowwaelrlofupl Young People’s Theatr
not perfect66MurielSt. outside the band’schioamleltyowcno, nscious lyrics about aawncsstordarintirpigcedpwaeaslrldiy.rtBednarocueAwcmtldnaSiypmtpeWewreifdnoeoearcmhlbohGauunmssrceaaeB.imAaodcfrktatmhrhTeeoye five Doras, including ou
baBnladck’.sDopoorssoipteinvaet 8mp.ems.,ssahogwes production in the theatre
disdtanrt’ts aatl8w:3a0yps.mre.,sLoivne oanteElgwini,t2h00 audiences division for G
raESf“prlAeogpainnwletoSar(tyOts.oa(oOkfrvaoikrlulveeirlcplepoopper-odeppurl-nspakufb)neeRklAlt)sRCl.iIoTklYde- Moon.
w(eHawmeiltroennro’tckr) eBeaalrliynghs (iOpttahwoap
anpdop-tphuneky) Hweaovuy Hldearstas y(Ntiahgaarta,” Canadian Stage took h
‘Sap1e(lO6tem+eteotart)cownahganaesdpttaoRiinipevd/-mpe1.u9e“mn+hSkbtoi/oepprtdooTrshihtnb-eokhe.AapDrrcdc’oacaowodlrlsriaeean)dss awards, including ou
soorptenoaft a6 ps.lma.pRitiunaltNhigehtfcalucbe, 1t3o7
Les gens sont fous: Aurélie BEST BETS God, povertyBoston. Joey Kramer’s Rockin’ & and family. mBee.ssBeerecraSut. TsieckIetus $n1d3 eadrvsatnacen+d production wins in th
oOftttahweajBaazczh fCehsotirival at the NAC on it’ssearvnicealcthearrgnesa.tive in its sub- theatre division for Bo
duriGlnisugtilaltanhudemilelou,psjeterwanetiollner,grJ, uepnneeamr2f3eol-rmance J.JSA. BZaZch’s B Minor Mass Roastin’ Cafe will serve organic the Fire & Sunday in So
OMstetUacwtHSiJoauInnCC.eiiTtpi2hz3eu,nr2sY0hdO1a6yUo., SWpaxoAphSonHistIwNithGhiTp-hOopNcre’dSthrAills WINNER WO2YO9tet,Uad2wn0se1easc6Cdt.iiaotiynz,e.JnuneJULY 21 TO AUGUST 3 2016REVIEWKamasi AtPDEoTmEinRioHn-UCMhalmers United jeScUt NmD aA Ytter from the gang- in the dance division fo
Washington grooves on stage to July 15, L.A. Pai Gallery, saturaSpWoatrr.nimalieeaecsegea$hbn.deadlrtl1sse-onn5o,awntd,oeuoiaiolnccrslvrwuethabd$inooieiaal2nsrnalckp0dytbkioo.ftRlBrScne(lhFmsaapo aeeSihoonnooi1oatwugeua.rrmofdcsrrrTWidfThcmtgasEttmiesoegstCnenhutehss.ehatoceOewede)aehmioeheelStrwarrcaavvKuubnnaaKfNldoernened.briinyynoltbsdaltwnt,SerdsuohiitiodbnpYahgnlwnhdoamtRonuioiciihamcdaeeiddlmrivcnthnMitrnl.rrgCdRyeuhuuo.snseoyeeoeedLhsesod&puFsocoAtreiyaoneodeakhgucifarBtrsoocssdydcfsSdbceatLsrutman’BtnspsAakArsaCfstiphoahhtioespdiryo’oDunnerce2ossohoh“Tsrdngtselioaggrbt0pemawoiirezdnWuTmlfoueedosnhiiu1enloetteheslnesrlsln4enenelewu.MemshBtaartreatccETsps.ca.armCnigdornhmeaiahSheithlontsldLerrmutbceehuwuitithawopit,ogyvfkLa-mnhdbensaofwtauneFLCbiafae-,ns,notomannrun,aOpAursgghofrddnatnyoUeOilogessioesdalcsvPdtivRftD.eerdedesswchci.phseelatslAeatseiueaerecroS,eihDrtafrilrnydRetwoaiurepaseiegnbnundyeBOsigebahesgniorOuschBh:ltepaaiaoidtgDseaIucnctxtnrncNtyevaollhhhhto-akrbyiwm,e.rt”peaymens,6abhtiainsm1snsehaehte3eainaoncohe-eccsautit8ndi’nodo.eeosst-6Cnrn3sdilt-yM7yab5naBe2nrr9yefuu,waEnll-l,is stBerriasntuWfilfs,obnuctlowsees’roeuthJiapzzhFeospt . fenheit.
13 Murray St. CRehpAvulsairemycwehoedodtthSheu, snTodDpaOyhitnstitagiwchatateJadzhzitFewshteivnasl ihne T H E A T R E WofeftastiolHinomgltlyowohoamovedanedTignehoqtutcdaslutdebos1TefOchuabrkoiDotymommaibns.aio“snNtD.oaMtyhpiianrtdgywataAsrts Court. ItwS8’Ts:oi3tjhuh0unehpdsi.stsbmta5ao.0nCuntroohdnotafn’henstdnehneirvereeavMrtwsiiaoeainnrwyaPSolpatbfarokPguieenmtatts.”,
2014, the pure-voiced vocalist Stacey yPiTnroAgauvTaneRgsl IibPnCregoKruaicldaLleerAnlsysNdcjaptuuhtonieGnsrhemrdifdycspSepeapoosoaollinTl,emlrivdiorctnuiaOewyancic.stnrtiil,NKinoeuasodningdntnfw.hfiiastgnuSehthfhygkrlovteleoaieioahnmntsnhflbasaheeguu,ltsotasreeof,chlcolnpdhtooiecdtbteuseeeipcarceradanl-iroieeknnnmstgga,-niesglandiilnlosyakTngltingohtnpafdoe,hMdesaana$siasnsob3osistrld2amfiiueeugfoawuvssrudnenaaemesMn,ganigiewAitncsadeoogsmbetni)shoarreglanebasaeeb(totac-ycsunwouhnydolt,oe-.ogausrseaewasatetflmutlebaurbs-syiacl.l ChDaavnidgBeaztahne(SNeaatrtlreaintdiviee-foalnk)d Canadian Stage also w
OTHER EVENTS/CALL vtouynagee,s to far-oiufnnfcrhloeaulaanrttdemadsp,mp,eeuwnarrdcaehonrcuSciehncsoatohrenwgrea-a.neldloewcYoiedud’elldhaltsiomo jbuetsoatbrsleeintloegabsuey a range of Thanisd WLauarsaNGiebsvoenr(OHreogmonefo, wlk)e. re standing touring produc
FOR SUBMISSIONS NO TEKATneATgnWAltaA,SnaCdHnI T,AArI ZemEtGeNuArrincUsaTntoHbtaIhsEeeRNd aintioLonnadl Aornt,s rsien8aAldlegplv.aalamegnse.,cePsIe/dr.Delisciosenennds’,Fet7deS510be9Ge+r.luYaTdaiocsrkutyoenta.setT$At2hvh0eee.in for Cold Blood.
Call for photography: on the cLBipCpiaas.clenemahnsty.ttsCseTreethiChncSokeadiaenri9tnttuj0soogr:0idnton-ratsaeiytebnad,auJwdttuthatNelhjeysaAelz2tCizoO.sfTTtPethhotsaaieftsrwiamivtstaair,umle.sceaio-,tm7 Club, references the Black
theme of Gratitude, for a new In the general theatre
exhibit at the Foyer Gallery owdtifeBOLfmeSaBdYrtLwlsitelaNceUaeoctanwNlEhfhtlaoiti’SesnnhhSnbYBggeAlitouotsSFMXrehuurksseBgienmntUhnrEduoaacntRarnnihfyimGfMvkJ’tsesedeearpsrdouss,refisRbortrttuafyrhiooctaneCrhthtmOhhgteisaadeBatcmbnvhCkhlicaus-cee.se-sfirst Tarragon Theatre sco
artist-run studio, open to all wins, including outstan
artists, whether using high- play honours for Mustar
end equipment or phones. ing wins for Anand Rajar
The show will be published tard) and Rebecca North
online and in the gallery in Date).
October 2016.
Deadline: June 30. Native Earth Perform
N E W SstWoDK RaeeIWtSyenShvaT’exrrAeIcoANerplrmoAfhRotMwoSnrotlptdhn.elEeooHHiamsmswTttstAteIpwsjL‘aNUeeatiLazettdznhlthRidGttfehraetm,iNsc’cTptruki-ovhOrowaOdonlpedoNFrctapercteee’nhTdSjnaeatrzHhrgzgriArifeElellsstToWiovnauclgIoahNprbesnNoeelnlrEfporRricBinrgowtonPCs 613 234-6306BMtcsPCwfBOPprrToeaerEuaouaaTIfsclymuAToettpiThWiorsEc-lnaaBieAtvY nhRfvscrPhCsiAeioeetenhIxHTrorat4gsuIjr,ksUZwanmhCNElt MyiiNeehassAnlanne“eatbbq3caduaenlviecsrsdkatitdmmtjaouzKRoOzsvaiemtcmtEdaauliawsnyiVsaceJii,auahWrlnI.ye”aPEseWTnsTveTCswththriaOhOiaWlMioeoueCtlNnebaMhdafYutgabpdgonnthreeatoCurncSecodylAbyugsiiPnaBicLe.hrndnnEafehDJteeatgg,AieWlgaoycownlrrtrhffREohdofdwaoaaaLohoSfyh1kryLttev6,ggreieerle-4errolnMryeads9snhtewtn,caeotavohwuairriogn4olc-ptaFmbaWththafPetaRlnnok9oialswiooisetpsrlaeyoi-nlcgloedEw.TTtyiaomnceryesppmiwwOa,opn,greihisdmiehhT’Gbpigrteatesnaaunareelhiedonrhteeeéaalr,rEnetels-tfgldhwatgrpeeoollaaasid3hAnnnteswe.hnneRraLlstfratsoudcd4eistt--trrdt,eimxpociirrto-ohtotftcsiaHroati-ysaonhhnmaewCsilwpuoyshnsnpenetgraCeoU,idiaiwiKssOTAroagaiohntcntleasasndtWieeihmhanprlehzttMchoneiassnrnunBdekej-agegthWeejtnenaaordcunodeLduphtiesrlniKlnsazadrlmoniaetrrlelseepnlrsttashvthduidezfepditrGeatd.aioitoeteagncdvgrinioeg.rtîymsstLmtTjdnceaeaatoeatnrt’aohcessatdtikohtlnchgheigdatozheAudhlnh8eabilesatoaadafesLszimi5aagnemtuoocysomtiaArirBStt,actbRfioodfngdapNiW,tGudaekaomnnoehuatnaetrei’lnannttesstietanlhengehalwsrathfoacatafiesiM-faonae’esh—oodswangstpoara,ldysuslrhcersohlnrbtiusoeasaslbyeacremtvidstnttuseoyuaifnolonrasnda.btad-iunhalcntpdd.gdregldrgotniosol-il-gree-mancltobeelihiewtecuusedsdeesS--t,omhhuevBnfNtlsknatchFfuoehhpoDtenntnieeoosaoeWWtsshoareintAsaesiCpobcteASse8beatdmCbtpAysCttptCcofcsnntxnooohiethehmteihvorltycerusastiieee.uoVaaarrrfioaeawmgogga aaaWetieaneaoofnoVtintiD4oveeagnrgtllldJtetlgvnJar.jyigofeImnvlllwrntwnssmodtadaEiayup.SagtcietfehlEahhsavner’phayanDitfftmbsgaessii1xhhnaxNwsltneclzeetiAxocrooe,n.wn.ototeprlylae,[email protected]:hthwgo1i6neafeArxrsgbhhhnnunserio.ewihlec.oaant5ipAurfn.rthssuooltnoLsoupgtaloeietEoraogudu-euir.err,TenotowRCidgg,mliuntuhbhm,rnmdioEi.ginmttmbei2npAfruvsrparntThEeAsshkaugsttedtmne2siihdoiVved.kio0e2vedrpaisscesiatwttrsatgtteoow.laglt0VwnneArftdehlwetc5no1mttticlepseooiut1aheetsitnhnt-ftyui,invhrnss6Cnnowgshto3:ipEoohldraoshte,talim,caDhutdneydload:ee.at/eniatwihwerfiTnasae.htlman’dtldfvtsrLweTsngoleetrsndoiavtOwaislvyrCitPurmhnctanotoaeiFttoomathbgtweotoYhrhaseisioTaneaeaelhpnadhbetogwaotnmshrdpna,ettepemtroeureheisne.nToeedyotrowt.asrtkicsnalaihdwhkhaksciOa.kDbeemesifAnonehrsaftmnGNrlonasenlF2,ot1retrcoxuxsomleWeatpraseeeootaca,tmtas0racre.nh0hotrbtghdraesbbgtttfs-iChynmaialurthrlybAfa:ictvde-aDhrektnlediaetmpattmic.iysoa,tibboaa.tohiarshh-awitasanernseasorag.-sCsms5eSywhgi-lmniinNaehlen.tskte.cp-sntstIao,aWuughlr,t-eTrcah-,a.tmAsidlespyouriortuhInhiaeciislefCZx,anegoeteanrrosilrtlgEeTemrth,gat.ndhunueadvoeNswrseiiddhaAhnd-asmenpeyndriotntuensr-tiichdgett-aOdwtTgfWtssutateihdiurnheogoaeivhhthaTeem.schntinroftfitndrvtfsssepwpabmdatbserwteetfileaoheohhhndaiioilsxitsdorueeiuruno dbSWmmtPMolceonenobwaSCFrraincoseeecouh-opnrecurtbrtaueahgtstwerAgurhern,haoihaesltilv’eaijlanpeheawetCynslrladlekealcireiesithredooineceealnefaynntycnx-mDdlssrFdstbtcantcdyascahootistelysuls4slleottTyituiapspogeseotdiytMlfurd,itrdoeootrvotseoiealms,eyifetzmtrstdb,adnlelmynnreetmkswtvyeenriheOstyna,hasMhprpmwbhHliafashswwxeebCoaneags—rerKaee’dc,auwhpolhk-anJiaeseaaa,txe,aytiaomtaroctincrdinswahacg—oeitfelPfuerbustaiaarrttnacfitaatocserir.eilaVHIAheiNriliyanusgleGaaseclyhstcninhiratf nesrilgsachsaroCndrehrlhsoongscnlsnudloo,ounwihsouralhsedtttnfueseotuottositpteis8nssasmtdtuinm.armshddWTiytfiTeiteidsoneomadfinnereduiomlaeondwasihibdapdcwocrclnHno.irzoncnhodmapmdrecosecinlscroaddetwneiOnoamum’pdceTcetlluhieEocaiohaenewinsglchiMgSitlvepiadlerencasnmaetrttep.aMeuugaoltldyttupnuhhkrm’aesenmtilsikNenooeogustnlhhseoniGThDlcrmsnanoledenaniPfhaesisslaaetdnseqaotlaeraddlioudeuutd,iniasb,BsutspbebarteieeeonedigrvoYsstlhptwerhfeanudoemnu,rR3ona,ynttonrshdncagimoenntesiersslieuotsrsyriroleu’ndndsdncofitbeduydosacadbflao2uwntasamrTiwvtianidgrw,stkorrittumvCt.aolefstueohbepgwauamhwoivavunetrylaocme2taeecnsanladnreecboeueyoTytwiteneoebEpcmuofneleAeehaOsePrtbNirnheinriahlrrry0Rgpoe.ttieiidapdvhgyssfnaaomroceahoaehCrigboooratrosrinntnpcn,utalnassgrtceooeocnLeasatiriaa,rihfrkmaeiicituuMae,glewquuneeeny.ituetlnoarroargf.tthcsklclosraaatrcihcmbtrssnygscnsgoDiyrslf.nltslctsaturaenoiCeeoAsttthafnieomsnectnpthlerirfh.ltatotttnoooe:u,donetoor’huimoocle.sscahseidnepimWnsbadfalaCddhedtdbeahsgcshugtamuoennCtiwgtsucmoaresityecoHhdohachejjerthdudpdaeeusaelalhaian.-ciiteooebyrratiootnrtiaelahErnaaovnbnktanl’ewrrnTnCtlnnsiarinneslylsryuerhdeanrsanenoetoevhaifsaa’gles,sLdfmsWnci,pdedhsycdarnwogtbd.ed-hsegidiPiacnrfroWtsybrnaoQe-aLvtieoisgt,adnhRdiw.fhoohs.thstat,zuntssgao1,yaafnpigsodratuhtg,nasampteaodesregmlts.amalftaarhwtaMcuis,esaikvegenhdsafsntebhnnctaehsdbyniaeee,sheltiswchb.NadhtieydnlrntwslioahealtglhoheOipasFcbieAnenamuinmoo,eeiuasompagrnRngremtouiCnedgewalromrstdarognsfedtdgste,idaaw.doeereplraaeiTgbtow‘ohtsnMebsyahrwinaMuntnrlaaotihontaonapeg.cAnoopnauobcicaig,heaggdnau’anhsfrconrtrouscrbaiepbpaegseinBesPetthnntaonosiktdoaosldurirhyerotrdtpcnrltrendndheo-adrenuh,tkl.siana.oiaeehsgg-cncaaytto-fyntlswtJewfe,tiduhTan7sodiwHsiktfhnslerey,hhctioypehiialiPhohawlslenprsgtwitauddtaffc1ysmRreniu.ol4inleramnn.mmeasjoiuaiA1teodornnoiag-uepArrirwoocnhtaAniTIDoiaamee.eouowcamlunmneupyddcnglreCptnnrasunsonltoentiw,eytoeaehwlrelrvotgrtnrehufotmria-”d.saauszhffuaiidtsohvum.atKesoesortei,oiubsnnSnehral2htanfeieilaetanypnlnimgfnfpndaisnyentts0rTegaletihoulgmloTfirtf,agieangtlyKusa,n.hcinitdlnhfrntgAuvnyganBckutaatnrTmnbhetdatitos‘jSsawimrdIbvcaaigfeeokoSedorsceyhitihadcotttnehlusealgtdatfiordaaoowe.dnneeevhrprialoud,iwi’hmsdottcetee’lecYS“TnsnadsbeuenpsisdanrentnutjnieltnfeehddaoAa’smEyseDstn.rruufkinuWaat.neapjehnkurrw.eddewlsrno-ierdcssasussmnmwrByp iellgoen’rtstoe,ctieei-edo’hstcttttroc.’segasThdadnr.vsarMTPihsfeaaeauoarfiaseratdatoToirceasabsseeIAobeiioneac.slrlatevfsCIlastJeorshtc,pptnritlNBlahrfSywasorfnalntdftDfiCsccCSJmcApcMdtJwprT(FfzmaaoKyrnhooeptn,rcrafaafiesweeh$oionaiIaiueeoaoSorbeoeuhulrnuaioaiTteLtbhCeyroSt.ufpEoannrmuieptvtwoeoelwasnlnn2sldmn’rdwhsrcrePrsdmytihucdylnymiaaEsustatwatAirsndTEyufckkrtdsaiwe)setcntmuaNedgoooAaaiiorOt.tiaTiabmoere,eobopr4,nV’ewSRfiSydhrcewtStsictmronatbtstLzrsshn“rAhetrssegedhi$ilrnRrreant.dcrsduntnuimndIEsctpsheieaia”SdeetSifaoatetwruC(f(IetedneEehoci8RhToiuprvewTtoincireget.nti$a-cmlNreiwneesnrclwceIaoheoraJide,in)nnra“SisethTeevosOmSiretuipedeDdBers5&C.apnp,entrucsrmtsbieeetaedslel-vaotsichrsfstaertOtrsm’gkdniMeo’eCihrtill.anelnBt,rmoatnsAwfshmvrrccicuurbdiytoomoBehneciyohoekmcrsmhttefniisruhiisreatehuhelpnefLghtdaAndGalrthg7aesvnm6retnraftanrdahsfaaatrlhsylybcecoaseeiwiess5gnresfa,rhorola,iiaZnhtoMsteramsolxernDyihssvmassltl:rrtpaBfvbm.eewtrwmincAuaSemaahiocnmlaqnetfEstfpipruimlaetaoisiteotaiueaooaTdohlnesbirtoeeoimnfeaa.ptpcdecvcttMpossrYrntngfasiauelerod“nnk’rrihmnCf)mfpnntorfIrlh,ohucecbbdgtaotatrQehi-mupge.wa,karhsctosesihawicpltedupCthshwthniaonedelilolddthlsnenmhu;heaeruntt.gnente-mervsialaehiaolhgombivoclfenastieoehietheartegdtkdatba,setpbnetgeehagaeiums,r-nnhptpbtJnsr,..umnehcpddroesyeehserelMs”s”slncu----deheTpmid,.,iLlciawtl(fvfaunkaleacihloskMaoaylr$aieteessni’auaoeoDersooni5iSrsd4radnnbunnnmwvdsnooiiSC)yoaJoytcmsctetmdmippCufihlanfiot”talTnn1larRraule-hpelnu’hool9qiaoiygci1tyundnnerduwu-uc47omoi.t5ieigtcc,retoefn9hnne;ceahaang-roh-tfand Red One Theatre C
each notched two awa
independent theatre div

Cliff Cardinal earned
ours for Native Ear

with wins for out
new play and ou
performance.
Red One receiv
mance ensembl
and a Dora for
ing sound des
position for L
Galerie.
Now into its
the Doras
honour leadin
talent in the p
arts.

The Canadia

LiMvOeNsD AMY atter movement
Uan.TabSdehs.gecctihnMhiesvdueitusol5ildrec0aioagytfnhha7dn5tadBscneromuynnnocaisnevrdtroectFshrJe!usIsetlatysairv,1llya7bslwutoaitftrhts
alwsoithmanaorpreianigneg aganladfetahteurliangckCiorqfue
coFmantmasitticm7:e30npt.min., hDoipmihnioonp-.
juMSC“sthTtu.aTshlwiimccekaeaermnnstsdtU:eB$ntsei1ots0yeao-dh$ngC7ade0hvsbueTrraucinhersgs,eesCd3xla5JHiy5ekw,nCJAesuoi,MtlLoy‘hipIn5eB-r ERFEST.COM
yoduemannndanldeTaomvemyyBoaunk,s’ ”witshatihde
SpNeaetiocnha,l wArhtsoCelinvtreesOirnchAesttlraantottahe
“wIC8Dikthophnmu.mroichn.hwiDio,so3ntm5-wCh5inhiaCiafotoelmn’os-paeCbernhsreadSUlemtn.ncieTtheritcsdihklUCedenthsriuut:eerncdnh-.
de$r10ly-$i7n0g point of rock ’n’

omgrneontuhtpeisiArsrotriwPlelTsnmthetaeeRdkrimDnhgesOivpmbe-ylhuorDsopeipc-- IGAL MARSALIS SHINES AS TOP$iwtrUtsaj$naiaeus11lanAzle..ec7w5itszidhsfh62tBgtetepmeeriwprrndworleoluaiuuwoadSmomypsussteikepittnoailcllacrlyeytrygeixoaeieransmncnanstngeett,NnosdohlsctracneereahhmrebeaceteAneenantrsafuliiu.aeaOsoldlnSMt.tlndrfgeiPii-leesdlmHéRhPttiwllacnaeoiaomnyapioeydEsnftnVdwptriuphnswtnreoT’-hhsesuuagifIrviiitee,mEcanellithLwelpsiiaflAnaset,teReoirthhehnLntrtrrweihdeeessr--otcHEasnenalhbtaaCU’,detgÎrocatmlweegemaeeMnarndc.epaceokdattvhKneprfoaiardefnotatoaeogngmmmTdgrbtihuaeaarhaÉnrlasesicedwlsdtiaoaechNWtdluroteor,wlenaetwatsad,o-w’essaialchtsoscsoabsTWdiosohitncefaynenhnlaaodauaibgsrhgumetalslge-utteniiehensrrlwattdeseawsitninaxhdattoooyhFafuBlyeehgoffvbetnetopaeeWsuotsfnthrdclStotchdtmeniiohaEafnesiorvateetEtesvc’hseitsaea,naanlChtaeNyenidTrlBTnilriAlsre.iohcvsAeecMnsh.ecDaieotldoooaPloCdge’rfusltdanotneOoOstaaEowyrnntiNhdccansghtstnpodAeanaatoiwmwrm’nriis3akstCdechtahwm2lptus,h,eeoin0wahhnkerersa-aetnydaeiheieohceoJhcvthlle-ohahpiafeyarhalburswueylaazspnrntoaul,artsizo’alpbyouhtslfeaneusfeeetirdp,dntrdmdna.sotbMwosekeatuxehdctaesinks--eiacbihtBmtnrrvrPMYairooeeestorsaOJwhbPoarCtslanreonuruhoasilyfornaeermag“rsAsnctuegkii,lrsCrrnkIoidtpc,scartnneseosaafiwlraecozcahrtananoZseoroo.lntndencueemerteosontwroeIAwrenhtneec,tscrirf?CdveZgtnvauuhetalaalPfnTiott.wseRvhielerien’CntoodrdslmhnUmRF,evceaohdoCScodnchtgaveaDdondengneeoghttootaemeeeEnbfh pdyrniraolcsenlvcipmtedeneendilrhuonwycaeatbskdesoadofSaembd’b,trtieuvlclwseor:nyRlrnnoduuelrtneieidSeeokrwe,JivTvnheeHarchagetrdtdukactetseasamahi,awinhhetaezootnttecrgCtdwnDeaseteiehzeeiamaR,ghvocroaionlOdghdseaangeoowk,huafndueelvawtenrtnsooeaoinnEaanue,soasrereozlvhdtalne,undCdfdneiyleeikaritohriPrftoWttdo-Vs.sraiebbsdthvaRhahhspatimcsasnoaivoeslthoinanmoecaer-IftecenaeutawososaekovundtrdbgnEslpnahohtrear,ueuisciaddkaaemcsd-ioaa.tocsWbtnisiBSpHniasnnrinht-tEuneerasdgigggEeiiroidsaiiMtlwichretgpdct,innnnemrwdwhRaooga,RnloniiTggggleaeutaEhowrhniegAanhhtuhtotnhmfEtspeonFesrthateVisiLwoneoafeAsaltdtraMErtoonmno,dsaehcdhLi.RanutdsanuYTattpPfewaenoIitiettgohrbgnPrsdVhrurpahOhltf-hQaabAynseersopNuhadePvcntaaaSdposloe’iAcikuysttd1Ryenslcs/rteuiffsurpiueesA1retldl2tooduriecpooiiugrofslaaduDInFrnmrmeedhgmuuea-entroonnnosPb’ntteerdhmntrcnatktasahB/nyo”lsausdiaousothagasiGitetbanpheielletrafnlbgottrl’d(Emtndewebrostliteeahul.socbulevgTgtdu,oQnfaro,shofilrasepButaemTtiiatsn,omolofn.audgneeraptihYcesl.ARrbnlrosaoepmucsdseoleeosbuniatgeanIrnlbrhis.mssou.roMtf-ireyienyciuaipcfooisefda.-gbamw-gbtAke-tleqm-lhrpyaThnlaGtauaeray-yoeap,ionEdelt-ysJmnlSeund,oraacodFwryr.awslclIuewatoLuAhaoedemsEegnpduonsSurtWssci“ufeetenteeocoanai.artorncfsletetlnhlhhuar,otvahniaettenectadretgtsid-vae-easacfaiamfsvntpneeisear,hctabhohinlapiaesdletlCaTrLsCWcyemiefnohilhnovflavudnoieeagerssebalcrttnnhesWe,hseatgvi,reeerhnnIeaeMepdte5Dsgdnf.Atie0NtaBcshinocmorntntc,enuehehtnamovo’tneFaNtLraeirrtfuiceSennnreteaebsedseHnsrmtsieierdtorhcmimuoivtYafoevwahemaetpoyvaihilrreriuro.veoelstyeMgeBe,umhaba.awosurtnblTdats-eyeateihygn.hchrcnroaesdkeeetfndbeond.ca roAlrle ayonuda parolmootteor, fmudsiifcfiaenroernt
U.S. civil rights marches, but [email protected],u’tsprtwoe.vo”svteewmnreetyediknibsafob.lcareomftmoaar,etnbioytn

tShepeeveenct.hP,howtoshaond’saudoino filteshaere
bowaelrcdomoef. the International
There—leaaroesnimnegaantwyfrogeJoeaoldbdAourwmeansslZtoohnaHisdstyZuaoensaimdrbMparonvedy’Asoubr huNearingBut late last year, seveTrahl oeff3e4rs-year-old Los Angeles- confines of the theatre, he and thersemhaovoetbhesetnosroymtelhleigrha-ltetvhele mmiecnrtoat-ion). and force that its Coltranesque was (mocsotmsumccitemssefnutlibnuhsiipnheosps.
WhyandootheyroounPewefotarrCnsaatlnet.courhae, baarckbferotmter? sineAssMfBailAedS, SnoAwDhOeRwoOnF’t wJAorZk ZttthoaIloakntgic noDagomedwceteifotmrhorebmhfeiuhsrs,iaesCl.hmaoanmcmebmeurtaaroostiawesmernbdt,eewhCsgneeaaartrnxce-froooprwhaonjnapzirszitnsaocneudnobdfatthnhedaltead- Black Film Festival, per-

leton University, abouat pbepceoamlsintgo not just jazz fans, but foorfmaneadrrwanigtehmAenrtrbeysttheedseDmein-al
veNleowpOmrleenants sfaoxropdhoonziestnSsidnoefy
The grouBpr’os o1k9l9y2nd, mebiuxte,s jazz and rootsiAttotsstatharetgiessats-meivnee-rtraiemlsciedo,neancnecoretatposfspoaomwrsrapetouaylrrnlete.iatormyf. ainstream audiences vgiroBlalueeBdtcuaehwtse-itsttah.hcephthoaorercotmhloeuksfctithrdhamseaolifsrneoesbNmtriaoavndsacehlhr’s-ned
projects he led. Wednesday night. those storied events. Still, in the jazzw,”aCsacnlceuarralsyayths,eadhdoisntgothf atthe Bpaacrht’sym, aost imimagpinraetsivseeidnsmtruo-re with its scale also marriage and the lack of coCmhimckuCnorietya mprinoogrrbalumesIWmiga-g-
inweaMm.eTChehni,ltdhereconm’spSousimngmtale-r
htenNhnieeWsaeaxtsrratetlgsyShvyhte,ofeiuhnrnploa-gl,mruthddogeeo-hnlmhuilavisybtneetee.ridnrnehtdbgei,aasrgntghradorii,gonoThuveh-pydestehtasientjaoJwmjfpW1lsaairaa9irbeinzanttzby7eNzh.gsztcn0mrpbhaahetaHeWeatsirr-ahnonsdol,ftuHusuystfneenJroLokimopnAssnconeidnnMtstwrnoiaptno.mmclhscewriuHenineafoieofteeurMapaeaoaadsMlensnOsrpnrssdrnstaiaicase’jC’tcclsewbrtDavyciaceDsesyrzswhettuosemanea,zi.hoherncvlitvvlsaiateNalyeelsoaieslhinlevltrlvaldnDhowymedotnoOajs.oieaioeanrdwIwrnknuzsauosntcosaszgoheagicnmostnvthnlteh.hgolseadfsiasokegersasw/wtmkWaefrclasrahwioaaaianensditeltalttblhydklergso-tealaooomRnklfdu,geHsnse’o‘htytrptrxnowfoeTYa.coeoeito’nsiopchsrtbotdBitiudoaehcnaiunensovatlltsusygliuavhtlecrctrloyhtfbes,oicoiaeascpmcaroYmerronoegenihs.lo:wtogsffadoficewatoeaisnuueearnenendairaiugarorcrpmedsreeettattntoxldtGthhnuTtpniyhhthvd,ooederrurhefhceyeaonosepauyeTsenfs,ofocdrrrfntsboaora,ulrheosiodttevdcysnasuadieiioayeceecsnoandrisdlntiShEeyanaWsnu,dgcoi,ecr,srrpoentiirai’hsweltgsaog.oniyostihpocedstbpdlnvth.,orail.larateirdsbyhtnaetrmiaadgoniantvtdnaltdodelMsti.,nneh.iBFhaasr’gisoncuaissrgahstvatarlairtle.mlatsiomtTnvoapbohingtlse-eaetbs,3a0seippsiydnfeiledbaMheosrienegtsper,a’tbstlayrayheanntoeowildwunsfSywj“huioIrghtoplai“shlkteupwissTthlteneoaeeohwamcormh,lrehntlwayik)i,semdyno.cwiaWutttowntuihhtehlpphyTueeegtisatnit,oanofhasnwhttstaeteoalvu’shesghtinoogaOipevnerabamneMeercgymveyrcsejsdeaob’eheoowirvawiwlsusencnyburessaisihlieecttl—t,Atdo—im’hrrihshx nl”laaticpdele’fakhstswatoosrtvodeefuitnaaeniideemr,etntitnnse-‘nhmdaIt-mt.,tuwpesnaiocstp.saiinoendce-s tFioiwNelnnmiattshswhohScfiiatseomhrprcieiBeheuceesensltdimirnenasropstacinhrxoeetodlspUlpbhaoyonbtntlioihivgserehtatTr--ed
D61a3v-3DspbmT6ituledao8eoYmnyosr8eansedos-ane3idrtndons2hsusu,M4aetet5hn4terioe,.nfMtEWoLhtuvoiheefrenineerrmtdyrhhoaadiifslltpa,l,O…siywaogi,ntYnPenhstgndOeoailacroelwlhd2Ues-- a Citizen 70tPwsNtmetsbahhaoaaraA“AwayenececTsnsCrhkdsatNehajeCdoHtuJtmgenwaooaausetcttenoztCarhpsOoi,zacnostaremsftuornooFtnemtihwrobaroreacnaiowiwtsluogben,gtrhrAraos3haiaeavki Ao8citerws’catisk.tdmoahhflisida’tntsdiatehuhmnConopCretCgehfriO itsaeleetonhsaWfFTbdauipynrehtlssdgettrleyetoilohalneaer.rTwniamaanyibnsuweasottmewttsleiihro dmd’gtutf snenaeheathseniholeachtdmnw,esNg,adeiwonriaanLahxtenOwiAtemoLnfnnnyoleighigoartzCvb,ddkpoeig”s--t,opaetteuto-hhmhruchdmneso“orKaseotT’niWs,nmeaphtyehdTpTilieane,Pacscus”shtDalastdrh’soapsEew’rhNeseirnseOctdaaiEitTstohddncyauaghtptkflfyaRwgtomthfrrisalttooILec.iaaTowmpumd,wCeactinncorrsa-amhhkAedneihi’istieoJtcal’lsaoatthiNheaarsosbgpmruaasz:lWthuduC7$3wQAErassizioslth3faoenl0esUfW.Letep5lddc,MddfonsalhaoiRL:vrl,t-ecrFt-ytrdmraIaieAheidohec:EsdteaNeNnimhbBlnivskteueWyuconoArptA,ensaTio-rs.CocNtCestnrensatobseIoanEFrtscbinsw’vooresanT“osotoiitt.utSIdp,sncuxde2anf-sirwHkatal0tortoctedHpelvdmhe,fewrmnflscfafpe7bSeui,eitafoiEI:ctuushnoet3inCu.wwmemnapvAs0ispcTotRgtgoloiteidihtacpeltenrehNtctrlse-yd.hdnnwgoemromoaeiiaainwsamaht’lc.xwnocsaTwngnogwk-vwtikgcahtmidttAecrieohninsahnhnaoedseadeearsgiMra,t.rsmbhlcdwsk,auowk,beaaCwiooiisa. uerngogBtehsahurnHehiny,tunletoaLlsiebby$aahcthanaecx5sltuaonYcrtt’geeegt0tsrnaeoedwrdiarlNadgradaueuossmtdriarccsa-ttbtuisiht-ythhnausemisaietiagLchamffdc:ngd,inteargleo-eng.aleyasneCtTCPOooeOrw2wPnCFWuCtMariiltotnDffo0peeaiho’EoDantdieWTWtnesateBltACnxgtjt1nnne.OyhhetTahasoua6stfsacfhtHwaTpptMkmoaeeucia,feIzemtnw,attEgohruvpe.sutndswdpiIlCdzrareohashCecaaeeeeVQwdaedabnrjRbe,neeaolatelidirai”atwdTsatriloaaa,eSnoant.rlddtleheoshn’tcaiuczyhaeahaananirsffrlyhotHticstWaseerzm.eczclnetenmayhetontedciaeJmkasdoiL,ifsswiyunsiInUatore.unseagy,tseharranhnsoboayditryseunoziohhslariWdFtothnfyhMawfttafnnlibnizgn.oaeytmr’huyeegaoiPntonshosseigthndnegrsuFsnnhnnaafnagutosmUartb’sir,e.mhePcsitroaMarMti-dltrymtoegHedtgatsrOnPnkaornasl ehtewhasphbhvieh“temsnJs,hkifrroleeti.iiaetsanualevtto.vo,tesas.ek“RtivxrheeStgehttesaeAHrmclooosmb.bplonrgoisstetesrfldiesilmocoitnbarsiopmecamhituutuaHeoathfroecreegSanhckPyuonaakeitgdnaeyrela,olthpiHtwheenkelaleadotpaeetteslp,pnkWtieipsuvehiiI-srearpdltnitJuQyns-dtImtgpeatotsc,e’nroneuTelowt,tmm’atroiagacresmcismduohncre,wdirwDrsnfeaspomiamnelomuirtaltieorediohaueltminaInuhucnhlseldnbdtenr1vsssireokiiradd,epne5konyddci.s”nwtse,m-tWssnmm,jsobugftrootoieegootn?ayinauwculStnpdtwcsoebfwoirlihfohioeuuspnebSsR“tiptMctgtotetaatllTnnimnootiaamioh,hruehiainressn,BsustaA“hlvexolaosnethectssvosebietilesteaWie.oerhsltsn,locdeeetnoswehncarlshrohcapeeeermheirahefegra.aneaafenohud’rdstte’smh’lhwbhctp-nrersnCrdetwhtitispoehi—ceS,xswsaemeloiieabisnuvsmiuaMaoYAIiecasmssssngrnfeaocsmtipclemaorñnntaiosnaeeauehostrataito,Rbojsuaawctefccipto”ofmdstiuenespsahdwatercaiou,lapinaiofmsmshunIprsnesitessortlvla.ionsntT.lrhecthogpugtoeno,irrs’nasBeAnlstioeHheeicspdiaeworisosEsildecnoeh—otcraojtvtlaahaYrkbienn,fhfinsriXoore,dnthuensni1hcafotndtpeneoaegEoboadrdCro9nitiefhutBomtaeehenihsiomnne4gfriAhuunnsperEreoalnsabts,ssnup3fugpifcastrtaeLpRaectteshyTb.tsishteiadrfnltyot,hogs-lgvttbaLenhtothvnroSlbaaiusioigsscmoeW2boeicEooyKfipsstoieeoeuneeyy0tastmnrnsioofahtNunaklOomo1eewsro,elyuotoaytneovmnnfnlrantw3bsdCaanawscpFeaeuntrnnlwwyoilOmesteenryTirgEltecaoTshaidulipn1Hdewlverirf0tr,duo.crest6tntcian4itnyhoe-2eeltoeserrli8atmh7shk’hrn-eek5n.oona_sc’dtiovapld1vtni_mtast,e-aef1yrhrneetungneioogatsaroloegdeasapltdauiscrduez.ungdnlaerfec.snn,timsres”sfpteB,cstittoflconsugdmbodyhc,ich-ouherwnnempoeabyeetotsabenrdlnsairowrstffuiftMdijacjaasene.ae-eetaanecawnmouthsbbasrspeiazznTsssfgkoaptootaii’oeteiehzztdtlotr,hicrmehdruuthsvereos’iiistirsesfgfeienvveomgttwaowona.ofespvryarnaaserhlnrstladiiceialiiprmononoeollryesMtaenrciog.eirtdtuuhgbtrnematlautI-eeoosfo,ias,esnnbtadcntreslt-e.refrhidtedthsytgBgsl.meraryf,naaiteuaisin.owtlhtiknnMtitfrgmseeiiiadtytctgbbbwntntoaoJslhhhihoeogioue.ghgnorAtIIbe,ieathneiuismtadifnLsyecnlgihtnmttbsrehcCdrneboh—sogdlti,soiutplsiaadoe,iOsaaummrppfaenmsbsaimsaneilreepskiuopépnoarcconrrleefetdrgaBvfmbvlarhheaononaaoygdodoyonasirn,eboeeaobinul-tnoluSovglugraysosaloplldorsianyfimt,lmtueocnldposousisculuwrr-sootsvy-iiptraeanektesd,hracewueiis-enmeafa.tnldefrsoirFallhlncdBlenyclgyyfeaowphiomowpwErcpowDsedhuaylbnetbaasruiiuwpaplrl,auiemToilntahngolcltlriusoytrtsr,itpkeoghuhngyholinieaucewhtMiwpvacesaottepienofilgosgtetoFlrtreh’inneIspEtosaatrohrtAhfrokutsn-stfonteohoxsudcatlniro.rwvo.ioertlo”srsnros’arnseathsdikrMhyrhetmrrosnfrp.e-t’bgodp’atSsstisa,treeeagihtgoferalieuodeorownvyeEnotesriddlornfr-pkcodrngfouizcasedntop,nm.bhhafenyyaoeosefbetslitefnejrbNalrtl,s’,,viSooetsdcesonifvasatiavdosewiygwokurroLospayvitslwiDcrbmobibtieceanalnsaoemnaepheraa’ednnhnoenlnlragaefthltl’yeitosiT--i-tttinfl’cynTvznnorMahegzae.hggfne,rin.auwsoproloTcdnonin-imn.chtnadthihtephi-eht--aehre,ne sitpya,inNtiansghs vofilalbesptroaclitceex,pMresestiorno-
NiassthJavciklsleonPPaorlkloscka.nd Salama
UgrosroitboThuneahpraennpgpdireeofMcrueefepsoiliwennrxigmiet.shcAutesntrtdeudidneawntshhci.neeosngueTpitaprhnwelcdeeais-
ofthimitesfotrhseonloeisntsctoustrraygefrdomthtehe
kipdasgetoanrdaimp parnovdisde,atnhecyewweriethno
section.and their four-year-old daughter, thls“eeoIsMmlsoaeifmrodesnpwearlsliietsthsaglsaieigvkbteesae..tnodptohbnieallnindygod, aaurnindnggh.e
geBnuet rhaistcioolnleahgauessswoerme nuoclhesisn
Annabelle. tttohhldmfeeioernreiiuxgmrrrmp,ahmbicrmdaeceasioeabsnsrmrilsesdAtpta.slsaPCinnaJitadaiahnrsncltnadoiksstsestasoEetnDonhnddamwrenstioeyqoNurluoegnicemieshzsett-taeesini,rndt-d
ouant,d”tShepgereecathhsoarnidp.la“yTerhsewreer’es
with their spiritual and so-“Ever since we had Annabelle, afufjatuucuBshttruiuetetovraMoeesmnsiPutcerrmnhiiktanesirnewcogleueJarssoaett,crohtkhmtesehieoynenndwrtiieetvorhi’nsdea.uatal

Thursday, June 30,our outlook on lifestyle became

cially conscious lyrics aboutdifferent,” says Cancura.

Husband’s business 2fa01ile6d. , now he won’t workHiswifegaveupherteachingjob

God, poverty and family.and its punishing commute, and
tWfsdaropnaoHweldyimdtsenCsn,’shoaheTorfskifusldmieecteaptieeysomt,,,dnttabeaoo.nuyTbtdCssehhyoateeawrntfnflheeeeTdestishsottncbmFiuinfvvterrra.haaisisliOlldesdlg’shs,naafthbefadyyaMsusiosstkkth,wh,iloiveihnebnnbma’egs--liuuntsmihmpthihnhneiCsoiogeersesBvmhattemonsrap.”,onpscsrhoeuase,ekextrdwaltavusyreythnpiseieoalcapiaalyoucrewCstr.ehsdeaartlisnnhreny,taaragnsdtnsi,sidtbduaeodenlhsceepseds-tilpoioasuinywtrewwoahriinttkihhds-hAeTrOmLWOhstcthrioeiihrtcaBCesnoyrtcnmtedteasnjachaohsecwnoitrebzcnaolcawceaszrenugnuotin’ropJssbsrnrCsMeraeaaeacbmkeoze,,tnetanwzhrfwufhrdrsurttetFhsehs.ehosrraecoioremeesblsnhoiaOhwwtyMs,nreiarvCmaigargvosclaasunlasehsslninonbdc’ftestg—roeacohrstmeourwhtesjeimrorhtesiayaahrJiateinJoatneioetRhanhezmutwaszodsevzmtdzrdntiaffrtadaooutegmeoytrkr--ed,earimtfeOnna-hmooJnsttueastrAifeisagIomdpnjsLitwumaocrseawCeze,arnselzevswlpataOy’wrisnsseflobahleorrtcsuasaoadoicIritprssuakhcfatrrsejoilekniyawpp’en-eiklednvsbyzdssSeleratetztaoeotu,cbasornDd.rsluhmonenaniieipadbtcnn’(daetoseontlt,mgasayiitmeenrsfiti,oyeoodysetnmo,wnowolturllaaayeeLsfaresnnnh.nionaviattawdlTdcdebdthalstfsehhlslaiwetlotadeuethbeivcaeeimpnimet,cdreatloegvelhiclbygtrnsr)eteayeptoi.-rshsnosl-asehunyhfiuiitsnmhl“Opihgbesm.ai,ruyTstrcno’skh1ihv5isob.eeen-tetsjpaaetmbaerzkslrazasase-sdods”éetneamaerbontoERFnrsuuesometmtmlajralaabpdoztilezweleEt,[email protected],[email protected],myednima,eMtonNmahwnddeeSaudisvtseCanthihhSrnraychieuviioteBrNsnetimtyi..tloeldceosodlpdmailerSptrmiri.iieicaepnnooeranontocgtdluecinl’rotemsirhowatftcdSaaeGmleaUianl,uls,eawywMmnaIomb.hmramiooigmevsceriarteahdereagGrt-Mocr---rcelaoarannssrhsscsciawecrlriiiatnspnt’sdion wseu’rbeoradlilngatoeitnogthteoobrcehteastlrkai’sng
abgoreuatte.”r, nobler cause of waving
[email protected]

twitter.com/peterhum

That message hasn’this family left their tiny apart- at Carleton all day. “I’m by no means ready to give Ellias, bassist John Geggie and tired; even counMteretaennowr hDialnei,elyou two could con- Nashville Parks and Salama
ment in Brooklyn. “We squeezed Cancura says that his musical lifne a ubpatnhkorseu mptucsiyc.aNl roelwatihoneswhiopsn. ’It Monrtiraegael darnumd myoeruGr roewg Rnitdcrhiive,e. Taylor had a rsairdeevrocyaol huirccpuapr—ticipating with him Urban Ministries. The
uitnanOibBnnearloboieolnevke.a”lbyhnlaenhbdua,dtbfebinienaengncini“acBlrlyeroautonikvslueasiylstnty-.jaoMrbmhrt.yeeaBaaHspdnluaieetazyohersrtweid.emhtuoInekrnctrneas’eibntnnaugebtrotvaseofsieieOnnsndutmettnspayaewsspwleaokolchfrroaahtltsbleiaaanroblkesogu,oe”-tusesboarnay-lssastbconaiotnegcYwegenc.woiotflhilrumditertaeeedkhrneeruamcaenselasdob,nctyjaduoaonszfeuzcdorrfmr’sest,apuhlatosaienvirscisdtetiiyannayntglotso-lsuhh’aatiraesnletOcvdhhevotneauirscgatahlell,icgntolhimbticsibiopnfhtBuehehsniMscel.tsadaia’ssntreueoatsdrp,ilansMfoyrogtraoiswsasustnororfyyemrfltikenitnahngicnaegtsan. ejowb——etvoen
our way into Westboro. It’s  a very group performed a couple
of hits then encouraged the
changed for Speech, thesmallhouse,butcomingfromNew kids to rap and dance with
them onstage.
York, it feels like a mansion.
“We have a driveway. I don’t have “I feel like the young
frontman of the six-pieceto look for parking for 45 minutes allowed him to record his 2013 afil-nanractiioanlslyw,itfhomr uwsihciiacnhs iIn’mTorvoenrtoy, “IwaanttcIhanintogbferaotmhotmhee, asniddreel-inemso. re celebratorIynthtaimn ree,vesrleonwt;lay withdraw from generation has so much in 26
their hearts and so much in
2016 Media Marketing Report │ TD Ottawa Jazz Festivalafter a gig,” he adds. Nor does he
collective, although the mu-havetodriveabeat-upcar,foresee- sgsaahrlleyiynaspt.teei“jxl.v”aIaBpzennurzesat,mstnIhseuadohsalipsidctsoire,asywfyntuooastrlnoruileteycasntl,oto”leyomlCepegadtleeanttythuchoauepnesrbdearwe. iptrhishnrteorgofualaeianrncscgttee-ihonbenous.uetgndhtbyoahsytoepsueiuewnninrrwhgtpeeeifnnlamicnrgtohreomaienetnreifetcofaseainn,aerdaleal-lnlysdsurupapptphooerrtrt,teeodnyjbooyuy
EciibnnSauastmHtetergDudEomofrRowyer.nnaBHtJuauotlnmoaolfebA,huwwimsha irdcdoahfiywn-tihatnhse,enydboeaemcagaysargr--tanet’tMNSttehhtfoeaorruvegan.eeelt2s.erwC0ieW.liracytIoolhesanwfIsincahrnodenoardarOTtvdkaataestmtapstfowhbhuanloeayrlw.NelntU-s-,AtctptthiChhimnemaFieftloixedreCuts,jairtbosntohuab-f t
ing that it

sic industry definitely has.fret about
cgouunlsdhboetsvtahnEadtLahleiLzheIdeEa, rodrT
“The music industry hasAdvice here. I was once very proud of Your husband can benefit from both, along with your child. their minds that they need
to express and need to get it
my husband’s abilities and still career counselling. If none of the above works,
Q My husband, who’s in his late feel love for him, but I’m losing
A professional’s assessment of get to a counsellor yourself to out,” Speech said. “There’s


all that jazz gossip 11

Your essential daily news Tim Hortons, Burger King commit to serving only cage-free eggs at all locations by 2025. Business

8 Wednesday, June 22, 2016 Special report: ottawa Jazz FeStival
shows worth seeing at the winter Jazz Festival

The TD Ottawa Winter Jazz Festival starts this week with a jazz-folk combo and

all thatends with an acoustic guitar trio reminiscent of Radiohead and Rush. Get your
eclectic fill at the National Arts Centre’s Fourth Stage.

5jazzlucyscholeymeTRO

American jazz saxophonist Kamasi Washington
kicks off the jazz festival on Thursday at the NAC
Theatre. Getty iMAGes

Mouse on the Keys

The TD Ottawa Jazz Festival, running June 22 to July 3, will have one of its most musically diverse lineups in it’s 36-year history. Julie-Anne MAdore With nothing more than two keyboards and a drum set, th
Japanese trio punches out a complex prog-jazz-funk soun
TBheeaychpBlaoyyso’nleSaduenrdBaryiasntWaritlsinogn watill6pepr.fmor.m Pet
Sounds 50th anniversary tour July 3. Getty iMAGes

his debut studio album, The Epic, Fraser hollins Quartetsoloists, ensemble players and lineup on July 3 is Beach Boys’
to glowing reviews in both the
jazz and mainstream press. He arrangers in jazz music today, leader Brian Wilson’s Pet Sounds
Montreal guitare trio (Mg3)Jen Traplin TiCKeTS AND iNFOrmATiON

You may hear hints of Radiohewaads,aJlsoorafenaetuarneddoRnutshhe icnrittihce- sof•tTD Ottawa Jazz Festival Bronze Pass: $200 the Jazz at Lincoln Center Or- 50th Anniversary tour, which
chestra (the hBoiugsenbaamndefsoratrhee becheilnebdratthesethFeragsoeldreHn oanllninivserQ- uartet. Beside
tTuhneeTsDoOfttahwisa JaaczzoFuesstivcalQisuseetbecalglyuaitcacrlatirmioedoKneSnudrnicdkaLyaamta8r p.mC.onfederation Park and jazz programhaet athveypweerfiogrhmtinbgasssisarty(aofnodnOe ottfatwheamnoasttiviceo)nFicraser Hollins, th
BtoutyakyeoouvretricCkoenftesdoernaltiinoen Paatrokttawreacojardzz, TfeosPtimvapl.acaBuotrteirnflyp.erson aMt arion Dewar Plaza Gold Pass: $325 arts centre inbNaenwdYionrckluCditey)s—JunoalAbwumarsdi-nwpionpnimngussicaxhoisptohroy.nist Joel miller, Jo

twhietheovneento’sf ibtsomx oosftfimceusoicnal2ly94 AlbEenrtetrStati.n, mSueintteo6n0t2h.e main • Daily Tickets on the main smtaigtecihneCllopnfieadneirsat--backTehreJaolwnaCysopwophuelradr OaLnGdArfetenrowned drumm
diverse lineups in the festival’s stagegets going Friday with Youth: $35 tion Park. Brian Blade, who hDasarrkeSceorriedseids bwaictkhtBhoisbyeDayrlaasn. Catch them o
36-year history. a bluesy lineup that includes • Festival Passes Regular: $40 to $65 staAglesotharpopuegahFroriniudgtatohyneatftehs9etimpva.amliins. well. Every night at 10:30 p.m.,
Youth Pass after the performances wrap
The festivities get underway a joint performance by two (ages 12 to 25): $90
on Thursday with a special pre- Platinum: $60 to $85
40 million albums worldwide,
Petr cancura’s crossroadsfestival kickoff performance by and has won nine Juno Awards
with lynn MilesAmerican jazz saxophonist Ka- and three Grammys.
legends — Elvin Bishop and 2015 Polaris Music Prize winner up in Confederation Park, the
Charlie Musselwhite — as well On June 29, fellow Grammy Buffy Sainte-Marie on June 28, tented Tartan Homes Stage at
as blues guitarist Alvin ‘Young- and beloved Canadian singer- Trombone Shorty and Orleans Marion Dewar Plaza is the place
masi Washington at the NAC blood’ Hart’s Muscle Theory, songwriters of all time, Sarah Avenue on June 27 and the super- to be to keep the party going.
TThheeamtrea,nhbomeheintodajanzuzmfbeesrt’osfmuTsoicroanltloi-nbeasuepd Nweiwll Obreleoanns-tshtyelestagMecLachlan, will perform at the star trio of Chick Corea, Chris- This year, the OLG After Dark
hhiimghsecalfl.ibJruensoho-nwosmatinthaitseydeasra’sxopbhraosnsibsatnPdeTthr eCBaonxccuarraB,otyhseanedvenTt’Ds Ottawa Jazz Festival on Satur- tian McBride and Brian Blade Series features performances by
pfersotigvaral.mming manager, willjapzlzabyigabnanodpFelant EinagrthsSeotciwetiyt.h hdiasy. In her nearly 30 year career, Award winner Wynton Marsalis on June 30. Judith Hill, Jim Bryson, Adrian
CroLassstryoeard, Ws absahinndgtoannrdeleaawseadrd-winOnienogf ftohlekmsionsgt esurcLcyenssnfuml ileMsc. Lachlan has sold more than leads 15 of the world’s finest Closing out the main stage Raso, and more.

T1h2eirWsedhnoeswdagy, eJutnse u22n, 2d0e16rway Thursday at 7:30 p.m. Special RepoRt: ottawa Jazz FeStival

Flat earth Society leMeow Digging rootS Dan BruBreck Quartet courtesy Juan Hitters

When Peter Vermeersch, band leader of the When the time came to name their David virelles & román DíazWith artists like Buffy Sainte-Marie, Tanya
unpredictable (sometimes even startling) debut CD, Ottawa’s leMeow went back
Flat Earth Society, started looking for a film to the beginning, back to York St. Tagaq and Ottawa’s own A Tribe Called Red
for the 14-piece outfit to accompany, the From as far back as he can remember, re-
usual would not do. “We have our roots on York Street in nowned jazz drummer Dan Brubeck always
some ways,” explained singer and co-
“I was really interested to do something founder Gin Bourgeois. “James [Rooke] making waves here at home and inter- knew he would have a career in music.
with live music on a film, but you know it’s and I, my partner, he’s one of the found-
always a bit the same pond we’re fishing in. ing members of leMeow, when we first nationally, it’s safe to say Canadian indigen- Brubeck is the son of iconic American jazz
It’s always the Murnaus and Faust and the started working on this project, he was
old things,” he said. actually living on York Street, and for ous music is finally starting to break through pianist Dave Brubeck and jazz lyricist Iola Bru-
anyone who’s familiar with Ottawa, you
Then he discovered The Oyster Princess, know there’s a lot of live music venues the mainstream. beck, which meant there was no shortage of
Ernst Lubitsch’s 1919 comedy about the on that street, there’s a lot of bars, a lot
blow-out wedding of a millionaire’s daugh- of action.” Afro-Cuban jazz musician David Virelles has been called aIn fact, Raven Kanatakta of the four-time
ter. “I was thinking, well, it’s a lot of work
to do something like this, so I want some- “We just had some really good times Canadian Aboriginal Music Awards winning
thing that is nice for all kinds of people, on York Street, specifically at that apart- artistic influences when Dan was growing up.
people who are not especially coming for ment and we just sort of felt like, well, “There was a flow of really artistic people
our music, but for a good film. It could be a we’re not living there anymore, but we
family thing, and it also has a very cinematic wanted to pay homage to it in some coming in and out of the house all the time
interest because at that moment, it was a bit way, so one thing led to another and and my dad had rehearsals a lot at the house.
of a forgotten film.” now we’ve got a song and an album leading musician of his genre. His latest album, mbòkó, toppedhusband and wife duo Digging Roots, calls
dedicated to our York Street memories.”
The action on the screen, he says, serves Visit facebook.com/lemeowmusic for what’s happening now a “renaissance.”
a “door-opener” to draw in new audiences more.
for the music, and repeated performances What we didn’t know was that a lot of the
have only deepened his appreciation. Flat leMeow plays a free show at the people that were playing with him were con-
Earth Society plays the Tartan Homes Stage Rideau Centre Saturday July 2 at noon. year-end roundups in the New York Times, NPR and the Village“It’s an exciting time,” he said. “I would
Thursday, June 23 at 10:30 p.m. Steve collinS
Steve collinS definitely call it a renaissance. I think one

sidered some of the best musicians in the
world. You don’t know that as a little kid,” he
Voice. The duo take the stage on Saturday starting at 9 p.m.of the reasons is that we’re getting further

away from the times when we were not

allowed to play our drums or to sing our said.

songs or, for that matter, to even speak Five of the six Brubeck children went on

our language. I think that it’s a time when to become professional working musicians.

people are feeling empowered and, as a While still a teenager, Dan Brubeck started

result, that’s coming through the music. touring the world with his dad’s group, the

There’s a lot of history that Canadians just Dave Brubeck Quartet, and, over the years,

don’t know.” was featured on nearly a dozen of his albums.

That history has always been deeply em- While he continues to perform and record

bedded in the music Kanatakta and wife with his siblings, Brubeck’s main focus these

ShoShona Kish create through Digging days is on the Vancouver-based Dan Brubeck

Roots. Digging Roots plays Tuesday, June 28 Quartet (DBQ). Dan Brubeck Quartet performs

at 7:30 p.m. at Tartan Homes Stage. Monday, June 27 at 6:30 p.m. at Main Stage

Jen traplin Confederation Park. Jen traplin

FMreetreo eprnogdulciesdhaCslixa-psasgeesspecial insert section published on Wednesday, June 22, 2016.

27 2016 Media Marketing Report │ TD Ottawa Jazz Festival

A CH INESE COMMUNITY SERVICE CE Language Instruction for
Newcomers to Canada


Exclaim! covered
the 2016 Festival
extensively, reviewing
numerous shows
such as: Brian Wilson,
Wynton Marsalis and
Jazz Lincoln Center
Orchestra, The Thing,
Buffy Sainte-Marie,
Colin Stetson, Dan
Brubeck Quartet,
Sharon Jones &
the Dap-Kings, Ben
Caplan and Sarah
McLachlan.

Online articles about the Festival appeared on JazzTimes.com, Exclaim.ca and NCPRmusic.org 28
2016 Media Marketing Report │ TD Ottawa Jazz Festival


2 NEWS TThheeOOttttaawwaaSSuunnnnTTUUEESSDDAAYY,,JJUUNNEE2288, ,2200161T6he Ottawa Sun n TUESDAY, JUNE 28, 2016

INWSHAITD’SE

Regulars
SHSHAAIITTD’D’SSEE

BIT OFBBITRAOSFSBIRNATSHSEICNATPHIETACLAPITALrrss
2322211232221144669324466932 HCCSSCSHThpUloooaBoSooBmmrNSIsbdTOobwrtTGtssimatschbiehsheHhytcrfihlsreliiontze/onoonopo2needaCoetes4rGwwwmomrrisCrcCacltstwrabWyraabyaooorwewopdopaawawnlnlatannaahddeeyydednnr23222114466932 Trombone
Shorty and AATTTTJUJUAEAEZSZSZDZDFAFAEEYSYSTT TUESDAY
eaatthheerr asTLTTrOrroooWyymAA1bnn4oddnrreeewwSssh,,bobreetttytte,erbrkkronnuoowgwhnnt Ben Caplan Peter Brown2 NEWS Quartet AT JAZZFEST
aahFhansineisssWHTssbtbfrefIiuouoGvdnlmnalndHdklekbaosat2todonnon2andtdtyMhhebbeeoSrrTanThasDsdDossaryyOOtyyNNt,t,ttteaebahwwwwriosaaOOutJJirrgaamllhzezezez-t- blow away
the crowd WPheteenr: BnorooIwnNWSHAInTD’SE Quartet The Ottawa Sun n MONDAY, JULY 4, 2016
WWhheerne:: nRoidoenauColumnists Centre
Troy Andrews, better known David Akin 15 Peter Brown Quartet
as Trombone Shorty, brought When: noon
his bold and brassy New Orle- Where: Rideau CentreDerekAllison 15 Where: Rideau Centre
ans funk to the TD Ottawa Jazz Tom Parkin15
Deani Van Pelt15

Regulars22 AL JARDINE Super Awesome Club
14
Classifieds21
20
Super Awesome ClubComment 20
Comics
Crossword16
24
WShuepne:rnAowoensome ClubHoroscope
WWhheerne:: nTaorotnanShowbiz Homes When: noon

Sports
Ottawa Weather Where: Tartan Homes
Today Stage

StWagheere: Tartan HomesHIGH30
LOW 15

Tuesday

Stage HIGH32
Jibber JLOaW19bber Jam
WJihbebne:r4Jpa.bmb.er JamLOTTERYNUMBERS Jibber Jabber Jam
Yesterday’s draws When: 4 p.m.BRIANWILSON
ENCORE MIDDAY: 1509238
WWhheerne: 4Copn.mfe.derationPICK2MIDDAY:19
PICK 3 MIDDAY: 0 6 1
PICK 4 MIDDAY: 0 0 2 2
KENO MIDDAY: 2, 4, 10, 11, 22, 25,
26, 27, 34, 38, 40, 41, 43, 52, 57,
60, 63, 64, 66, 70. ASHELY FRASER PHOTOS
The Ontario Lottery

PaWrkhere: Confederation Where: ConfederationCorporationhasextendedthe
lotto ticket sales deadline to
10:30 p.m. and is not releasing
the winning numbers in time to
Park Brian Wilson traPanrskports Jazzmakeourfirsteditiondeadline.
The numbers are available
The Thingonourwebsiteattorontosun.
com/lottery and in later
editions of our newspaper.
Numbers are unofficial.
LOW 14 Festival crowd back in timeFaepsptievaarlionng Masoandhaeya,dthliinsetrimone

athpepemaariinngstagsea. headliner on
theNmoaqinusetsatgioe.n, he’s earned
thNe boilqliunegs. tion, he’s earned

ney theRbeilcliengn.t l y n a m e d o n e
ney Your MoneyofRFeocrebnetsl’sy 3n0aUmneddero3n0e,
44 US oAfndFroerwbsehsa’s b3e0enUanmduesric3ia0n,
Festival on Monday, this time WThenT:h6inpg.m.Call 1-866-891-8946 to verify. The Thing
appearing as a headliner on HOME DELIVERY/CUSTOMER SERVICE:
the main stage. 613.739.7200 or 1.800.267.4669
SWITCHBOARD: 613.829.9100
No question, he’s earned CLASSIFIED ADVERTISING: 1.888.786.7821 When: 6 p.m.1967.
the billing. RETAIL ADVERTISING: 613.596.3590 Wilson, who is now 73, has
PHOTO REPRINTS 613.596.3680 been on an extensive tour.
Recently named one He was joined by former
of Forbes’s 30 Under 30, WWhheerne: 6NApC.mB.DIDWEMISSYOU?Ifwemissone
ack Stageofyourpapers,we’llgetyouacopy

that day if you call us by 10 a.m.
weekdays or 11 a.m. weekends at

Where: NAC Back Stage613-739-7200
PETER ROBB in terms of sales out of the For fans of a certain vin- tured woodwinds, lots of gui-
It was hard not to feel nos- gate. In fact, it did better in tage, and there were many in tars and drums and the har-
talgic Sunday night at the the United Kingdom than it the audience Sunday night, monies many associate with
TD Ottawa International did in the United States. But, the Beach Boys provided the classic Beach Boys songs.
Jazz Festival. After all, the over time, Wilson’s intricate Where: NAC BackBeach Boy Al Jardine and a
weather was a perfect back- studio-built album was rec-
drop for the music of the ognized as heralding Qa new 10-piece band. In the ensem-
musical mindset; one that ble was Jardine’s son, Matt,
who handled some of the key
The Ottawa Sun is a member of sound track of their youth. After Pet Sounds finished Stage
the National Newsmedia Council, They were treated to a full with a nice version of Caro-
which is an independent ethical dose of those hits. line, No, Wilson et al offered
organization established to deal up some Good Vibrations.
with editorial concerns. For more Songs such as Califor-
information or to file a complaint

Amanda Tosoff “Words”gotowww.mediacouncil.caor
PrAomjeactnda Tosoff “Words”calltollfree1-844-877-1163.
Endless Summer and a cel- influenced many other art- falsetto parts, particularly on nia Girls, Surfer Girl and I That was followed by a long
ebration with Brian Wilson ists, including Paul McCa- Wouldn’t It Be Nice. Get Around preceded Pet list of encore tunes as the
marking the 50th birthday rtney, who has said that Pet The show did feature Sounds. The complicated enthusiastic crowd sang
of his seminal album, Pet Sounds prompted the crea- the entire song list from mix of influences on that along with Help Me Rhonda,
Sounds. tion of Sgt. Pepper’s Lonely the album and it also ran album requires a large and Surfin’ USA and Fun, Fun,
Hearts Club Band, which Amanda Tosoff “Words”through a string of hits from talented ensemble to recre- Fun.
The disc, released in May was released a year later in
1966, wasn’t a smash success the Beach Boys’ catalogue. ate on stage. The band fea-

40.U49S¢ DOLLAR $76.44 USAfonrdmreowstsohfahsisbeliefen, faomrmuisnigcihains Andrews has been a musician PWrohjeenc:t6:30 p.m. Project
WWhheerne: 6M:a3i0npS.tma.ge When: 6:30 p.m.
40.C4D9¢N DOWN 0.49¢ffoirsmt boasntdofwhhisenlifhe,efworams ijunsgthsisx for most of his life, forming his CoWnhfeedre:raMtiaoin PSatarkge CWonhNfEeeWrSdee:9rMataiionnSPtaargke
0C.D09N¢ EURO $1.4404 CDNfyiresatrbsaonld.wNhoewn3h0e, whea’s jpulsatyseidx first band when he was just six The Ottawa Sun n Monday, June 27, 2016 Confederation ParkThe Ottawa Sun n Monday,June 27, 2016

yweiatrhs oelvde. rNyoowne30f,rhoem’s pLleanyendy years old. Now 30, he’s played Jon Cleary & The
80.90.97¢9 DOWN 0.09¢ ‘Best year so far,’ ‘Best year so far,’wKirtahvitezvteorGyoreneenfDroaym, aLnednhnays with everyone from Lenny
AbJsoonluCtleeaMroyn&stTehre Jon Cleary & The
90.27.190 S&P/ 13,689.79 raves Rockfest raves RockfestKardaveietzptoknGorewelnedDgaey,oafnmd ohads- Kravitz to Green Day, and has
042..4104 TSX DOWN 202.10aerdnemepuskincaolwslteydlegse, mofixminogdi-t a deep knowledge of mod- GAebnstolelumteanMonster Absolute Monster
GWehnetlne:m7 apn.m. Gentleman
41.34.540 NASDAQ 4,594.44 organizer organizerearlnl inmtousaincainl tsotyxliceas,timngixfuinsgioint ern musical styles, mixing it
WWhheerne: 7NAp.CmS. udio When: 7 p.m.
MonTeBeLLo, Que. unusual life forms to emerge MonTeBeLLo, Que. Where: NAC Sudiounusual life forms to emerge Where: NAC Sudio
13.50 DOWN 113.50atlhl aint tcoaann’tinhtoexlpicabtuintgaftutsriaocnt all into an intoxicating fusion — any sane person would from the mosh pit. — any sane person would
40.50 tahdavtenctaunro’tuhs leislptenbeurts.attract have sought out shade from the mosh pit.
060.5.500 DOW 17,140.50advHeenatulsrouspseliasrtheneaedrss. a chari- have sought out shade Limp Bizkit singer Fred and a cool drink, but that Digging RootsLimp Bizkit singer Fred
6009..5201 DOWN 260.50tabHle afolsuonsdpaetaiorhnetahdastaaicmhasrtio- that can’t help but attract and a cool drink, but that durst did his best to rile up wasn’t the choice for alex
395.72.119 NIKKEI 15,309.21tparbelseefrovuentdhaetimonustihcaatl aciumltsutroe adventurous listeners. wasn’t the choice for alex the testosterone-fuelled Martel and the tens of durst did his best to rile up
Martel and the tens of Saturday-night crowd with thousands of rock fans who the testosterone-fuelled Digging Roots
He also spearheads a chari- thousands of rock fans who an intense performance, attended the 11th annual Saturday-night crowd with When: 7:30 p.m.
table foundation that aims to attended the 11th annual which included an offer of Rockfest, the event Martel Where: Tartan Homes
Rockfest, the event Martel free alcohol, supposedly WDhigegni:n7g:3R0opo.tms.an intense performance,
founded in his hometown of from Martel. other
Montebello, Que., when he highlights included Ice which included an offer of

WWhheerne: 7Ta:3r0tapn.mHo. mesfree alcohol,supposedly
StWagheere: Tartan Homesfounded in his hometown of from Martel. other

Montebello, Que., when he highlights included Ice
was 17 years old. Cube and his determination was 17 years old. StageCube and his determination Stage
Instead, they camped out to show that Hollywood Instead, they camped out Donkey Monkey
hasn’t erased his thugness, to show that Hollywood When: 8 p.m.
and saw bands, including an epic grand finale by and saw bands, including
Rise against, Blink-182, Chicago punks Rise against, Rise against, Blink-182, Donkey Monkeyhasn’t erased his thugness,
Limp Bizkit, Jane’s addiction and Lamb of God with a Limp Bizkit, Jane’s addiction
and Korn, to name a few of ferociously raging late- and Korn, to name a few of an epic grand finale by
the dozens of metal, punk afternoon set. the dozens of metal, punk Chicago punks Rise against,
and hardcore acts at what and hardcore acts at what and Lamb of God with a
may have been the biggest, The folk-metal Finnish may have been the biggest,
WDhoennk:e8y pM.mon. keyferociously raging late-

afternoon set.

WWhheerne: 8NApC.mB. ack StageThefolk-metalFinnish
3$35$3171U..U1.33S91S1 OIL $DO4UW6P.N33$5317U..13S91member ofporfeNserwveOtrhleeamnsubsyicsahlacruinltguirtes preserve the musical culture hottest, dustiest and most band Korpiklaani included a
otrfaNdeiwtioOnrslewainths byyosuhnagrimngusitis- of New Orleans by sharing its
Play that fuPnlkay mthuastifcunky mumdsn7neheanndhea7sdcneescine-c.iaimdtc1.liadtFo.l1Foec.Cotbmec6Cotmtoaroteoa3hrophumrodp.iumodlicnreloacnreoaaocaifacairnlilrnleilltel,t,tcriaadnist.ions with young musi- traditions with young musi-
ciaAnsn. oble effort, to be sure, cians.
7-1163. buTAthient’OsotbhtailwseaceSrfoufwnoirdst-a,pmtloeeambsbeinesrguolfrivee,
bssssahuuhunwotwoctochsrhicwicgewttiAehaec’Nstnshvteshahsihdeszita.sai.ainitotWstatWonuifnrofcoaioieniariltrtnr,olhNehmdmcAwseeohthwsnpsnadiisebctdst-smhnelhpirbdrsbeeeelnheaedawsrnerniaon.oadtFssdodeoCot’istot,nrt,ohOoumsdOogicntefforlaracahihlrllvilgeeelii,ese-s-
sMMddBBrraEaERwRwSsSs LLOaTsTt EnRigYhNtU’sMdBraERwSs FTreosmtivbaolnine OShttoarwtya,&yeOsrtlerdnasyA. venuTFreeospmteivbrafoolnirnemOSahtttoaCrwtoyan,&fyeeOdsertlreearatdinoasnyA.Pvaernkudeupreinrgfotrhme aOttCtaownafeJdaezrzation Park during the Ottawa Jazz88539aenxisnpfAoervrmieeantniuocnee,oArwtnoadfislreeawvcisod’msepsnltataingitne
tetbhhxregcpeoaonuelnltoagrtaoithwtleulutwnfrrrtwaeaco.elmlets1seh-hwh8deoi4oaa4wscws-to8mamue7gn7avace-1niin,l1d.sc6aseha3hn.noiidpprt hhhiinees
88539 burnofuaiglihntgtcootnhfeidsetnacge ,aasnadbahnis-
1 udnlefaidlienrg. confidence as a ban-
12 7 dleRadigehr.t out of the gate, his
26,79, 10, 11, naRmigehstaokue tinosf ttrhuemgeantet,whais
62,69,,310, 5114,, nfraEomNnCteOasRnaEkdMeIcDeiDnnAstYrt:er2u,9am88be5o3nm9t bwaass-
26, 30, 54, rltwfthlrttwirihaiihacsoiec51PPPKsineFtnetF2tf8ntIIIEhfmhgorCCC,gorrN,orotoe1oKKKrao5eraOoa4fcmafcm9l234akb,leabMende,ed1eslMMsM6tlt5aItdutsaohuhDo2ahh,IIIasstDDDfue,1Dtafcetaitv66iDvD.rDAlpt.reelteoee,4oAAeeYAonso1s,fca,YY:Y,ca7op.Ap.6t::aA:2,dadrreA6200e9A,nlnelin35sinsldst07,9lds,,iteitetwtnra62h2rn1hdedie,6igigso7bswo9wt,tteehhu,3lohulssri1ri0emgmeemg0aat,thns,hdos5doibi1hht4dtd1hheaheoho,,eeudsdiwiwiddss-s-,,
shaBaedsaBaediineiieaontoTm1tlTCefaotf“ohh“e0idshmnhheidsowItnwaemIenw:tmeeerw3okoartgpwwnrtgwn0.nOuea.kaotadiaurdyaninolyearplcnmentewaotnentue.soknamodtcnodiercuenbniunurnoebfit.ieteegntoepnansaNaenrsrNennnsgnisnLagdhfttdttteeutoe,odele,aaaeaerdmtrrdrgwdsasigwdgtkdesgkateioaeboodyieotyentaronxenoe,ioeyw,OveooOttraycadyceaatsdtsnsidae’rlnie’rltnr-nal-oiadlowhaenldilll’nlmne’lbomelnoeaetelttelealgdisogaaeoamnoddhodhtusktwnoklwntvneuveihieuhninie.sieeensirnetgreuttos,st,hp.tghpg”-”.,.,
y
tended the com/lottery and in later
eanddlinede tohe editions of our newspaper.
oadt rlienleatosing
rtsreinletaimsiengto
rosnindetiamdelinteo.
ovnaidlaebaldeline.
tatialawbalesun.

HOME DELIVERY/CUSTOMER SERVICE 613.739.7200 or 1.800.267.4669stlalpaatwateeparresru.n.

snpoaffpiceiar.l.

HOME DELIVERY/CUe-SmTaOilM: [email protected]/3eC9d.Ui7aS2.c0TaO0MoErR1.S8E0R0V.2I6C7E.4661639.739.7200 or 1.800.267.46694o6fftiociavel.rify.

29 2016 Media Markeet-minagil: Rweebpseorrvtic│[email protected]:[email protected]
hottest, dustiest and mostband Korpiklaani included acolourful edition of amnesia dreadlocked screamer of a
dreadlocked screamer of a
A noble effort, to be sure, Where: NAC Back Stage Where: NAC Back Stagecolourful edition ofamnesia front man, a bearded bassist Rockfest. front man, a bearded bassist
Rockfest.in a kilt, a punk accordionistThe three days of ear- in a kilt, a punk accordionist
and a blond fiddler who was splitting rock wrapped up and a blond fiddler who was aShlEy FraSEr
but it’s his crowd-pleasing live Buffy Saint-MarieThe three days of ear-
splitting rock wrapped up
in the wee hours of Sunday

show that forms the root of his WBhueffny: S8:a3i0ntp-M.ma.rie Buffy Saint-Mariemorning with organizers
declared another sellout,

success. With his band, Orle- WWhheerne: 8M:a3i0npS.tma.ge When: 8:30 p.m.the fourth in a row.Close
to 200,000 people are

ans Avenue, Andrews’s stage CoWnhfeedre:raMtiaoin PSatarkge Where: Main Stageestimated to have made the
trek to the parking lot of the
municipal marina in the

experience was evident in Confederation Park Confederation ParkWest Quebec village.
“It’s the best year so far in

the natural showmanship he DSehvairlo’sn JToanleesfaenadttuheriDnagp-Kings Sharon Jones and the Dap-Kingstermsofeverythingrunning
smoothly,” said Martel in an

TbroromubgohntetoShthoertsyt&agOer,laenandshAisvenue perform at Confederation Park during the Ottawa Jazz AgdDarveieavfnialn’RssaeTsxaaolcet&lyfeFwahtnautftrahirneeygwanted gave faDnseevxial’cstlyTawlheatfethaetyuwrainntgedinterviewonSaturday.“We
really have our formula.”

FuenstfaivilailnigncOotntfaiwdean, yceesatseradbaayn. - CAidorciaarnliaRaso & Fanfare Adrian Raso & FanfareForthemostpart,things
were peaceful. With a lineup
dleader. CWiohceanr:li1a0:30 p.m. Ciocarliathat appealed to men in
their late 20s and early

AnRdirgehwt soudteocflatrheedgateo, nheis E a r l i e r i n t h e e ve n i ng, for it at every gig and never get WWhheerne: 1T0ar:3ta0npH.mom. es30s,divingintothemosh
When: 10:30 p.m.pit was an effective way to

relive a misspent youth.

Apnonaidmnrte, swaalskthedoeiuncgslhtarrtuehmdereaentwtowenraes bAunEshdayrleCiwearnsaiddneiactnhlaetroeeudvbeantdioonungr,e ifto,”rEhiteaarstlaeiiveder,rtyihngaigntkhainendgentveheveenjraignzezgt, fSotrWaitghaeetreev:eTrayrtgaignaHnodmneesver get Where: Tartan Homesarubberdinghy,adude
one of the few women on ShianrtohneJwoeneehsoaunrds oTfhSeuDnadpay-Kingsonpelaoyf tohnetfehwe wComnfeendoenration ParkSmhairnonstJaogneeyseasntedrTdhaey aDsap-aKrtinogfsTpDlaOytotanwtaheJaCzoznFfeesdteivratl.ion Park main stage yesterday as part of TD Ottawa J
stage playing an instrument morning with organizers stage playing an instrument
during the entire weekend. declared another sellout, during the entire weekend.
They supplied an entertaining the fourth in a row. Close They supplied an entertaining
blast of anthemic metal with to 200,000 people are blast of anthemic metal with
elements of ska and a dab of estimated to have made the elements of ska and a dab of
polka, a refreshing counter trek to the parking lot of the polka, a refreshing counter
to the likes of Corrosion of municipal marina in the to the likes of Corrosion of
Conformity,anthrax and TONY CALDWELLWest Quebec village. Conformity,anthrax and
Sodom. “It’satEhdeabNehstElymeaErrso far in Sodom. aEdaN hElmEr If any pro
also memorable TONY CALDWELLterms of everything running also memorable If any proof was required, it was provid
were the groovy Jane’s was provided with Jones and her band st
addiction show on Friday, sOmttoaowtahlfye,”sstiaviadlMfaanrstegloint tahneir were the groovy Jane’s TONY CALDWELLOttawa festival fans got their her band striking up a spot-on rendition
funinkteornvieinw aonbSigatwuradyaSy.u“nWdeay, addiction show on Friday, rendition of the classic soul
wirtehaallyfuhlalv-tehoruorttfloermsouulal.”revue the fun ‘n’ furious romp funk on in a big way Sunday,
the fun ‘n’ furious romp with a full-throttle soul revue torch song Every Beat of My torch song
by L.a. veterans noFX, a courFteosrythoef mShoasrtopnarJto, tnheinsgasnd baysLJ.oan. veestesrtarnusttneodFoXn, astage in cionutorteashyiopf-SshakroingJofrneenszaynodn aHs eJoarnte, ws sitthruJottneedsocnhasntangeelliinng into a hip-shaking frenzy on Heart, with
triumphant comeback by thweeDreappe-aKcienfugls.,Wwithoa lcinloeusped tsripuamrpkhlianngt pcoumrpelbeascekqbuyin out- tLhoenDgaTpim-Ke,inWgrso,nwghToimcel,ofsloewd- sGpalarkdlyinsgKpnuirgphlte, sdeeqsupiinteouhte-r Long Time, Wrong Time, flow- Gladys Kn
Canada’s Sum 41, whose outthtahteafpepsetiavlaeld’stfoirmstewn einekend Cfiatnwaditah’spSinumk t4a1s,swelhsoisneperpet- oiuntgtihnetofeasntiveaxlt’senfidrsetdwjaemekewnidth fitnwitiitahl phienskitastsioenls ionvperertpaectk-- ing into an extended jam with initial hes
singer deryk Whibley looked witthhesirolmate 2h0ostasnoduel atorlymatch suinaglemr doetrioyknW, hheibrlehyelaodokceldean- wJoitnhessofmreeeshtoytlisnogu,latnodmcahtacnh- ulainl gmtohteiotunn, eh:e“rThheiasdiscalesaonn-g Jones freestyling, and chan- ling the tu
(and sounded) in good the30wse,adtihvienrg. into the mosh (sahnadvseonun(tdheed6) 0in-ygeoaord-old Jones thnelwlienagther. idol James Brown sIhawvaennn(athdeo6,0b-yuetamr-oyldvoJoicneesis nelling her idol James Brown I wanna d
shape after nearly drinking pAint ywoanseanwehfofercetcivaellwsathyetoleg- shhaspebaefetenr bneaattrliyndgricnakinncger, as onAnthyeoinnetrwohs oforreecaacllhsmtheemlebge-r hcarsacbkeinegn.”battling cancer, as on the intros for each member cracking.”
himself to death a couple of enrdealivrye asomuils-sptiernritnygoushtho.ws at hsihmesealcfktonodwealtehdagecoduepalerloyfwith eonfdhaerrybsaonudl-.stirring shows at sheTahcekrneowwalesdngoedeveiadrelynwceithof of her band. There w
years ago, and an intense the sawreuabtbyerBdainbgyhloy,na cdluudbe all yseoamrseaignos,painrdinagnwinotrednss.e) theAsnwdeawtyhBilaebtyhloeny callurbeaadlly stohme eslinghspteisritnwgewakonrdess.)— vocal And while they already the slightes
thionsaefyuerrayrpsaangdoa wsuoitu, lidt have wor“kWouhtebny BI iglleytTaalelnittt,lwehuonder
befeirnecwraeclkle-rasdavnidseadlatrgoebring dtehdeicwateadtahseorn, gantodthtehese last
thseeicrtdioannocf imnegtaslhfeonecsintgo the TfreawgicmalolynHthips’sitG’sobrdedenowkniicek. ing
Cownefreedseormateioonf tPhearmkolraewn, as my but—t, PbousttmyoeudiaknNoetwwowrkhat?
the Dap-Kings started heating I’m gonna do my show and
up the stage — and the crowd I’m gonna overcome this.
— long before the latter-day Every time I get on this stage
Queen of Funk took centre and this mic gets in my hand,
stage. and I look out at this audi-
in a furry panda suit, lit

BbpueonsihnCyta,Cpalaalntnhapodruiagcnhtitcrtaohluelybreraadwisoeudrre fiebt,s”utihsvheaylsfaCoiradin,tsathdgaeiannkeritnorsogiutyhb.eadjaozuzr itS,”thageesaid, thanking the jazz Stagefirecrackersandalarge
section of metal fencing

sitsBtnstshhttoeoiaatedenogugtehrereltCoohetannraooneiMeepffdsxxlsaoooatthrtffnnttidhopottgirhphscohcGreeiuifoatrtfygcfaypoeehtsmhhsbis.ctartaeiaoilllfvvallloc.la.askyrHHltel’’‘rsyesnehaet’itdedaeserurgeuonn’godslgttlt, bdfdBstearhrtsAeusAautesnigcmcmvirecsCcaomtomlnoaofmfemperofeoxrlrrpoaptmiJfanJttaoastnnHpmhmgicireeaieiaitnldedecfyieeftKahbiKsrbcoxtayryrai,oslvollOialnO.tanynyHtliti.’trcdstceakakhitwd,wse,ieuaansaadgt fderWWMsAWMutiyhhcmvyhseecasetnrmlotnee:efmr:oe1ry1M0ryrp0Ci:eCJt3a:o3asr0oncn0mgnuicpeecprie.nydeme.rmertL.Krbt.ooyrusoinOtnygti.etcakw, aa WMyhsetne:r1y0C:3o0ncpe.mrt.weresomeofthemore
psfirodoienttr,iapansldtthcroeounugtgrhhe,trhoacebkroe‘nmw’ rbeoarlsle,- workout by Billy Talent, who thaovseeayweaerlls-eaagronewdoruelpduthaativoen or“WothenrwIisgeet—a alisttJloenuensdaenrd have a well-earned reputation or otherwi
stioidcueflotarnicpdeshtthhipartohouopgpehbnreofdockrteh‘neh’esrhgooollwt, dedicated a song to the baesepnewrhealpl-satdhveismedosttofibericnegly therwbaenadthkeerp,tafenedt mthoevsineglanstd as perhaps the most fiercely her band ke
stwouitthlhaeanMdbalharisdpti.hGorpasb. efore he got Tragically Hip’s Gord downie. tdhevirotdeadn—cianngdschoonevsintcointgh—e febwodmieosngtrhosoivt’isnbg etehnrokuigckhinthge devoted — and convincing — bodies gro
to tIFhnreotMrmuaetrhdjeairzGez,r-Aaisnm.dprerowvs astdydled, Croetnrfoedsoeural trieovnuPeagrokinlagw, int,waass msoyublufuttl, Sbhuet yAoiun’ktnaoCwhwilhdaNt?o retro soul revue going, it was soulful Sh
— Postmedia Network thcleeDarape-aKcihnginsdstiavritdeudahl epaltainyegr IM’morgeo,nthnea sdwoammypyshHoewSaniddI clear each individual player More, the
uhpatdhheistsahgaer—e oafncdhothpes.crowd IC’mang, aonndnGa eotvUeprcanodmGeetthOius.t, had his share of chops. Can, and G
— l“oInlogvbeemfoyrebathned!laTthteyr-hdaavye Epvlearyyedti“mneiceI gaentdosnlotwh”istosatallgoew played “nic
Qmuyeebnacokf,Faunndktthoeoyk’vceebnetreen aJnodneths itsomleitclogoestes in tmhey shtaynledo,f “I love my band! They have Jones to let
sbtaeghei.nd me,” she said, breath- aanndotIhleorohkeroou, TtiantatThuirsnaeur.di- my back, and they’ve been another her
behind me,” she said, breath-
The crack eight-piece band

pbianarsttosnitsehtr,efrssoionmnggeHsr-afprloiafmanxil,satasnTt ayderhyanris’s baWsshisetrefr:oMmerHcuarlyifaLxo,uanngde his Where: Mercury Lounge— who cut their teeth back-
ing Lee Fields before break-
ing out with Amy Winehouse

Kpeaxwrctaenjlealer,,ntshtineaglsbemur-amprit,alBynidrsdtresTsaWsreyidtnh partner, singer-pianist Tarynon her first U.S. tour — deliv-
ered on an early promise to

CKBarpwoklaaejan, Wtwhiaensgssmi,nparftoilnjyeecdtfrioensrgsmehd,is KTahwearjae, wthaessnmoaratrlgyudmreesnsetd“keep it funky” with a med-
ley of classic soul tunes, wel-

aCdltaehpeoplua, gbnhoworemadsi-nfiagncveofdincfereoinmfotorthmthe,e frCoTamphtlehareneawttaens tnivnoe faiurngdeuiemfnocerenm.t, There was no argumentcomingbackupsingersSaun-
htheIeanlrstorluueerogjfeadlzezha-idismmsipnursgoiecvriastntoyslhteoi,s einxtcoIentlhlteernusteoanjlagbzsuzfmr-oi,mmBpilradostsvyWsetaiytrlh’es, ence, you-all inspire me to leTsshley,cbreafcokreeidgehbtu-ptiinegcea baranndd encJeo,nyeosus-aaildl itnhsaptirseonmgehtaos lessly, before debuting a brand Jones sa
hslteiesaptlsuoopf ,udwrughteeidethsh.eisrAmfloturhsaoicsuigzazhnlsinhtogis BehxreockeaelslneonWutriganelgbdsu,hmpisr,omBjeuicrsdtiicsniaWgnhistithso keep going,” she declared as —newwhtounceuct atlhleedirTtheeestehTbeaacrsk.- kteaekpengoninagn,”eswhemdeeacnlianrgesdinacse new tune called These Tears. taken on a n
sertlaeenpcgtuerpica, swgahueivttoahcrearsloifsoltoriasoslrimznzailtisnetdgy, dBserteopke,unbpoW,owmihniegntshg, epvrroofiocjerecaitnsintiozgztlhhiniesg the crowd roared. ingSLtreaenFgieerldtos MbeyfoHreapbprienaeks-s the rcrdoiwagdnroasrise,db. ut for Jones her diagno
eshalexcmotpraihkceogsnuueiptwafroorsrioktolwouitoh.rMennautshtiuy-- sdeterlaetpco,tsrbpiochoegmruei.tnagrvsooilcoe oinrtonathstey infoglolouwt wedit,hwAimthy Wbrianseshobulaser- mSuhseichieslhdenrobtehsint mg beadcickinaes : Stranger to My Happiness music is h
She held nothing back as oinngheorvfeirrstaUt.hS.utmoupri—ngdbelaivs-s, th“Iehbaavnedclaunncechr,ecdainnctoerIfdYoonu’t followed, with brass blar- “I have can
the band launched into If You ebreudt eoanchansoenarglywparsosmimispelytoa Chaalvl,efmroem. I’2m01s0h’souI tLinega,rCnaend- ing over a thumping bass, have me. I
Call, from 2010’s I Learned “lkaeuenpchitpfuadnkfoyr” Jwonitehsaanmdehde-r thcer,Hyaorud gWoat yto, agnedt uhperapnidpgeest but each song was simply a cer, you go
the Hard Way, and her pipes lepyriomf ecltaismsiec psolauyletrusnteos,shwoewl-- woeurt!e” as powerful as ever launch pad for Jones and her out!”
were as powerful as ever ccoamseintghbeairckpurpowsiensgserosvSearutnh-e on TRheetreTaDt!,OtthteawleaadJaozfzf sFiens-- prime time players to show-
on Retreat!, the leadoff sin- dDraapW-Kililniagms rsealenndtleSstsargrroDouvne.- gtlievaflrsoemrvetshuepbaannodth’ser2s0l1a4te case their prowess over the The TD
scsaiiaaxnsomspohanonnbdeaesnwse,orgrgukyio,taaulrto,. ndMgruuwmsiits-h canTLhoewbeantodtmakieghvot chaalvdeubteieesn Gorfaemclmecyt-incoomffienraintegds GMiovendthaey, Dap-Kings relentless groove. tival serve
caainafdneswaodpneabciaersnost,fdgsuaanixtcaoerp, mhdroounvmeess. wghr ioleo mJoendesipnret phaeresdt ufdori ohebry PweoitphleTWrohmatbTohneeySWhaonrt.y, Ben The band might have been of eclectic
ahBneeldipneagdpyhoaiuimrnogp,frgesoaaocxdho-ptlhhoeoknBienigsg gMraanrdkenRtorannscoen. (of Uptown CSahpeladnid, DpraencisBerluy basecpkroamn-d with Trom
hEaeansldpyegtdaolshepniemtl,eepdnrdedoainceghsnwt’hittehhBtuhiregt, Fu“nSkhfea’ms en),obustttrhaisnwg easr vtino- isCeodlin aStpeotswoenr.house perform- groomed in the studio by Caplan, D
Otattgaewad,onwonr itsoswhne tfouannky, dtuorwn-n ance, ramping up the energy Mark Ronson (of Uptown Colin Stetso
tabnlde idniarntyy,daanndceufnlodoerniniathbely on [email protected] Funk fame), but this was vin-
waourtlhde,”nctaicm. e her introduction, verse antwdittwer.hcoimp/phienlmgerhaerself tage downtown funk, down ahelme
and dirty, and undeniably twitte
authentic.
sstraFaxtroepssphhhoefnrreo. wmoarkowuete. kMeunsdi- haselttarhat.otousgphherered.-faced from the Ifnarolatmhdodtuihtgieohanrtetteodn-ttfhiavacetedbaurfedraoikem-nuctphe.e from the attentive audience.WayNECuddiNgtoN
gciigFaanrtestsohhne Pfbreaorstmsh, gKauiliwttaReru,ednkr,eutnhmeds he“aFItt.r’se sahref raol mscoarcwheeer,k” ehned tIuhnneeaa,dtD.driitfitoAnptaortt,hhaigt hblrieghakts-uofp In addition to that break-upPunk rock fans get into the spirit as the annualAmnesia

Rockfest invaded the village of Montebello in Quebec,

nwgwhaiaiignelltddeldapldltyyeatbbbdhepeeethaaawPririmdedereereotdndphfrCaCKescaaaioplpcxtullhoaRaspntnutihhcnaaeol,gltttuneeBhrirei--e-gs rfreegweemim“igllIldaaaitkrl’rtyskektebehtadhdeeirasbePbrehadeeturltewwtmdsheeciCeKdeonaniirtlpcystslhoRcaonaenulgrnlg,ass”s,l.f.ttho“eh“rIerIe- atathruteetenemW“rerrI,raiotifD’rrfisickmrcieasf,sdteIerAtGtebipinaeonaclttcrwlMstul,uecdehdeoeianegrdcdhWsBhloBioegenmelhrllg,ylt”ayssno.hoof,“ffeI tautneer,riDfircifsteAtpinacrtl,uhdiegdhlBigehlltys ooffabout an hour away from Ottawa and Montreal.
dra Williams and Starr Dun- gle from the band’s 2014
can Lowe to take vocal duties Grammy-nominated Give the
while Jones prepared for her PeSohpeledWidhpaWtreaTychNieEsyeCulWyddaaiNnsgtpt.orNom-
grand entrance.
P“uSnhkero’scknfoans tgreatningtoe rthteospiriisteadsinthaepaonwneurahloAumsenpeseiraform-
OtRtoawckaf,ensotrinisvashdeedtothaenyvitlulargne- of aMnocnet,erbaemllopiinngQuupebthece,energy
taabbleouint aannyhdoaunrcaewfaloyofrroinmthOettawoanasntdagMeonwtirtehale.very passing
world,” came her introduction, verse and whipping herself

Ereoaitushyseignr.ogspsterla,iennsdoinf gWwhietnh tthhee tnEaara,tsebydagnbojeost,pwaeenl,eden,ntaodcihoniugssdwteiicltihgghuthti,-e afneheaeltelaidrkte-bwtehrtiewsnheceuhnminaidgciotbyurscetaailkcls-gufuopir- atanfahnedehedWlUeUlainoknrrdetdm-eetwrh,r—CIriCseoGPonhononsucttttrhmrmMooileni.led.dgaiiatbyWNrceeoatamwllkosa-rfunkop,r the Worm, I Got Me a Woman,
rSoaui“nsItisnwGgaosntMnraaairntcahskionefgyWIn’ah.lel ndetheep atraSor,tuebsianinwgjaoys, tagrnraadinn,dstopohifaiWns odh.ee“lInigahtshkt,e satoahnreg, .ba”ratn-wjor,eanncdh, itnoghbisredaekli-guhpt, and Under Control.
SdaoinwtsnGot oMaNrcehwingOInr l. e a n s ,” aSSatienitnswGaoyMgraarncdhipnigaInno.. “I ask saonStge.”inway grand piano. “I ask song.” — Postmedia Network — Postmedia Network
Tweet the Find the Ottawa Sun
@ottaOwOtatTttsawauwwenaeactSoStumuhnne ottawasFuinn.dcothmoeo/nOnfFatFatcaacecwebebOaobotTSotowuakokwenkeatStuhne
Numbers are unofficial. Find the Ottawa Sun
• GENCERaAllL1I-N8Q6U6I-R8IE9S1-68139.84269.t9o10v0e•rifCyL.ASSIFIEDADVERTISING 1.888.786.7821 • RETAILADVERTISING 613.739.7100•PHOTOREPRINTS1.877.624.1463(tollfree) on Facebook

5 PM DID WE [email protected]? Iaf wseumnicsos omne of yooutrtpaawpearss,uwne’.lcl goemt [email protected]/oufoaatctcaoepwbyoathosakut ncom ottawasun.com/facebook
dDayIDifWyoEuMcIaSlSl uYsObUy?10If aw.emm. wiseseokdnaeyosfoyro1u1rap.amp.ewrse,DewIkDee’nWlldgEseaMttyI6So1Su3Ya-7Oc3Uo9p?-7yI2ft0wh0aetmiss one of your papers, we’ll get you a copy that
Y-FRIDAY 9AM-5PM • GBEUNSEINRAESLSINHQOUUIRISESM6O1N3.D8A2Y9-.F9R1I0D0AY•9CLAAMS-S5IFPIMED•AGDEVNEERRTAILSINGQU1.I8R8I8E.S78661.37.8219•.91R0E0TA•ICLLAADSVSEIRFTIEISDINADGV6E1R3.T7I3S9I.N71G001.8•8P8H.7O8T6O.78R2E1P•RRINETTSAI1L.8A7D7.V62E4R.T14IS6I3N(Gtol6lf1r3ee.7)39.7d1a0y0if•yPoHuOcTaOll RusEPbRyI1N0TSa.1m.8.7w7.e6e2k4d.1a4y6s3o(rto1ll1fraee.m) . wdeaeykeifnydosuacta6ll1u3s-7b3y91-702a0.0m. weekdays or 11 a.m. weekends at 613-739-7200


YOUNew play M O N D AY, F E B R UA RY 1, 2 0 1 6 ‘THE RIGHT THING’
THING’
YOU lays down $400K raised for
the lawO T T A W A C I T I Z E N $400K raised for Indian village D4

Indian village D4 SECTION D

O T TAWA C I T I Z E N M O N D AY, F E B R UA RY 1, 2 0 1 6 SECTION D

New playPATRICK LANGSTON

New play The law — arcane, precedent-lov-

lays downing,sometimesoverwhelmingina

lays down Kafkaesque way — has a fun side?

the lawYoubet,accordingtoIanStauffer.

the law The veteran Ottawa litigation
lawyer and small claims court dep-
PutAyTjuRdIgCeKprLeAmNieGreSsThOisNlatest play,
PATRICK LANGSTON A New Paradise, at Ottawa Little

Tinhge, sloamw e—tiamrecasnoev,eprwrehceeldmeinntg-Titlnihonhgveae-, aOslotatrmwtea,e—wFtieaambrM.ec3asi-sno6sev.i,eoAprnfwr,uehtnchedeeldrmaceiionsnmteg-rleiofndovyar-
Kafkaesque way — has a fun siKsdtea?frksaaerseqauelawwayye—rs,hjausdagefus,npsoidliec?e

Youbet,accordingtoIanStauofffeYfiroc. eurbseatn,adccoothrdeirnsgwtohoIasneSdtaayujfofebrs.

GORY VICTORIANSThe veteran Ottawa litigaitnioTvnohlevevtehterlawn.Ottawa litigation

Jane Austen gets the zombie treatment D3ulTAathwNyeyjeauewtdrrgeaPe,naFpdrerasbemd.mi3asi-ele6l,rc.aelAatsifhOmuitnsstdlacarwotaueaisrstLtepdluAomriatleffttawSopaNylyPer-en,yjeaut,ewrdrtianhgaPdeentiahpds2rereas3,emd-fmMicicashitoeleali,rorcrgaelnaaatscainhOtmleialtsrsetnlacgpadwoaltauleBaysrortLtffifpdigintlcehtadepltyess--,

the Ottawa Mission, the comaTenhdyeavtirlele, Fadebe.r3p-l6o.tAtifnugntdoracirseeartfeoar
stars area lawyers, judges, pontlhieceweOmttaaswtear Mraicsesioonn,Etahrethc.oPmitetdedy
oionffSfviPoecatelvrrieasndtathinhsedeel,oafMtiwch.toeirrogsnawanlhaloensgedadlBaoryfifosaisgjinoctcghfabfeivabtiessr-ociunsnelmvtsraietssrbtteal,hhianwneedlgiaeltobahvwtwailhylro.-eervdirresoss,te,wserjorushsladaoarrgsnefeedasadra,macpcyolsouejalovpinbceldesr
man, the 23-character play fainlcdSoseht oinl gtehtetinfigctiinononaltlheegacl toioffnic.es
dry,” Stauffer

Y O U $400K raised for“Butjudges

ple who bring
an evil leader plotting to creaotfe“PaTahreahduisme,aMn soirdgeaonf athnedlaBwriigshnt’-t
new master race on Earth. Piomttfeatdenn, tdhiesp2l3ay-cehdawrahcetnerppeloapylefinedns-

‘THE RIGHToaascglfciabeoiunnhmtsoitslbttgl,hiewnetgitetibhnvaigllro-irvdniesoo,tesenrorstslahaarrenefadaacramtcicoolsanadcuenavognpre.n“eayluwdeBre,i”nnvumtSistelttjaralutseuhtdtahfeegdfreeeersvlraaiasplcwan-leydd.osooItl.taeniwransElygwaaertraroetsyhacas.rrcsPeeoeaipuetttepmeeoldaes-
THING’often displayed when peoplesaecnnide-nmtiesnt,twalitahnldohveis,tsorlaicraflabrmagsgaangde
“The human side of the law opisflneb’twumhobblirnignbgathrreiisrtoerwsnanemd aoctiloevnearl

counter the law. It always setaeolmctoshheopligcettutrine.g in on the action.
atshanyedsirl.aowwyneresmaoretipeooennf“otatTIe-l snhwieddaehinsultpaemlwdaaytneodrsssidwhheohawoevfnet,hpteeholaiarptwrlteehivseennrr’e--t Joel Miller on sax, left, and Fraser Hollins on bass, seen at the 2012 Ottawa Jazz Festival, are part of a quartet set
to play the TD Ottawa Winter Jazz Festival that also includes John Cowherd and Brian Blade.  JEAN LEVAC/FILES FRASER HOLLINS
Y O UOTTAWA CITIZEN Indian village D4and mental and historical baggicsaoguseonmteer ftuhne lianwla. wIt palrwacatyiscesseeamnds
stroeonobonesgin lNaeyws dpolawyn DREADOttMawRa-raETisedEAFraAsMerMHollinTs haEs assAemblMedDecemberstart QUARTET
Featuring Joel Miller, Jon
for $110M project Cowherd and Brian Blade
D
the law Ottawa-raised FraaseurpHeorlsltinasrhjaazszasqsueamrbtleetd, Peter Hum writes.RenovationoftheNationalArts When: Friday, Feb. 5, 9 p.m.
NdpetOiOsonVelA“aETsattMIyholNBsiTwaEmeniRendAapgw2eden4iwSA,WcPftlt2wTtuhaiea0utUa1wnedrAh5rrFadfyeit(Fidsnne.ocirCRrlsaoilsseEllealhIiAiinhwnnTsoLtafsSwsLopvIttY)raeZra.tr”la,DuihmvEctOfeehftetEeNiiainncrSrtge’trsHtdseithnrtdpPaaAhvaaoenPcehrelimanMA““ArearPrytiadrtaddeBIs-yo,Ehw alN”OlDmiNurwadoenh2S,etnNinJteapgtowsohjodangnueiDwebpecuPtttldtlsrithaiaAefMamdgeuitfylednrheierYerlataeligfrsehbedYTnt(eid,eerhn.atsOoccusdfiehiaonlTUosa.FntkisnyhDeeNiildemetdhEsiesiGindsOrllns.asoymaaBttMtxorsSOwthwsoe,atwIKut)NRlSiraweya .EsntD”inDflCaueUchtmTS3if,IWreaftOeiafAsyNmrleiennDisbandrRtrtotra’hetrsFetYrgsreieitanJgpohhvasaaeneohtei1zgrrorzrawi,dees--HFleo2sllt0iiJnvosa1elo6tlnhMabtailsalsels,rosoeinencnlsuaadtxet,hsleJeo2fht0,n1a2CnOodwtthFaerwaradsJeaanrzdzHBFoerlislaitnnivsBallo,aandreeb.  apJasErstA, of a quartet set FRASER HOLLINS S E C T I O N Where: NAC Fourth Stage
QUARTET set Tickets: $32
T U E S D AY, N L E VAC/ F I L E S Featuring Joel Miller, Jon

NAC’s Paradise series. seen at the 2012 OttawCaoJwahzezrdFeasntdivBarila, narBelapdaert of a quartet
eLnotstsidnePlaarwadyiesresahsatvhee, t2h0a0t9thperroe- to play the TD Ottawa Winter Jazz Festival that also includes John CowherWdhaennd: FBridriaayn, FBebl.a5d,e9.p .mJE. AN LEVAC/FILES
A longtime community theidastursceotimoneoffutnheinanlanwuaplrLaacwtiyceersPalnayd, Where: NAC Fourth Stage FRASER HOLLINS
aLdacuoftucsottnriiod,nnrhaPoeiafsdrteaherdebfiuaosnterenatduhsaehtlhiGLsearf2ewir0ayst0et9CrsPadpadmphnlroeilafAaaouawayu--yn,nlNniainTdetngywhrdawecPtiaahsiatteuerhrasef(idefncCosilsaorietlemhtiinnhsaptsSetsatt)SaGna.”ltuymrafeaufeaenfntrfde’tsCrictnahohnhimaraidds-- Tickets: $32
dian Theatre Company and cPcooma-r-faoduisnedseedriseesv. eral years earlier. QUARTET
munity causes that StaufferHhaiAsdsloencogntidmsehocowm, SmtiullnLiotyokthinegatforer T D O T TAWA Featuring Joel Miller, Jon
co-founded several years earaPlicaetrro.ard,isheewdheibcuhtheedphriosdfuircsetdshhiomw- WINTER JAZZ
F E S T I VA L TCoDwheOrdTanTdABWrianABlade
Centre will begin in December. WINTER JAZZ
The start of work is earlier than FWhEenS: FTridIaVy,AFeLb. 5, 9 p.m.

originally proposed to ensure that Where: NAC Fourth Stage
ATilcl kceotnsc:e$r3ts2 unless noted
a superstar jazz quartet, Peter Hum writes.the completion of a new Elgin

Street atrium entrance by July 1,

DREAM TEAM2017.WorkontheNAC’smainban-

quet space, the Panorama Room,
will be finished by January 2018.

The $110-million project will
see improvements to performance
spaces, public areas for education
and events, full accessibility for
people with mobility challenges,
and a sparkling glass shell that will
encompass the side of the NAC fac-

Ottawa-raised Fraser Hollins has assembledingElginStreetandtheNational

War Memorial.
The project is designed by the ar-

chitectural firm Diamond Schmitt.
The builder is PCL Constructors

Inc. The NAC will stay open for

a superstar jazz quartet, Peter Hum writes.businessduringtherenovations.
“The decision to stay open wasn’t
an easy one,” said Peter Herrndorf,
CEO of the National Arts Centre,
in a media release. “We were very
aware that the work involved for a
PPHseaAilrsfaTsadetRicsOoIenLCwdTKhsiihncLoh2wAh0,Ne1S3ptG,irlrloSaLdiTsoueOocdekNdiannhLdstgireeufmoaoxlcsfor--ttraiidotninOnPoaLafrTrtyahi$den5ias02ne,00na10us30a,tlhfrLoaerais2tweh0yde0eUa9rnPnplieraooxyn-, All concerts unless noted are in the NAC Fourth Stage
traordinary $50,000 for the UnaMiofiunssnidorna.iHseer hfoorpethsetoGmreaattcCh atnha-t are in the NAC Fourth Stage
TMhisesiloanw. H—e ahrocpaens eto, pmraetccehddtheianistnt-tTliomYhvoe-uaoctourutel.dCloomkpataintythaisnwdacyo: m- You could look at it this way: easy,” Hollins says of Cowherd. from Wayne Shorter to Chick Thursday
tinhigs,tsimome oeutti.mes overwhelmWiunnghiitFnlyeractsaheureHspeolslolitnshsahistajvSuesttaeguvefotftelivnreghda, da Feraasys,e”rHHololilnlsinsasyissojfuCsotwgheettridn. g from W“Hayen’se aShgorretaert tloisCtehnicekr. When ThursCdaoyrea to Joshua Redman to
lKltpaahlwSWaawTYeyufaofhyhskictru.eiahremlereeba,vsaeitsqehnastae,cteudattecepttcsorihlcmnwraoeodgtnacasriemnydlhOnlgi—aactntkvrlttgeaeeohaitsoeamwofSvfsaoItoaslaaarllcvuntlfgeohicHPstplfuoStadfheurolaeniowitS,ealger-rsradaefyuft,saaufsoasidcdttedfr.utihrefirsatcmoeesneoOopono?nreTagom,d-dn.iLeamsweaasetdlTkhademchltsoetuaticiahsrnntbtncoteihtgooehenrh2vtusew,idig.ehh0mtsc,iriae1FemSnsean3rnrptgbli,uaoidtrulyronkrlaodtaemdyeLoddiaesowsymourrefSsotiscfatotdaotekhtaeleaprdtilaha’nelustnaigrh-hgfsfylorifioreifmeeoeeloxdrnrder--.,d t“oHgee’sthaegrretahtilsisFterniedra. yWwheitnh his oldCoreaytoouJ’orsehiuna aRecdomnavnertosation with ■ PetrKCeanncnuryaGwiathrrLyentnt. ■TPDetrOCaTncTurAa wWithALynn
uwthyojsuhdougledpkrneomw:iHeree’ssahpiasrtlnatwetrrehaasottrpsdhlmaionyeu,anlrtdy. Pk$en5no0cwi,0l :i0nH0tehf’esonaratpmhaeerstUnonef itrohaent srahyfHooneoieeommdu’lsm’,rtaejhheumltaeisount’tsanwntaathgehecgetsoe,rri.nehnmeav.iytsHeeolrruiebsso’astupeotjldinuamodyesntrymw,wvaiteaitnotrhthdyephy’lisomafuyr. ienKinde““gnBV, gnreeiyrhHfanyeGnieeeimanri’lssrot,trauhjhheusretaeetssm.t’aotsluwotlaylhm,h”gbeeerHernneaeotua.,lyttlvHiioenfluuierssyl’ss,tp,agejlyinuavsy-es. trw,vaietnrhdyhyiomFM■ur.iiTldehase,yi7Cn:h3““go0BV,cpgore.leimraanty.eneiHnriosottauhPsorecesmkaoelutolsyl,m,”beHenaotu,ltlviienfursyls,,agyivs-. MWileIs,N7:3T0Ep.mR. J A Z Z
prTeaselknta. bIto’sutht eansourtnodf eprlasytiantgeI- very pprerseesnetn. At.nIdta’sgtahine, lsiokertJoonf,playing I5 p.m.v(ferreye cpornecesretn) t. And again, like Jon, F E S T I VA L
mlikeenat.loPte. Tnhceirleins athloet onfalmisteesnionfgthealwaysliakbeoautlosetr.vTinhgetrheesmaulsoict.of listenin■gMikeaMlwuraleyysTaribo,o7upt.ms.erving the music.
project of this scale would mean a FabfrtYyHataooosoharonplogs“oaesuudkJielesmelhosarmitcecdennehpoelmr,aosbaieluorOHstcalaltrfliooesyttdozomotfntdeifehladntlqu,ltaoiiwiithuhsgnasnhoideiuliacwcFosksarme,-kgrthieisrra,ustui.aeoatitdhefshjimojiiayusugecHtmoeyoss-stuMtdittoowhmneggglbgqieolaiiesaivttuaomnntshtewisntecstshi.rhkoqa’,nisielasyimuygfsatn:,ar”lohdir-elatdneslSctihtrdof“etemHaipttee,eeta“yehtasrjishouHfmnaoippe“mmsesudaJceeityetc’ehso’a,ra,setc”tliheenihw.taelmHaeoiimiangonr’setsyotgirfssogsal.aeo”milhosftaicfgetndmtqouertbsimhelunsieaigsaieisvltshcacottoetm,tkyeglorthbins,rususpeeyiaeoteflstaaetjrfoiyugiyn.ncCoooWdsesnuotironhwg,wggqeaeihivtunnotesehidnrcth.dkoyi.olmy1A■■■u,0”RFJFCpralao.mmTsrqehKclSfC.sirru,erofeoeMoH.“eetsHmsnrHBomesaiotelirtnrtlroteceiaa,eneinWyutslas—j,itrsouGn1mQyoap0FmsuLyaoi:Jaetao3srnrcreous0ratraóeentesliepigtw.thPrSm.,temae9mtuhar.a.eptay,oyi.lsmsg,lrRyiht.steeebtdmrebmtmaieoguatshCtnotithfottburiopecly,kltaagoynivd- Friday
good deal of inconvenience to our ■AlTl hcoenCcheorctoslautneleHsostnPootcekdets,
patrons. On the other hand, we 5arpe.min. t(hfreeeNcAoCncFeorutr)th Stage
knew that our audience depends on ■ Mike Murley Trio, 7 p.m.
us to bring the best of the perform- ■ThFurarsedraHyollins Quartet, 9 p.m.
ing arts to the Nation’s Capital. In SstTAThEtihEeaNererPneasOAewtRaytrAtrSePaDet,IwaaaFSurEealfafabOedMw.Nri3LsDyi-seLe26s,Pr.iashoA,tenjfrOu,uettdinnhtgdateerowSMtlTsaawchEai,wiWoEeinispssmLr.ePfsohntiriAireltieomfiaybftmltRdocyoonesoalAlyseeersupS.kiteDeslstoHhrmadIaeapuySe,ebautlOtEtallpft.hiehytfzhltdOeeieooaneNrTawpttgchLDsDdeawearL-sh2OtneirtPaatattthhimtovrhsaeHeeew-emMdtooreaelbefaolavWiaatmninosncltislslnrhq,vitteastuoehaettnawdlrhrhdr-,eataneaest.t ■ PFleotrrqCuaensctruara—wFiothrrLóyPnanrty,
the end, and after careful consid- 1M0ilpe.sm, 7.,:3M0eprc.mur.y Lounge
eration, we’ve decided to remain ■ Jam session, 10:30 p.m.,
open during the 2015-2016 and AFrRidCaTyhe.Hotel
2016-17 artistic seasons.” officers and others whosepdlaysj.oJbazsz Festival.

Here are some of the impacts of

the construction. aton“dpHlaae’ylsowtnhogertkTiemdDeOxbttrutedamwdeyalytWhoapirndlataeytr ComfHpeoleeltlitinhngasHtcowolnlhinteisn’suyqeousua.rpteltay with him. tinhge,pgeernfercotuthsisnogu.”l,” Hollins says.
sJhoaimszzaerFtteaunsntdievhsai.sl.craft, so his skills is saxoHphe“Ho’snejius’stsJwtotoehrlekMreeidl.leHerx.eHt’rseejmusetlvyehrayrd aStaturdayC“Voemryplienttinhge Hmoolmlinesn’st,qvuearyr,tet ■ The Chocolate Hot Pockets,
I wanted toON PERFORMANCES
Construction will occur outside

I wanted toperformance hours on weekdays
involve the law. Such “aI’smehttaipnpgy amndakveersy feoxcritgeodo,”d
between midnight and 2 p.m. Eve-

show thening and weekend shows will go
Set in the fictional legathl eoafftirce,s according to Stauffer,aheadasplanned.Becauseofday-

time construction, some school

irreverent side show theof Paradise, Morgan andwBhroisghhotu-matinées, daytime performances

ld know: He’s a partner atand rehearsals will be cancelled

or moved within the NAC or to

man, the 23-character pTlaiyerfninedysStauffer LLP here in town.other venues across the city. The

Fourth Stage will be closed start-
ing in the spring of 2016 until July

ALlaLwyerTs hHaveA, T iJrrAeveZreZnt sidean evil leader plotting to create a2017,howevermanyoftheshows
says Hollins, 45. “I’m seizing theBrian Blade performing at the 2009 Ottawa International Jazz Festival in Confederation Park.  MIKE CARROCCETTO / OTTAWA CITIZEN FILES smfoahfaoaepbre“Tleyeepo’kIslnsaurs’osgmletHtlkrop.aistktPlolehauleaayrelban,liyvsntioprpii’nnsectnupiarysgaigtyill,.lttl”la4iywhawanne5ndbih.ettmoduehh“vurnueIveteH’lsdemtohnihrecopeay.erels’Ismlsdmeetiat.nixraeluAzelcstssian,ieinlotcdal-eg.yfn”dtd,h”emhjhaoezirrgzdnhs,mttbaplhhaaniaunrtreikonusete’detsrhsaarheaagenereaoondtilalvsfootaetlcBaltt.oanty.lIlhoma,deTstedfrap’pshheedidionetaiiraisnsthairlneetglecelrdryo.wCrnssCgdaaaohaoufnetrteiwvealot,rod-ensgeotiloaaofoholnihppfenilel’gsasidsysao.tiklnAenlin.nlglisdIn■■■5gpDJC.oaamhvr.onijmSaivdlasGeloWVwzisermigezargyalehsgxseylpmiltoteetsrasanipJemantoaohus,bunt7eeordronshnpeuRe.atimioyotts.vm.BfstAmeáaeBJnnntrioldhgdvae,heidalnteigMgnbaateinehnltldre,eonlrCmita.kroHtueyiwoseJa-inonca.ndl, S5apt.mur.d(afryee concert)
opportunity.” yoHJuoirisneeianxlgi-zHreoootllhminamstatanhtdeeCMioswoNhneetwrrdeYaol-rk His atabl“eoJnuottsnswiesornsvohiniqmguttihhceke,2mi0f1uy3soiuc.gIitvreehailmlyDíaz, 9hlipef.tmrid.t, bsoumt heetiims aesleiatdminigghCtabneatdoian ■ JMoihken MGeugogrsslgiep iyeTJro1i1ou,r7nepy.mB.and,
His ex-roommate is New York bpwaiahsneenidst,thOJeytotpnalwaCyaoa-wtrtahhiesreNdda,tbwioahnsosalihstahsasJuno Afaewpeailresdclfeiokorefbiemts’stucasolilncat,ebhmoe-ujut stht egemtsutsoic.■” Jamhcsroeesrsanitomen,sa1p0n:a3aYc0oneupr.de.smsce.no,tiamldapilyoneswes r. ■5 pF.rmas.er Hollins Quartet, 9 p.m.
■ CFlaorroqluWeestlsram—anF,o7rpró.mP.arty,
and community events presented S E E P AppRilAaaynDeiIsdStwEJoiOtnhNCRDoo2wsahnenrde,Cwahsoh,hIagsgy 10Dpa.mvid., VMireerlcleusryaLnoduRnogme ánTim Hortons, Burger King commit to serving only cage-free eggs at all locations by 2025. Business
here will be moved to other the new master race on Earth. PittPeodp, Cassandra Wilson and, most ■
Centre’s performance halls.
that there is lawyers have,ON LE CAFÉ 5paAslrastyesmeCdebnwlteridteh’saFRdooruesrathnmnS-tetaegCaeamwsihlql,ubIeagrgtyeptorarythjaJezozhirneeaicnrotgrdoHifnotghlfleoinrmsSwuanismidc, CsoowquhiecrkdlyA,”RC The.“HHHoisteetljaulsetnatlswwaoyns sheiesmmhtoshwteos2pw0l1ao3yrth seeing aD■títJahazm,e9wspei.smnst.ioenr,J1a0z:3z0Fep.smt.i,val
BriaagnaBinlasdtetohnetheevibli-ldl aoteFresbrauraeray jcaozzufpfealsmet,owursiltyesfoPrejtaezrzHluomve.rs, the
Due to the daytime disruption PfJtgTwnbaoraoaoh“mrozpnniIeuztd’l,oeemLapClFruoeoyeitahasuhshtdslsiearheysteseripicreaafnvtopoannToahn-yradwlafDd-.njoranrasaanuOBeziindWndslztaegftddvldeoaioeerlrwds/vdrharsoeyaiuoswmnrinmWesnisgax,tmge-hnticulnhefidl.dtarte,e/rermdur,m”otlwms-iotnhigdsiec-at1hhn9nHhAwead9iorrlho“s0MstniHoelsnsalei.nifrleCMenltoe’tasesortahtnhwunhcnetrteoaydorervrnerdepehatkt’HslbhliieasnseFoadyieculnnonlraeeicunaBtxepsrsf.lttlt.ttarahhH,hyedeesiomnSeoNlgt-heaaligtymseiohsswknaeiiralllfdlll.sbaS■■etuMMnoodnuaJiptwstyshreuoehCseoanrianloacpoxGrmtheohuAyreipaptwfjaKlhaelrseeazcoTytrztrsniidf,ontrei6,hsefga8optictHnp.rJomu.gmobror..de”.ellildsinntMTeelHgucshcncleidy’ofeoslssocTcnlhtwDqelrioctiilurOteenShf.yitalmmtlwsaHaearn.TwtRti-OeHatamehcWoetou,iNnlsa-tteitcirogJnauaziltzaAFrrettsrsitoCiveraenlmtsrtSAA■eian’srRRaitsJFsctCCoaetuuhnmTTrirtstdhhhowsfaeeSeeRt..yeaasHHkgdswooeioi.iotthteehenalla,dj1aa0znz:d-f3oR0lukscpho..mmGbe.ot,yaonudr
2016
group he co-founded with drum-caused by the renovation, le café T D O T TAWA
WINTER JAZZ
of busmombliengfubanrriinstelarswand a cleverwillbeclosingforlunchfromJanu- F E S T I VA L
When: February 4 to 7
ary 4, 2016 until June 26, 2017. Le Where: National Arts Centre
Fourth Stage
scienptrisatc, wtiicthelsovaen, sdolar farmsItahnmnwdeartBrtiahneBrlaedei, sthe Grammy-caféwillremainopen,however,forTickets: $22 to $32 for
omainnatteed Fdeltloodinner in the evening. The NAC’s

wship Band.cateringoperationswillbeconsid-
alcohol getting in on the action.erablyreducedduringtherenova-

soHmolleinfs usayns tihnat hlae awnd Cow-tions.
“Tdheeahluimnganwsiidtehof the law isshhne’rtodwbectamheeclose friends whenON CONSTRUCTION
Brian Blade, the profound and ex- lins and Cowherd were roommates single concerts, $40 or $50 Wallace at 7 p.m. and then the Hol- smcaoeymrsbBHinroiaaltlinionnBso,laf4dg5re.o,“otIvh’eme, dGsyenriaz-minmg yth- e “WeTa’vrheeejurLestaohluluyins, giraeonaualtl-syroadmiesuvecedhl,odpruedm.mAnedr/ lminigshatnndoMt hilalevrehthaveeinbteeernnaptliaoyninagl S■ uJnodhanyGeggie Journey Band,
plosive drummer who has played in New York in the late 1990s and for evening pass, $77.50 for lins band at 9 p.m.
with Daniel Lanois, Herbie Han- Hollins occasionally took part in Friday-to-Saturday pass; ot-
cock, Wayne Shorter and his own Fellowship Band rehearsals when tawajazzfestival.com The next night will feature
acclaimed Fellowship Band over its bassist was absent. shows by Ottawa bassist John
the years in Ottawa, will be play- Geggie’s new Journey Band, which
ing the National Arts Centre’s in- Blade thanked Hollins in the lin- blends world music, baroque
timate Fourth Stage in February er notes of his 2008 album Season music and jazz aspects, followed
— but as the sideman in the band of Changes. That year, Hollins told by the polished chanteuse Carol
the Citizen: “I remember when I Welsman and then the earthy and

first started hearing Brian, I kind
of thought, ‘Boy, if one day I get
to just play for a minute with him,
that will be it for me, I’m going to
be cool.’ And then I got the privi-
of a Gloucester-raised musician.
Blade, who has also recorded

often displayed when people etnhe-y were among several peoplewith Joni Mitchell, Bob Dylan

practices andand Marianne Faithful, will sit
coun(cteliretnhtesl)a.w. It always seiermwrhseo vshearredeanntUpspiedr Weest Sideon the drummer’s throne with
The public will begin to see exploratory duo of pianist David onmpoipmsmoirnatanutdnesidetynF.s”eitlilvoitwy.ship Band. listenibhnaegn’stodglmoetuasadiecs,rpgiaornoitfdinwsgihnegreerh/seo’snagl-l Tickettjsao:zgSzeintsghtleaetcruoinrnceeMrotsfoBnltardeealasnidncCeotwh-e ■5 pM.mou. se on the Keys, 6 p.m.
physical changes to the building Virelles and percussionist Román tpphLDmhileaHayaBeornlynsldaoioatesinwidlbsodsl,eetfieJeaxnwthJocnrh-sanoaeidrestimsnoSahjaMaaoemcCeyzRamiczstolcoooc,wlwtmmnnhsohooeaghpsarltnaellstt,dnneeroDfh’isdrveeimaeisge,dneCrewarNiBnenaenahodeltsltdibohwsspoCn,ewhYIooahgopwsgerly-nkeamlSiErnuoEssuDsincRacfmawdayEeobl,sArJeidb.moMis“loortuJmsoeiibOontntlrNiehgasnikliDene’sssaeri2rg.dltlr”ilviieyHktosi’nestenohoangaliowbnllstilfrighnntaosgeis,tebr”vhdmaoHietnourfoyu,ovdt.las-ertCi,hcado.eswyIimtnnhraguee-usraildlcal.y(pfar”u$tal2sol s2ptte-aa$shmhlswi3s(eosa$e2H“itrjrsd,4Waedpni0(z-nsl$z,1-mue$f7ib9tse’n75avaus9f.05egletnt0ie,e0vtpjshnsaapuo)l.luent,l.sucsnmsdtosiifsgwmehfucheeaoutsoeslsil)nynmce,)g,ahpgdoioomiusnotegtfrsihn.Coegam2n0ua1cd3hia, n ■ CMaornotlrWeaellsGmuiatna,r7Trpio.m, 8. p.m.
between December and January, Díaz, two Cuban expatriates based Pwohpo, sChaasrseadndanraUWppilesronWaensdt ,Smidoest whBelandtehheyaspalacycoamt tphaenNieadtiBoonbal JaruonuonAdw, daoridnfgosriblleystthcionngtse,”mH-ol- ■ David Virelles and Román
including hoarding that will be in New York. DTiícakz,e9tsp:.Smin. gle concerts
installed on Elgin Street and on (■$J2a2m-$s3e2s,spioluns, 1fe0e:3s)0, npi.gmh.t,ly
the northeastern side of the ter- The Sunday concerts will be by ApaRsCseTshe($.H4oM0to-eu$sle5o0nt,hpeKlueyss fees),
race overlooking Confederation
Square. PCL will also begin to re- the quartet of Montreal-based,
move concrete tiles on the north
terrace in January. Inside the NAC, apartment during stretches ofBlackburn Hamlet-raised bassist
work will begin near the Fountain dry,” Stauffer says.FraserHollinsonFriday,Feb.5,as
Room and in the space between
the main reception desk and the “But judges and lawyers are pdlaeteiomw-aelybienetwrgesewnh19ai9tv9hpartofthe2016TDOttawaWinter
Theatre lobby. aen,d 2005.Jazz Festival.

Visitors may also see some Completing Hollins’ quartet
work being done in the garages to
“Playing with him, it’s verywillbeMontrealsaxophonistJoel

ple who bring their own emotio(cnalilMiller and New York pianist Jon
ents).Cowherd — Blade’s longtime col-
that there islaborator in the Fellowship Band

and mental and historical baggageandotherprojects.
lege of doing so a few times ... I just diverse lineup that includes a local the Japanese trio Mouse on the afapmarotumselynftodrujraiznzglostvreertsc,htheseof DArytlsanC,eJnotnrei ’Ms Fitocuhretlhl,SDtagneiewl ill be lpionrsasrayyjsa.z“zJorecl’sorlidkienga fborroSthweirm, a, full passes ($77.50 plus fees)With nothing more than two keyboards and a drum set, this
feel very blessed to have been able jazz-funk band, a smooth, swing- Keys, a trippy electronica-and- Japanese trio punches out a complex prog-jazz-funk sound.
to do that.” ing chanteuse, a bracing duo of hip-hop-meets-jazz band that They play on Sunday starting at 6 p.m.
Cuban musicians, and a Japanese consists of a drummer and two
Those Blade rehearsals, Hollins underground post-rock trio. keyboardists, and the Montréal Satuontdtawy ajaFzrazsfeershtoillvinaslQ.cuaortmet
then said, were “just a few experi- Guitare Trio.
ences in a lifetime of music, but Opening the festival is a free
definitely among the ones that I concert by Ottawa groove outfit On Thursday, Feb. 4, there will
remember very fondly and really the Chocolate Hot Pockets on be a concert by Petr Cancura,
smile about a lot.” Friday, Feb. 5 at 5 p.m. That rest Ottawa multi-instrumentalist
of the night will see shows by the and the jazz festival’s program-
The Hollins concert is one of ming manager, with Ottawa sing-
nine taking place at the Fourth

While this group led by Hollins Stage from Feb. 4 to 7 as part of the impeccable Toronto-based trio of er-songwriter Lynn Miles. It is a
performs infrequently, its musi- fifth annual winter jazz weekend. saxophonist Mike Murley, guitar- co-production between the NAC

to“tIhwe apnictteudret.o show the irrever- Joel Miller on sax,cianshaveahistorytogether.Hol- Completingthefestival’sbillisa istRegSchwagerandbassistSteve and the jazz festival.
some fun in lawstrengthensomeoftheNAC’ssup- left, gtirmouepbhetewceoe-nfo1u9n9d9eadnwdi2th00d5ru. m- nLoanoeiostahnedr tSheanl, Bnolatdteohmimensteilofn. wmhuiscihcaallbsoroftehaetur.r”ed Hollins. Hol-
andmFr“eaPrsleBarryHianongllBiwnlsiatodhneh,bitmahse,si,Gts’rseaevmnermaytyt-he 201mT2 hOoetsttLaowofuatihJsaieazjnzaaFz-ezrswatiiovsaerlld,dad’srregurpmeaarmttsoerf/a qualSriEntEestDasRneEdtAMM iMOlloNentrDreha2lgauvitearebterioe(Mngp3)laying
porting structure.
S E E N A C O N D2

nominated Fellowship Band. bandleader and singer/song- together in Montreal since theto play the TD Ottawa Winter Jazz Festival that also includes John Cowherd and Brian Blade. F R A S E R H O L L I N S JEAN LEVAC/FILES
ent side lawyers have, that there You may hear hints of Radiohead, Jorane and Rush in the soft ■ Mouse on the Keys, 6 p.m.Big names are behind the Fraser Hollins Quartet. Besides
tunes of this acoustic Quebec guitar trio on Sunday at 8 p.m. heavyweight bassist (and Ottawa native) Fraser Hollins, the
practices andis some fun in law practices and Buy your tickets online at ottawajazzfestival.ca or in person at band includes Juno Award-winning saxophonist Joel miller, Joni
dealing withdealing with (clients).”
Hollins says that he and Cow- mid-1990s. Q U A R T E Tthe event’s box office on 294 Albert St., Suite 602. Montreal Guitar Trio, 8 p.m.mitchell pianist-backer Jon Cowherd and renowned drummer
A New Paradise is Stauffer’s third Brian Blade, who has recorded with Bob Dylan. Catch them on

(clients).play and the final instalment in his ■ Friday at 9 p.m.
Media coverage for the TD Ottawa Winter Jazz Fest came from theParadise series.

A longtime community theatre

Ottawa Citizen, Metro News Ottawa, Ottawa Life, Ottawa Sun, CBC.actor, he debuted his first show

DREAM TEAMLostinParadiseasthe2009pro-
writer is renowned for a singular “We’ve juPwseittthrhclyaunnncnuMrgialF’esosecuraottssusroroaidnmsguJcohe,l Miller, Jon

herd became close friends when combination of groove, dyna- listening to music,Cgoowofhienrgd and Brian Blade Tickets: Single concertsThe man behind jazz fest’s musical lineup will be on the stage
himself. Juno-nominated saxophonist Petr Cancura, the event’s
they were among several people mism and sensitivity. programming manager, will play an opening set with his
Crossroads band and award-winning folk singer Lynn miles. ($22-$32, plus fees), nightly
who shared an Upper West Side Blade has accompanied Bob
around, doing silly things,” Hol-Their show gets underway Thursday at 7:30 p.m.
lins says. “Joel’s likWe ahebnr:oFtrhideary, ,aFeb. 5, 9 p.m.passes ($40-$50, plus fees),
apartment during stretches of Dylan, Joni Mitchell, Daniel musical brother.” Where: NAC Fourth Stage full passes ($77.50 plus fees)courtesyJuanHitters
S E E D R E A M O N D2 Tickets: $32 Davidvirelles&romaátnoDtíatzawajazzfestival.com
time between 1999 and 2005. Lanois and Seal, not to mention
“Playing with him, it’s very most of the jazz world’s greats Afro-Cuban jazz musician David Virelles has been called a
leading musician of his genre. His latest album, mbòkó, topped

year-end roundups in the New York Times, NPR and the Village

Voice. The duo take the stage on Saturday starting at 9 p.m.

duction of the annual Lawyer Play,

a fundraiser for the Great Cana- T D O T TAWA
WINTER JAZZ
dian Theatre Company and com- F E S T I VA LOTT10653142_1_1

munity causes that Stauffer had Ottawa-raised Fraser Hollins has assembled
co-founded several years earlier.

His second show, Still Looking for a superstar jazz quartet, Peter Hum writes. All concerts unless noted
Paradise which he produced him- are in the NAC Fourth Stage
self at OLT in 2013, raised an ex- 30
traordinary $50,000 for the Union You could look at it this way: easy,” Hollins says of Cow2h0erd1.6 MferodmiWaayMneaShrokrteerttionCghicRk eport │ThTurDsdayOttawa Jazz Festival
Mission. He hopes to match that ■ Petr Cancura with Lynn

this time out. Fraser Hollins is just getting “He’s a great listener. When Corea to Joshua Redman to Miles, 7:30 p.m.

While the plots have evolved, a together this Friday with his old you’re in a conversation with Kenny Garrett. OTT10653142_1_1

law firm is at the centre of all three roommate, his roommate’s friend him, he’s a great listener, and you “Brian is a really beautiful, giv- Friday

plays. and a longtime buddy to play feel that when you play with him. ing, generous soul,” Hollins says.


Click to View FlipBook Version
Previous Book
TEST_Daily labour update_30.01.2018
Next Book
Lumity