J Local News / What’s On / Local Directory
une - July 2017: Issue 21
FREE
I Bramingham I Bushmead I Icknield I Barnfield I Stopsley I Wigmore I
Top Tips For
Small Gardens
By Alan Titchmarsh
Wills Advice
By Martin Lewis
Inside This Issue
WIN A Family Ticket!
To WOODSIDE
Animal Farm
Connecting local people to local businesses
Delivered free to 10,000 homes
QUALITY Do You Dream Of A
KITCHEN New Kitchen?
FACELIFTS
kintcoUhwKe’nospfleaencaedilniinfytgoeuxrpearret a! EST.
1999
Before
®
Whyyoruepclaacne rwehfaence? CALL MARK FOR A
FREE ESTIMATE:
• Large choice of doors, worktops
& appliances 01582 806433
• Less time, money and hassle than dreamdoors.co.uk
a full kitchen re-fit
• Installed in 1-2 days by local, skilled
tradesmen
• The whole process managed from
d2esigwnwtwo.tchoemvipnelemtiaognazine.co.uk
UNIQUE AFFORDABLE FURNITURE
Bedroom Furniture designs to fit your lifestyle
We specialise in
made-to-measure fully
fitted furniture for bedrooms,
studies and lounges.
Visit our NEW SHOWROOM.
WFITETENDOKWITCOHFFEENRS NSSOAPWLREIONNGCvvUon4wi0tnw2Jtw8oa,e.CuIlcnStktinrqueiueseeltdfbvoWeNrdaoyrdrotFehoatwmarmoisol,dTsdri:irnHegicllsRt.dvc.oMD.uuidnkdsvlteOasbMpelexoenv,:L-HUMSA6ao6t2n1J1dX0PaaAymvT-e-FTlre5:idp0l:a1m05y129v52832Ca25mlo913s0-e356d18p6SmunCCOoFnHFtUaWFOcRItOBCINDfoEESrIETDEd&UReRFtRLAaORiOlENsOOUGTMMNOE,GOEF
Office Furniture Lounge Furniture Fitted Bed Furniture
Proud To Be Inside this issue...
Highly Commended
CEUdiStToerO3:xM0SpcEeoRytretCiNaeAirnRgsEhcteEinXgCalEeLLENCE AWARD 6 MS Society Celebrate 55 Years
8 Luton Hoo This Summer
Advertising & Editorial: 13 WIN! Tickets To Woodside!
• Shelly Nesbitt 14 Recipe: Seven Layer Bar
TEeml:a0il1:5i2n5foG2@2A2th3eR7v9iAn/e0Gm78Ea5g2 aDz4i5nO3e0.Oc4o3R.ukS IN STEEL, WO16ODPu, zGzleRs P & ABS
18 Martin Lewis:Wills Explained
• cWohnitlesnt tevoefraydAcvaerUretishTiansOgbaeMnednaAtratkiTcelneIstOopeuNnbsliu srTheetOdhein NEW & EXIS2T0 IANuGtos :DCOitrOoeRnSC 3& GATES
• tohrisitms eadgaitzoirniFealaRcreoEnatcrEciub ruaQttoerU,snceOaitnhTearcAtcheTepptIuaOnbdliNsheSr, SPARES &2 2REBoPdAyICRhSange Health
24 Milk & The Alternatives
hereby disclaim any liability to any party to loss
or damage caused by errors. Neither do they
26 wHwomw.ep:rReemciyecrlgea, rRaeg-Uedpohoorlss.tceor.uk
TEL: 01525 220212reflect the opinion of this publication.The Vine
does not officially endorse any advertising 28 In The Garden: Small Gardens
material included within this publication.
30 Looking Up
No part of this publication may be reproduced
without prior permission. Copy deadline
for next issue:
July 18th
UNIT 7, SPARROWHALL BUSINESS PARK, LEIGHTON RD. EDLESBOROUGH, LU6 2ES
www.thevinemagazine.co.ukwww.thevinemagazine.com 19
Find Us On Find Us On
• Extra Lights • Addional Sockets • Door Bells • Outside Lighting • Security Lights
• New Fuse Boards • Rewires • New Installations • Fire Alarms • Emergency Lighting
• New Cooker Installs • New Kitchens And Bathrooms • Garden Lighting
• Landlord And Homebuyer Electrical Certificates
• Reliable Service • Quick Response • Tidy Work • Flexible Hours
• Reasonably Priced • References Available • Small Jobs Welcome
Fault finding and Repairs Satisfaction Guaranteed
Landlord and Homebuyer Inspection & Testing P.A.T. Testing
I will assure you of a quick response, and a reasonably priced service…
I give FREE NO OBLIGATION ESTIMATES before commencing anywork
AWWAWAWiAirnnrieinrrenttiiteeynntyhheeoottryyeerueeuaooarrSSFnFuunraauudrdeFFemmnnSeSerrddzwzmmweeiinneSSeeeeeglglzztwwrrteieiii??nnnrnreeiitggnlltnhtthggeeeiiennrriittnnhhggee
iinn tthhee SSuummmmeerr??NrtWtsdcwNrWtcstdwhhooaohhuoooaoNNWrrtWtcsdtdstcwweeeuontoeee-hhohharntsiooLooaaoo-mvcharssuuikLoomnvchesoeeeeeekoeoonnafttnmeoo--edafaarraomrssaiinLLpvdmmvvccahhossranpkkvascknnsneweerooasoockeesnaaffewtrinmmeodddotCioinaaooeerroaanndppoovvsrCoibenvoosraasssbvcckkhnnsspnneevwworrlsvehnpnpeattlsiinniereenooddperapioosCCirooiismitaseeyrpioossdrrsmitasobby4enndvvooacsoss4vvseeahhnnppacrsrslle0eanteernnryppeetaae0vssntoweiirrytdvrrppiioywessmmtamdyiittaaussyyaytahddmiyuoaoos44tteeerhinoaaccssssteteossrhueeaanesarrsrreodhueee00sannttrrdehtryyttvvwlrroowweeehtyvrhorslddwleyyyvvhorslttaammoiyyeuuaaaawvacRoiehhciiaooawacossRttectteetnerrrnnsoossotneeeroohhuusfiotceessaatowmtfiddtcootweonmtrrorrhoeehhottrreonwwollhifndbgsyyvvhhfaloorrssllifndbeegslfavvSitootiitleinSaabaawwigtaaccntRRteihneeccbcogvwneoohuicovttnneerrweessoooevulitdooesouevfifiletttccdhrttwwensuqmmttehirooenootyeeeqoonnneipooshhtuyeiynexpstouiiffnnddieybberggssxatfiffaahllooepersanofillhorpSSiilttsirnouertttteeiiinnsnvvlbbsggiruetnnsishhnrvvsccoovvt.ysaigwwbeeruuitiidc.yaigbCeeeooieevvtdclltttddaCeaoewpssuuntoaueehhaorrewpeennnco.qqufnlciirscttyy.eeeafnklnnceepprssseeuuayiiyyktsxxecttyooteeosteerrcaaififihhooooerppthnissmnnoooerrrhno.lmlliirruueeevo.iilssnnvvvvsseeovttssrreeo..ryyaaiiggebbfiittrddccfCCeettaaaaooeewwppnnoouucc..ffnnllccrrsseeaakkeeyyttssccoottiiooeerrhhnnmmoo..lleevveeooeerrff
tWWthhWWttaeaehh’tl’t’laaees’lst’’tttrpllrp’’allsseaenttrnrrrppsfsfeaafeeefconncorrtrtssrffmemeeeffvvccooyeyettrorrroymmueeyurdvvrdyyaceeacoyrroooynyyuuonsofsrrddefetraatcchrvhooveyyaeannytooytoessoeffraeerayttryrrrhh!ivv!nieenaattoyyttoooaeearraarryyorroo!!iionnmmttoo aa rroooomm
CFCFoaoarlrlmlmttoCCFFooodoodraaraerraellyllyimmnittfnfooofofoooroddrrrrramaaeeamfyyafriiarnnetffetieoiooffeooonqrrnqrruvaaummviosiosfftiaattierrteeettwwoiioeeoownwnnnqq0w00w00uuvv11.116n.iioo16nss6u0ttiiu050tt0eel4lo24owwooo52552kwwnnk313r17r276o00ww200o78o178o11110..f1660nn1f18.6608c.0cuu000o00oll.044oou.u7kook5522kk3311rr7722oo7788oo00ff11
Issue 21 • June / July 2017 5
local News
Local MS Society Celebrating 55Years
Throughout 2017 the MS Society Luton, Dunstable Luton, Dunstable and District Branch operate a mini bus
and District Branch are celebrating their Emerald service to transport less able bodied members from their
Anniversary. For 55 years they have been offer- homes to the weekly activity sessions, the therapy centre
ing support and assistance to people in the local in Bedford and to various social events.
community who are living with Multiple Sclerosis. Regular social events are held to bring members and their
Much has changed since the branch first started, families together, these includes coffee mornings (every
particularly in the increased range of services that other Friday), a Lunch Club (second Saturday monthly)
are offered. The branch now has a team of committed and ‘Fun & Trouble’ (last Friday monthly). These are all
volunteers and support nearly 90 members! fun socials and are open to people of all ages.
The MS Society offers advice and information to people In addition the Society organise regular fundraising events
who have been newly diagnosed to explain what MS is within the local community which raise money to enable
and how to manage different symptoms. The local branch the branch to continue its important work. These events
has a dedicated Support Worker who is available to talk are also opportunities to spread the word about MS and
confidentially and provide guidance when needed. updates on research developments.
The branch offer two physical activity sessions each week Members are kept up to date on branch activities via a
– one on a Wednesday at High Town Community Sports quarterly newsletter and on their facebook page. If you
and Arts Centre and the other on a Saturday at Lewsey would like to find out more information about the work
Sports Park. During these sessions, members can take we do or to become a volunteer please contact us via
part in swimming, yoga, pilates and chair based exercises telephone on 0845 605 2055
suitable for all abilities. or email at [email protected]
It's a real Most of us try our best when it comes to recycling but, when it comes to
pain in the garden waste, Central Bedfordshire Council say that unfortunately some
grass! are still putting the wrong items into their bins and bags and these items are
causing major problems and ruining the good recycling already collected.
What IS accepted:
Grass cuttings
Plants and weeds
Flowers
Prunings
Hedge clippings
Leaves and bark
Vase plants
Pond plants
What is NOT accepted: Vegetable peelings, kitchen waste, plastic
bags, plant pots, polystyrene trays, soil, rubble, animal bedding, pet waste
and general household waste
If in doubt please leave it out! That’s the advice from CBC regarding garden waste recycling.
If you have an item that you’re not sure can be accepted as part of the garden waste collection, leave it out
and place in your domestic waste bin or alternatively take it along to your local tidy tip.
6 www.thevinemagazine.co.uk
Is Your Roof Ready
For Winter?
Flat Roof Specialist
• Felt • EPDM Rubber • Repairs
we will beat any
like for like quote!
01582 690005 07515 361972
www.mycomplete.co.uk
1st Glass Window Repairs
FULLY INSURED!
EMERGENCY SERVICE AVAILABLE
Local company who can fix all types of
problems with your double glazing,
call us now for a free quotation.
• Steamed Up Glass • New Conservatory
• Faulty Window or Roofs
Door Locks & Hinges • Conservatory
• Draughty Windows Cleaning & Service
and Doors • Security up grades
• Leaking Conservatory • We also fit Windows,
Roofs Doors & Conservatories
£0 DEPOSIT REQUIRED - BALANCE UPON
COMPLETION OF YOUR FULL SATISFACTION!
• Fascia • Soffits • Gutters
Special Discount
for OAP’s
CALL: 07511 906 161
Issue 21 • June / July 2017 7
local News
ething incredible is happening
d like you to see it for yourself
Luton Hoo Walled Garden ChLNildaEruWennS&chFRaeEmsLilLEieAus AtSopEpneal
An inspirational restoration project
Open every WeHdnoeosd’sayOpen For
SAumBmrieerf !HistoryOWpeebnegFianrtmhe112Sa0uEmn1nt6ryd-:‘D£3oa5ppye,metn1a1ditalhys’JsueHansFOeoonMartEWtiDIheNmSecd“teoTnpaBmeSiRelOssLicdOnmaOaiugnyTDaKdst2lUo9otoFEtiAeCchnEnkvEJSeuedStTlRsny”ti: TatLetAhreeUftoaCaolbrmNeaicflpioaiinCatlpiybasee,HinslemifctowEyi.eariBnlStmhritsoaaysLwlnuoinUyluelsndrhT.eegeTsaOacihsglhonitNsihneld,dysberCiFeanelnrrHcoelwwwuaIeedvLhreioanDGmrageaeRrriaenldliEtesnm,nteNprisWunosggvo&ogeotrlroditndFyigsA- MIL
from 6th May untilD3a0ttehiSsesputeedmb1er6/02/16 Home-Start provides vital support to local
Something incredible is happeningardens, its hiFisntHPoorlLyroanEothtAEeHsFfetiarrOtiVPsteitarspiotgWteodiuemnurapc(leFrHleoedateduhrcremeGtsstaLalaSlrounudfftdeneroindnBngaeawyHd,itsowh)ohothiEnceREhsSnetAjaoiafysrtntuaeentlsrihghudwhemtaailullyfenlFacn2htartai3misnrkrbfeideonauprgAtifauprl tril
Something incredible is happeningHomeStart provides vital support to local families with young childrncewaitth11a:3g0u,idi1en22d:3dt00ouu1rs.6trfyro'smarnannda1gtve1eio0gofed0tnaeb-lail1celis5ofuor0so,pms0eetah.snoenEgaadlnrfdarteuyrnitas.onnceSiusnsajuudsrerslaoetcuytn£iodJn3inuogfnsah. Onoetudar1ncd1tafocetohlsuderrdvfsrerisnooksfm,
to tfhuertShheorobtiunigldLoodugres,uopupr osertttsinegrvfiocretshiencLafuét,ownhaenred
lighhtaluvneclhaeusnccahnebdethpuerLchuatsoend.ChTihlde raednjo&iniFnagmstialibelses
houAspepaenaelxihnibhiotipoen oabf orauitstihnegV£i3ct0o0ri0an. farm buildings,
aaSnnTodd mwweaee’’nddLLdtllihikwkuuAeeien’ntytdyLooogoluuiiknnunAitetonsonptyscsHoHoieeurrieenanetoioiotsttdipfoosfoHooiienrrbreaaWyWyloiotoetliuufoorroraaeinssrseselalWyltlffloollhuereraraaesddptesliltfoploGnGereadnpatairiornroGnjddgecpaeetrrnonjdecet npfbsooromofk1a5taiodonredamibaltb1oE1frcooairaorsutaO1ovwtAibtg51naeeandhitrp.0nodnchr0apeLcmowue£lfe2umd3ml0tteeptuotrrc5ooeIgeitGa0g0yknrnonaInir-tOaear,rasane.0a-s3Hetatncandrut1amwfreetratpao1pnarTrn5dodithndluone.aedtlaehdemthedWfe3deenoernsrdlsfteendoTevyans,si0heanfh.rlasftnb1al,,oekietaryaWvafrgteadhfmttedcecery9brtemtojTsliorsashnotaaaGhveeaaheaerwtmeooeotrelatwhikrhoedmonentsucralhddnfftciWdceaJeieaedsinhohLnaenoeegaoanatr)genpronshunrlcts,dndeghlntnulpanggnueeaaronmosetllsssnnesianuwoneradoestonaeleddwmithhahdHfrldndstdcdtaurrewdoeineaceaSssbhiSobiid2vescltutlaeerpontoeclodeetsdsaretbnene0hset1oytuahuetos..tpputbrhimp.mobosrcsyilnsnteh9ncGatant,anriheepnminnurApHahueeedboaEpds8lritfyChpg2secgeka.nutreeaelrsucp0elage0a,iinoaserwaen1vruognibnsfeeongati5btd’3sdwntfxpoaattuechiwgsdfuneprttdgrioserienoelnodavmhtreleiyfels-rdttriirehlArgooaannydodurehbriw,gveisioetfgnibedtbessrifcnwdiErheeisuohsngcvcupinalenilSeaosmsrdaaVtiteenvnWeeonfgnrisatLrtneoseanMdraterrtisyeisddaheanuctl1noLrpefuonc,n'aoideaderoeatiseimsdtmoalteoBgutnlbgrrrdtfugbosxeov4eslsreeyospeapaferpnvot-rmylthaiuaecrorvnsooimstoGhrnaldeio94aBvunnfcnoaliatatitiudftownrawiotdahatcctHerrendbauens,nutaoGaih£hnfgctencnhrigotcntesatnisreosHemreoehrf2.tdfoekspdiesefassaerreonraewhoa.',.sanmrasspgigoro£aasw,yoplwonogsndmasnnifeneTnaoiinmsEsefctererdtee3htilaodevoahrhdttoihaharlscnhdInbdhsenlokErrIovttobiagua0jsetIcosaeneeenuebafnmser.npsWawelshtdnorcteeirirn0ererinLedssomlalteasaidtvAgaithaon’drbiutlac0s(onnsiuylta-taneease-r-genroeuyitlnsWmd.gudc.ttdtlwh1obattogt,ureean7Wararytnrdeli6hsecElsAaiiiEgbira.naef0ennnstsegnahteiardn-l’cqynarldsttilgvtbatSibhcnadunhhtutvuonalnuituheieeeyeerahdenrrhedfbioTgttAidrnsmlterennahonwngaiipncrwh1Feetghyfnelterdseg.euwibtp8eenaoycbrm.evgghaphn.tiesdbs6eeerphtAiAreseclotoisuAnxhteeaai0erroaacervhh(psftcuaehghmaren’ooutncotoespiaavlertrhotgaliirayjnoduombfisinelrarliatnevlheoueaehdspedhifmncumigtasocelaecstsnrtaersiLiii'airinptnotmfrosndeseastoaosssaslwaa5dsoghrmcdnegtdlahMntwticcenoitoluilef1eayresofo.niaoittlt-dogfuvaeoedoeenyihoecbLnfasetnosiagrcrfassaafctuehenAagounwarvunbtasrdtrriessrtlehsdol.ltthasserorreucswiloathssheeysdttue.wbymkhoeefneHaihauunheecadeeoplaernnareTrmsyrprbefoisndetanptegctaeaerris.rchiepauhnveewnetsaooihomnesaghhssudleetiatrdor’smvgrdrleotbitrdgsiadiivdtetnsisroloaWrasprsetmrieteelicaeaeiueitiofi,uiwnilnnctosfssfiaphodnansreyaftpighyflttudehrfnbjrrcydm.lhgditeisuioehaalnstuenanoeeeloWdehtsesciaoceccd,sscrnirnptete:sewaasutwaonhglrlWeLehdteruateettnpgce,animthfsihhiderbsdohalanuatatcrrdtwlsehaebhuorlmsfhadronui2eheiwebnctitresreudttep0ewbssrIseooiegeihei£villnreIpstenoartelyaaeuddeieaeh.1aeneoonc.1kgnsrqarnorka)nd0k4guHwlftnmsrtC.diduehnfvaadma’ot9oCddssomnsteroiedfhTmishpohipwrgtmffniwcnlpisfetaibieuhieheemrtiessthetlnmtvtaeaehdyluninhfehsrsiiiioiicaadeuvnelctsrnrosctelaadaeshtifkeeenydlienagnrigttbpllreoeceryranti-ceifrumratrunntuileunoeseliclaraetsivdutctetienuninyeraddosrenode,sngs&sm,pot
SbiunegmcsTomwomdilelabryaen,Etaehvvxeeacinisltaiitnbenglegcan.oVecmTwoocplueorurxissnpreodetsferitaienhnfergicviFneatgrfaoomcrrBtvehiusgiieltadorirdnnsegtenos ,ehthsaduevresrouonfsgdtar-treh“dnSeegbtntuehdcfabaioenonmsobsWkehieleopyddwu.nfroetcHhrshdaaaotansyLewsuidl.tleouaPsnsvrtwroheadeatrlesuldcbaietsetaacLhlnokuadmttoospenlyambHonouteosrreocfcrdohloueommbpnreotiehyvr.eesdcocleieatyr.
An OinsppeirnateiovnearlyrWestoerdantieonsdparyojectNWewalelefdodrbG2ya0tr1hd7eeSnourwimghimneoraeelrft1Eht8evhtreheenCisneiagcnnVetueobrxylhueionbrctiegttiaeo.rgnionAongfaswtlhiweollarubelel-r, asnedrTavhiiocsvegHearorbtdwheeentoclargoseetvmt5ivtoayelethisaserssmW.tiAllaolmollrenoedgsoGtwianagtrehd–eilrnldd:koonfn’Ltouetwxopnne’sctcththoiledsreeennumb
ffrroommfr66OottmhhpeMM6Ontaahpeyye11vM1u1uneaannrammetyti-1vi-llW31u3e33papnrmm0m0eyttitd-lWhh3n3pSeSm0eesetddhppnatteSeyesemmdpbabtyeeemrr berLuton Hoo Walled GardenGfGmaAt-OfOiw8niTaTDhrvFbOcBtualwhPaLsd2Wrraoolinfaaeuoeeuapvnosuohrlnoi0uaeonoermusrronydtiuarathdlvvuyonwtle1kcddodlrbatetidaroessroTMiggatgtbwMrsouOs6ollsddmcreeohnnvntwsaabistes5duiualagriofuhinlawvewaohnncsdae–iahbcinfegsuirlaapptuaaratcHtnhrsesEiuieWeebads..etiskdeeahoecnglltnc1dttlesmeirnrgawidteirasdptlehooienckt0eiWtoiodeerkntawheooNTihoepghbnrmwahtfeintleeraheofa,n0enesrgesnehswnnotbofboealgrelhwdtbWeeodogaponesaedesheipgotheectrarreuaDTadofltu-iiyrmehnran.i.twairpomzsssirsel.agoefnngngoeoectson8hiswgdifgnacatneitliatonednas.hexohstiindnttnoedwdnnrpelueTteotcaetridlesnoteicaoliihnughvascptsegnfeeslnhsrehmbtnnnuoodh1or.hrMdrspwalhuhnotdeieoeetadydLhunt’yeoe5tgotssveaavfesofiaaorsprdralrfiauoegeToschragvraesattoaotvtdo0otniydihsty3peifcseshWieneenrthsrrrbshtherhautaeipmn1hynrfeaho,tdoe0nupatdyzegfdCt“tptoaesECsiotertewdsyat1otAoacnsbraaaaeohhos,geuemdrmShec0chehdeehsordgBaca:veietgulttaodeeiiapsgaetesaleewieee3togssfg.metrirvthkpeiwetiabantpiushroeretlasv.ssfrricn0atuonuthsalonesntaweadgrLoitianu,agectseceisrpgdmyhlasordhaina,heatgiaeesndi,TnwbkatcoancotspuauddiooaualhrnsGn1autdeedeiicraagheiagdrwehherratiorndvstnaelneouariaongtldw2epdsneollelartsolgldtianoeerseoninddudlvallsaieitradseso@irhs:tdlerliaengcevirnisyve.obraeesh3aapnftusttdhithndlraciineiznfiMardetahlylasegnuahnaxntns0caBeeneysseoronlHosieadian,.cLsirtngeerthanltsdttegtdohdiBeicresleibauodunr.ahnoys,Hntpugeoddonvwi,abouaasdeuwetmtuJuyno.soterotserinechdshopeeueiwgirci.-roehya.kotecehecgnnfhcpiotwlylupodsRutehtltlrlunEsrets.yaot.htMbnoeotaatuafoavfdoaoieEeWhcntdcaaaiihhnigowboo’sopbvachtt.otnncenurbiditdsuytfrilneseahhointianesefnuleerrrneditetecgbttgssrWrstieoesFeodogidttyowiasowiadnasenguto.e..honeeavatdiytan’taus1oauntueutnsnirtu£dhsntatdhsrtntd1sainrtrhn7tthbyhwkhrpwotoetoec,wcmeh.ta,ngtykeufdsclbiimyn6t1oeoooeebaylaheeffobrl,aiieaofWulhccSkeecltssguuita0ndttursmsyoolntaefon5nhhrdsKrPaVf,sieerswhaoa.wlsrhr’ttwseraradonnlearoisnghtderaHpe.hlitittcniptWliatqolnthoeiniuoitrarssamcTeauolvihdwvetenteeLamfseoioorieeiugifosleeudrogfoyrsdecorhoreteuragdydkeefiwootimwveneLn1gesanyvttuballerhoerorE.lilhhhged’srddheert9loniesoMsnehouusgbouaaelehdn.gaep-elcd0tlrnaodsurruafrerCeiaeruw-ra-otbvrieW8dcornfnosdtrtynlovpdcrwieahee,yedElapceetfrubee,neinelrPVmenEoalecEilrrdeaOiceace-ds-ufOghhtoWFtwaihinveisnnrirhhsrrsrhnah.unofoosuSanwi’oCtwdgeepaereotf.vtrsf,uucwtrrniaomrowhl–pawoYdCfusafridWseoeheiwdceiotauglasydaouadtvwuseyhoenufsleiwdeeLpE,meisu.notaf.e:mfAETHpsmlnHg£nfa1:itre@hlacutownasOwuurllftdrensween£hohrcahpil1r£e0ladP3sioetyrlett.ewvyrdhbdncsdeeeoipc.ttubhahcl0oo.lo5eeeoio0easpt’dh5elb3uwapedenraehswamropdn8puyenenfAtrnsseer0Let0nooetlltsruEoHsftroemhht1aJi.ppyohcowlisofhoeaiof0onc1hidccirdltoRucnshungkef,rfeolshoopWvnmhivjeo.rWol0SihaheAouukuoneeaon–hbnoeiitrtmhoimtrnoe-Vatwlr8tdeenepveucnnrussdchtrteeaoraepognAioeoyy-etri1fm’letdttshertggnpastessydvldr.hlrtaitoasergygowolpn4at,,neetinrpnboeuhgte.rLo:b/tunsaetthei6ieaaOeeitnypansewtcertnoeeeduns£yTicNueyreouUregor-esvtafatits,tmhgstteietdneaedrohtcsetsntrn.oiaulrs.5Gc.lwhH1aacnealioaplnddromu.anaeiopmiislpg.rtcosfenwvtdiecTsmtonaoau.ntolT.eonr4eLnenor£lwitr,iemedasyrrefMeclnPoraoWrmil.rhumabLa.yaedfsefvo–5scfnhouunfeeltlfLumaeangefiuteetbpteoEoneatefioektoieceublrirerrraaldonotinattenLhttoa.srtl:cdfoaniee-t.seuffenfinesoofdhntrydnSslo.anrfultoEtstgcdioiketodaoe0esi1itivateauohlsgPtssnstrosuonhhe.b,uaamnrr.1c,n1ourdotyoeeeinthoowsieni:artCrnhawda5h1adnlafunybplsvr’tfEiendurrii.efsloeoteemi8aEsRtW0ongnelhnfiouCncltHrrortuhWrtpaylluwtea2pe0ruwnrc.itpheeisorgyaerennlyeurlyigreaa-akeldarun:dijnleaneedh7sciWuumerdknr£uolrrrsn3clanpaterdlnfasoeeet2e5ep/sfdv3irttleiyaewtifpnirderltinadHstrvoeecu1nnelnfefves.adnarfoonapuhdmtt0rtaenedateoe4”cntrnsrignpieditlaornfrngs.ensGmo&ra4dadtslddwcBrsoetuay,cadgasJi–gtdncmcSh3toSpewueagaoeirpaecnfhruFntanLhoaevrl,neaueirisahhhninhldiaodafinrWulnditrppRsEgitlnWno.oLemrSsonrftoseiilailmwfDfut.sdemeeeNlslIoDs£etttdiotnnroIdteleusneTeNtsiehht.fnadAurveerNSuiemis1eanr–jocStadeaaxn.nnrgdmr“lresrcrOedoeorhgdiy“tinpi5nnoemecpfvTtekfnkpenpnreogoatn-fTBnprtdyeattWaBesicmre,ayrbnseacuetenoiatucnlosrmie.eRieorvainhhal:aehOtpRrertnslylealeeertoasOm-fsnoniaeYatAekcigesaincdmsiletebOteirhncdnuufwrLOjtnfnalaekhaifslcrdmgotaOasoedeaiplsshOeniaeehttygUihtnabedgyge.JDoainlnautthhyc-D”arnlafehKcdNihl1bseoWnKrbd2aeetWtosell2DoUdngoIelmUee4t/o9NwydSeeDt9scd“lIesLsoFrttEoohaTtinpoLFadlBeEiwdCNetil.mceiuChSuenreRelcnuOEsFharcsnds“irkEcwdOOfnventtekmadiEnOoaviTtnJpvgoEnSaegyDaBJgSscieuKedmsrcu2eeunlnsSleifntUnnoihTRS9ettlliiuhsOoFTlEnstislt.aCyrsscnnhs”lnfEyiockdo”tvOElneJSeetuakeicOSat5nftTi
New Alarms Fitted or Upgrade Existing Alarms
BURGLAR ALARMS
We fit new alarms - Wired or Wirelss Systems
*We can service and maintain your existing alarm*
CCTV
We fit high quality systems to maximise your security.
Access your CCTV via the Internet or mobile phone.
DOOR ENTRY
We fit a range of quality video and audio Intercoms
to suit your needs
We are a family run business with over 35 years experience
in home security and crime prevention
LIES APPDEOAN’LT BECOME A VICTIM Contact us:
01582 864138 / 01525 567028
For a FREE quote and consultation
ren who are www.maximumsecuritysystems.co.uk
mental ill health,
to further build our
Families Appeal in
of 51 Luton families Issue 21 • June / July 2017 9
practical help
that this is just the tip
ber of families referred
ow having to turn
r
”OneetaOa5nftig:nly:nDaoKd–s2ymlUou9ttoFeEtihCfcrhnaErkavieEoJsSekuerStyTmhlesnsy”t.ca:ahAonlelmldmtahelpotehatsorteaunsts
on, HomeStart
ent:
T
tsS”
ukitlsnys,beautiful
cafe serves
WIN WIN Tickets To Woodside Animal Farm
There’s so much to do this summer at Woodside Animal Farm
and we’ve got a Family Day Ticket to give away!
You can get up close and personal with the animals at Woodside To win all you have to do
Animal Farm. Feed them, pet them and even cuddle them during is tell us:
our 'Cuddly Encounters' hands on sessions. As well as our wide
range of farm, zoo and exotic animals there are tractor and trailer What animal features in the
rides, animal demonstrations, a mini fun fair, crazy golf and lots Woodside Animal Farm logo?
of outdoor play fun. For rainy days and when the kids just want
to run wild there’s the heated indoor soft play centre and cafe Email your answer ,
serving hot meals and snacks, a selection of rich and warming along with your name
coffees and a tempting range of delicious cakes and treats. Our and contact telephone
well stocked gift shop has a good range of gifts, toys and pocket
money treats. Our award winning poultry centre stocks a vast number to
range of livestock, feed and accessories, and our friendly helpful [email protected]
staff are on hand to give you all the advice you need!
The Vine Magazine - For competitions, news & offers, find us on Facebook!
Enter online and find t’s & c’s at www.thevinedirectory.co.uk
Issue 21 • June / July 2017 13
Food
7 Layer Bar
I am not sure I know any food writers who are more prolific
than Hannah Miles. Every time she is a guest on my
programme, she seems to have added another couple to
her list and she is now up to well over 30 books. Her latest
is called Traybakes (published by Lorenz Books) and,in it,
she shows how versatile traybake cakes can be.
This indulgent tray bake may actually be the Queen of
Traybakes. Loads of indulgent ingredients, bound
together by a can of condensed milk,to create a perfect
snack or lunchbox treat, especially for your children or
grandchildren. It’s also ideal, as traybakes often are, if you
need to rustle together a cake for the school fete or a cake sale at work.
This is a big treat bar, packed with flavour, fun… and calories!
How To Make Ingredients
Equipment: Food processor or blender, 35cm x 25cm For the Base:
deep baking tin, greased and lined 300g/ digestive biscuits or graham crackers
125g butter
Preheat the oven to Gas Mark 4/180C/350F.
For the topping:
Blitz the biscuits to fine crumbs. Melt the butter in a 200g chocolate chips
saucepan and pour into the crumbs. 100g fudge pieces or butterscotch chips
60g raisins
Stir well so that all the crumbs are coated in the butter. 100g pecans, coarsely chopped
Press the crumbs out in an even layer over the base of 150g flake sweetened
the tin using the back of a spoon. coconut (or desiccated)
60g toasted hazelnuts,
Sprinkle the chocolate chips over the biscuit base in a halved or roughly
layer. Sprinkle over the fudge pieces, raisins and pecans. chopped
Sprinkle over the coconut and hazelnuts. 398g can of condensed
milk
Drizzle with the condensed milk. Bake for 25 – 30 min-
utes until golden brown then leave to cool completely in
the tin.
Cut into 24 squares to serve. This layer cake will store in
an airtight container for up to 3 days - if it lasts that long!
Hear more recipes on Nick Coffer’s Weekend Kitchen every Sunday morning on BBC Three
Counties radio at 11am. You can also join Nick every weekday at midday for brilliant local guests
with great stories to tell and all the music you want for your early afternoon.
14 www.thevinemagazine.co.uk
Renault CAPTUR
Capture life
Test drive a Captur or Mégane and save an
extra £750* on selected models until 30 June
While stocks last
Renault CAPTUR All-New
Renault
PLUS 20% off selected MEGANE Hatch
accessory packs on Captur†
The official fuel consumption figures in mpg (I/100km) for the cars shown are: urban 42.2 (6.7)–47.1 (6); extra-urban 61.4
(4.6)–62.8 (4.5); combined 52.3 (5.4)–55.4 (5.1). The official CO2 emissions are 120–114g/km. Figures are obtained for
comparative purposes in accordance with EU legislation and may not reflect real-life driving results.
*An additional £750 contribution towards the purchase price. Retail customers only, on top of all other offers on selected Captur and Mégane
models from existing stock only. Offers eligible when ordered and registered between 16 May and 30 June 2017. †Certain accessory packs will
not be compatible with all Captur trim levels; speak to your dealer for details. Subject to availability. Participating dealers only. Terms & conditions
apply: see renault.co.uk/offers. Captur shown with optional metallic paint, and painted roof at an extra £894. All-New Megane Hatch shown with
optional metallic paint, available at £545.
GLYN HOPKIN – The NEW name for Renault in St Albans and surrounding areas
Lyon Way, St Albans, AL4 0LQ
Tel 01727 818453 www.glynhopkin.com/renault Book a test drive
Puzzles Answers on
page 30
RD Across
1. Bury (5) Down
4. Lower (7)
8. Great joy (7) 1. Unutterable (13)
9. Pick-me-up (5) 2. Commerce (5)
10. Excuse (4) 3. Destroy (4)
11. Awful (8) 4. Peril (6)
13. Stag (4) 5. Fatherly (8)
14. Labyrinth (4) 6. Exalt (7)
16. Harshness (8) 7. Reticence (13)
17. Pain (4) 12. Help (8)
20. Canal boat (5) 13.Varied (7)
21. Blow up (7) 15. Go to (6)
22. Corrected (7) 18. Arc (5)
23. Urge (5) 19. Applaud (4)
SUDOKU Fill in the grid so that every row, eve
and every 3x3 box contains the digi
Hard E
Step from the bottom to the top rung 928
by changing one letter at a time
7 56 1
SLING
4
6
1 92
9278 5
83 92
74
65
PLANE CROSSWORD
16 wwwwww.t.htheevvinienmemagaagzainzein.ceo..cuok.uk Across:
1. Bury (5)
4. Lower (7)
8. Great joy (7)
9. Pick-me-up (5)
r CaArnytJeoSbrws- L&a&aDrnHHgeeaaDnnocddreoyySmmcmraaoaannlrlStSaoeertrrvviiniscceegss Swan Ceramics
s. Reliable, Friendly For All Your Tiling Needs
& Trustworthy
• Ceramic Tiles • Natural Stone
Call me today for a free quote & advice
• 30 Years Experience
01582 263571
07729 962196 For A Free, No Obligation Quote
Burt Carter - Painter & Decorator Call Mark On: 07867 801423
For all of your decorating needs
ery column,
its 1 through 9. LEWIS BUILDING
PLASTERING SERVICES CONSULTANCY SERVICES
Extreme30 Years Experience In All Aspects Of Plastering
Render Specialist 101 Leighton Rd, Toddington
No Job Too Big Or Small! Drawings for extensions
& Conversions
250 High Street North to pass
Dunstable
Beds Local Authority requirements
LU6 1BE
C. LEWIS MCIOB
Phone : 01582 472526 Tel/Fax: 01525 874113
Mobile : 07958377463 Mob: 07870 326607
Email : [email protected] Email: [email protected]
.... 2A50ll WHiogrhkSFturelleytGNuoarrthanteed
G & J GROUNDWORKCONSLUPELWaTiRCnIiASntguNiBnGlCaUglYreIrL&ynSDEDI&NReGVcSIoCroEanSting DIGGER & DRIVER HIRE
0F1e5nDS8chr2eainw4Pg&7ai1Gnl70neC1eg5eLnoDes6eilgnshrrf8taooiv•nl/vAerR0MeldBlr,eT7asTsolxyiAd9oni•dpontin4tcdeegenPtk9snonnsaapOs1ntafi1hcove8sniW0nso1gr1k ALL SIZES DIGGERS & DUMPERS
Slabs • Steptos N•poaGJsoasbrdToeonSwmaalllls
s LoScNoaealwkATuAePtl/wahFatCoaxi. :rLoyEi0Wsts01CyIS5•7•M2a9r5CR3leDIl82Oeq7rBS64lauea21iia61ryn23neia2n:m4ggeents GRAB LORRIES ARRAGED
FRwEEwewEsmt.iMgamialo:abntc:ehdrsjigs•.lre0oRw07ueis81fn87e5@dr08new32tnl2woc66oer0r6skl8d0a..c57cvoo4am.7iulakble ALL AREAS COVERED
MOBILE: 07855 321 781
OFFICE: 01525 877234
EMAIL: [email protected]
D Issue 21 • June / July 2017 17
Money Matters By Martin Lewis
What’s More Important
Than A Will?
What’s more importantOne person develops dementia every three minutes. Many others
lose their faculties via strokes, accidents and more. The emotional
than a will?challenges this puts on you and your family are substantial, and
a lack of financial preparation exacerbates this. That’s why I am
a passionate believer that every grown up with assets should look
@martinslewis at gettingaLasting PowerofAttorney(LPA).
InmanywaysIconsider thistobe moreimportant However it needs to be set up when you have mental
thanawill.Diewill-lessandyoudon’t choose where
yllayoooogcsuueokrreoyacddosausdrweero.tifwlslagnccuho-let–eaievptsehlynwatssi’etstheonopwouptwtignawog.LmoyPdosAue(.f,rmoyfroaem/fuurwilllaiylshlsspee)al.tpysYioncengotuifdflodoyriobnueg cnaopwa”citisy,asomtihstiankkein-go,n“ctheayto’sunkont ofowr tuhsetroe’swaonrrisysaubeoitut
Thisisn’tanagethingeither.I’m44andIhaveone,
eventhoughtothebest ofmyknowledge, Ihave no maybetoolate.
ftohogaryensfeooenraepbuilneshissiisnxugoettshh.iYesr,eset,hswpaevhceeianolnlIye’v,aessopnooIlwmledathkoeencnotohsitasphloeassl-s
rbTa•eneoTgdeienshintneercerNoidcnuuoogrcrasaetgthdeLehfPrmarnAosomIrirbnee£elpEae1enn1nodg0plc£alteuno1dt1t£o5ta8.ton2aYdk.£oeIWun8tha2cSlia.cesnosutfhpliana,nstdhdrteehitcc’eseonf£sott7lryo5mfs
dropped. atwww.gov.uk.However,thoseonsomeformsof
benefits maybeable tohavethefeereducedorwiped.
It’sworthrememberingpeoplecanlosetheirfaculties
veryquickly.Andwhentheirfamilyare alreadyhaving •You can do it yourself, but if things are
ttvhoiaectoohmnelyeCwtoouayrtettrohmfeysPacrnaondtetdcatekiaoelncw.hiathrgtehoatf-ywouitrhofiuntanacLePsAis,
Peopleoftensaythisisanightmare,asJudithtweete d: btaTofuhfrcsaeoitinorgmseodsalsprrdaealfsestctsxaooen,mntsdge.paeflreodtxrhw,yseaouylucpth–.oawdsooorvatehLrscPeoAansisspidrteoorpigneegrttyiafosyoroliucri-
“@MartinSLewisTook12mths togoviaCourtof
Protectionformymum. Cost £3,000.”
Sohere’smykeyLPAfacts…
•Youstayincontrol.
tlbWirkuueittshtOaenadNiLnfLrasiYsuetnriiandfngaocPnerodrpweowlaelhitrcievyonefinytAoocutattasolkeorensteheceyocanwyptoorauorcslinttoyoh.fmaIytpi’osnpuaaertnebasia.stsets,
18www.thevinemagazine.co.uk
Money Matters By Martin Lewis
It will typically cost around £500 – get a quote first. You can also set up an ‘advance decision’ (known as a
To find a solicitor you can use the Law Society Tool living will) where you can refuse certain medical treat-
at solicitors.lawsociety.org.uk, or www.sfe.legal, is a ments if you lose capacity in future. These are free to
network of over 1,000 solicitors specialising in issues make and needn’t go via a solicitor.
affecting older people. See www.ageuk.org.uk for full help.
However, those with simple affairs used to filling in
forms carefully should be able to apply for a LPA Martin Lewis is the Founder and Chair of MoneySavingExpert.com.
without help. To join the 12 million people who get his free Money Tips weekly
email, go to www.moneysavingexpert.com/latesttip
Or a decent half way house is to use www.which. Steve Harris
co.uk legal service where you fill in a questionnaire, to
generate the LPA form, then crucially it’s checked by a Property Maintenance
qualified paralegal. The standard charge for this from
Which? is £139, but before 31 May via my site www. City & Guilds Qualified
mse.me/LPA#whichdeal there’s a link to do it at half Trustworthy & Friendly
price (£79). Of course as with solicitors, you’ll still
need to pay the Government registration fee. • Carpentry
If you need help but have a low income, little savings • Painting & Decorating
and are over 70, disabled, have a disabled child or are a • Kitchens
single parent, you may be able to get help through the • Flooring
Civil Legal Advice scheme at www.gov.uk/civil-legal- • Windows
advice. If not your local Citizens Advice office may be
able to help. Tel: 01582 523076
07835 091232
• Sort future medical care and your (living)
will too. Email: [email protected]
For obvious reasons I’ve focused on the financial No Job Too Small
LPA, but you can also set up a health and welfare LPA
to give loved ones authority over your treatment. You
have to fill out a separate form for this and it will cost
you a further £79 if you sign up before 31 May again
via www.gov.uk.
Issue 21 • June / July 2017 19
Friendly staff, honest work, Experts in all aspects of
highly recommended...
- customer review Roofing & General
Maintenance
• Competent Roofer • All Repair Work ✓ Tiling ✓ Flat Roofing
Registered Undertaken ✓ Slating ✓ Rubber Roofing
✓ Gutters & ✓ Built-Up Felt
• Trust a Trader & • Insurance Backed
EDS Approved Guarantee Available Down Pipes Roofing
✓ Lead Work ✓ Velux Windows
• Free Estimates • Friendly Service ✓ Chimney Repairs ✓ Skylights
✓ Fascias & Soffits ✓ Sun Tunnels
• Repairs & New Works • Approved Installer of
Undertaken Fascias & Soffits.
• All New Work Guaranteed • 30 Year Colour Guarantee
Tel: 01525 600150 TRADER • PLEASE CHEC K OUR REVIEWS ON TRUSTA TRADER • PLEASE CHEC
01582 671185
K OUR REVIEWS ON TRUST A
Mob: 07801 315140
Email: [email protected]
10110%0%%OOFOFFFFAFALLALLLEELLLEEELCCETTCRRITICCRAIACLLAWWLOWORRKOKRGJSmithRoofingA5Flyer2016LB.indd 1
Web: www.gjsmithroofing.com
JUST QUOTE CODE SJ1207 31/08/2016 13:52
JUST QUOTE CODE SJ1207
JUST QUOTE CODE SJ120F7ree quotations, no obligatio
ADEFFEADmrrmononeemmaeeeaemrmreeqgqgDAEssueeeumetotoninyioyncmcteacootacoyrmoauetyugritrWsoceCiWectCoanoaoinyncnosornmco,ksmtoryunrt,mk–ruromWncu–eCsdoaotsreaodocnbtoryrmaiclakbtioyiglrmalr–uoailgnesdtriitaroganctnyhiiigoastolhnrtsnig
EAlnAEeAEldnclendeectdcrerttrertitcoriroctsinocsn snEOMCmoffioanbcitlei:EMCOale:jmcoffiaOMCEo0:tnamm0bo1cffiJotiie5a7lanla:ebec:mc87jtis:ie0altal:27@0eem:1Jcja17:50asa3tem07m861ndJ4sa7752e@9di3emr17s88e3eas16d72er@n4c21Kt9i1std3r5o3a38eeoe6dn1n14ecrnK19i2pedtt3r5i:eo3n8eloeee11gncnprK12ceitt:n5tyeol3gowreoe1ninupccyweito:nsrwulgw.iecciwc.sroyae.to.icdrrnuueoidcdk.uwsuep.uki.rcrpte.ood.nueukpl.ectrics.co.uk
wwww.wawnd.aenrdtoernteolneecltercitcrsic.cso.c.ou.kuk
Issue 21 • June / July 2017 21
Star Hollywood
In A
Blockbuster
By Haydon Littlewood, Personal trainer at www.bodychange4u.co.uk
“I would do anything to be thinner!” biscuit or to look amazing on the beach?” A biscuit will
give you 10 seconds of satisfaction but achieving your
I hear this phrase a lot from clients and I always reply goal will give you a lifetime of happiness!
with the same question. You need to re-train the brain and start thinking differ-
“If you were offered £10million to star in a Hollywood ently; breaking old habits and building new ones. This
blockbuster but you had to get down to a size 8, could is actually easier than you think! Have you ever driven
you do it?” The answer I usually get is “of course I abroad? How weird does it feel when you drive on the
would!” opposite side of the road? The mirror in the wrong
So then I say “what about £5m?” and I get the same an- place, the gearstick in the opposite hand and rounda-
swer “of course I would!” then I say “£1m?” and, again, bouts are a nightmare! But we survive. Why? Well our
I get a yes. "What about £500k?” might get a 'mmm instinct kicks in and you then start concentrating harder.
maybe'. “Would you lose the weight for £100?” and at By the end of the first week it feels more natural and
this point I tend to get a NO! you think less about what you are doing. This is the
The point of this type of questioning is to show just same when changing your eating habits and your lifestyle
how much you really want something and, more impor- choices. It will feel weird and awkward to begin with but
tantly, the amount of work you are prepared to put in to slowly you will create new habits and patterns and this
achieve it. When you want to lose weight or get fit you will become the norm. You will have slips along the way
need to ask yourself “How much do I want this realisti- but be consistent and you will create new habits which in
cally? How much effort am I prepared to put in? What turn will help you to successfully achieve your goal. And
am I prepared to sacrifice?” If you answered no to the remember; you didn’t put weight on overnight so don’t
question about the film for £100 then you really don’t expect to lose it overnight. Be patient.
want it enough and really aren’t prepared to make the Try it for yourself tomorrow and set yourself the chal-
necessary sacrifices. lenge of leaving the last bite of everything you eat. For
example, the last spoon of cornflakes? Throw it in the
We all have our own reasons for wanting to reduce fat bin! The last bite of a sandwich? Bin it! The last mouth-
and get fit. The most common reasons I hear are: ful of pasta? Ditch it! Because we are programmed to
• Look good in swimwear/beach holiday clean our plates at meal times this can be harder than you
• Told to lose weight by a doctor for health reasons think! But with repetition this can become a new habit
(lower cholesterol/reduce joint pain/be eligible for IVF and think of how all those calories will add up over the
• Achieve a target (race/challenge etc.) period of a month!
If these are familiar targets for you, then you need to A personal trainer will offer you the support and guid-
treat them like a £10m film opportunity. When you are ance to help you through any changes in lifestyle and
confronted by temptations you need to ask yourself ei- will be on hand to give you the necessary support and
ther out loud or in your head “what do I want more, this encouragement at those times when it feels like you’ve
had enough. A good personal trainer isn’t just about
meeting you and taking you to the gym; a great personal
trainer will call/text you everyday, set you challenges,
devise food plans and offer you advice on a variety of
subjects. You should be paying for a package not just the
time spent with your PT.
22 www.thevinemagazine.co.uk
Have A Great-Looking Garden All Year Round
Stockists and installers of…
p Artificial Grass
p Composite: toWtparouarpebdheleioncaunsed
• Fencing
• Decking
• Cladding
p And More
Phone now on 0800 321 3452
Unit 42 Icknield Way Business Park, Tring Road, DUNSTABLE, LU6 2JX
Recycling today for tomorrow...
w9a4sis%terewocefyacclloel ltdlheect
We can help you!!
The Complete Waste Whatever kind of treatment you’re looking for we offer it in a warm and
Management Service friendly atmosphere. We offer the following:-
● Qualified Foot Health Practitioner SPECIAL OFFER
● Routine Nail Care
● Cracked heels and Dry Skin
● Corns and Callus
● Ingrown toenails
Local Man & Van Rubbish Nationwide Sweeper www.foot-right.co.uk
Skip Hire Clearance Grab Hire Hire
Call us today on: 01442 210047
or email: [email protected]
www.wasteking.co.uk “Your feet ...... in great hands”
Unit 25, Airfield Industrial Estate, Long Marston, Cheddington HP23 4QR
Waste carrier CBDU93920 - Transfer Site License 402839
Issue 21 • June / July 2017 23
and its alternatives
Some people would have you Now that full fat milk has been exonerated,
believe that there is only one authorities are openly recommending that
milk, and that is from a cow. children should be drinking full fat milk, at
But with the prevalence of IBS least up to a certain age. Research also shows
(irritable Bowel Syndrome), (pass the smelling salts!) that adults trying to
lactose intolerance and lose weight tend to do better if they include
allergies, there is a lot of some full fat milk and yoghurt in their diet.
confusion about milk. Of course, a lot of this is down to the fact
that full fat milk leaves us feeling fuller for
Dairy milk has been a subject of hysteria longer, and that keeps us away from the
for a while now - it has divided the nation biscuit tin.
for decades. In the white corner we have
the virtuous 1%-ters who only ever touch
skimmed milk, while in the red corner
defenders of full fat milk have been saying
that it cannot be so bad if it comes straight
from the cow at 4%, as nature intended. And
stuck in the middle are the semi-skimmers,
waiting to see who is right.
Well, now we know. The full fat milk
defenders have been right all along,
and finally the nation is listening.
The truth is that skimmed, semi-skimmed
or full fat, milk is a low fat food! Even full
fat milk has only 4% fat, and in the world of
nutrition anything below 10% is considered
low fat. So unless you are drinking gallons
of it, the fat amount is small and the biggest
difference between the red top, green top and
blue top milk is the taste. Compare this with
the fat content of a sausage or a HobNob,
and you will see what I mean.
24 www.thevinemagazine.co.uk
Apart from the weight management benefits, Soya milk remains the most popular dairy
milk is a great source of calcium and vitamin milk substitute. It is made from soya beans so
D, with both nutrients playing an important it’s actually a processed food but that doesn’t
role in maintaining strong bones and teeth. make it unhealthy, far from it - eating soya
It’s worth remembering that vitamin D is fat has been shown to benefit health in a number
soluble – it means that we absorb more of of ways. Just choose the non-sweetened
it when we ingest it with fat, as nature has variety, as many options have sugar added for
conveniently arranged it in the form of full improved flavour.
fat milk.
Other alternatives include almond
“milk is a great milk with its subtle nutty flavour
source of calcium of almonds; the naturally sweet rice
and vitamin D” milk, and also hemp milk with its
high content of Omega 3 - all have
become less expensive due to popular
demand.
Recently, coconut milk has made
something of a comeback, not least
for its health benefits. It is packed with
Having said that, some people suffer from nutrients and although it is a little high in
a number of unpleasant symptoms due to fat, it is the good kind so it provides a great
genuine lactose intolerance as they lack the addition to anyone’s diet, lactose intolerant
enzyme called lactase (lactase breaks down or not. The unique taste of coconut will
the natural sugar in dairy milk). While only easily convince even the more reluctant
a fraction of the UK population is affected, palate, just ask anyone holding a glass of
dairy intolerance is much more prevalent piña colada!
among the natives in Asia, Africa and South
America.
If you are among the unlucky lactose
intolerant population, or simply don’t like
the taste of dairy milk, things have come
a long way since the powdery taste of
soya milk, and there is a great of choice
of other alternatives.
Take goat’s milk, for instance. People
with lactose intolerance are often able to
drink it with no adverse effects. Okay, so
the flavour is a little stronger than cow’s
milk and it may take some getting used
to, but it’s like learning to love olives or
avocado – you may not like it the first
time, but if you try again (and again),
you’ll most likely grow to like it.
Issue 21 • June / July 2017 25
Home&Garden Flor
Re-Uph
By Floral Chicken Recy
Reupho
Bespoke Footstools, Individ
Headboards
Manufactured 07
Stuart@
Recycling and upcycling may have taken on a new impetus over the last few years. One area that has been www.F
doing this for years though is the Upholsterer. If you have a sentimental piece or just something that has
become a bit tired you could get it rebuilt in a way that gives you a one of a kind piece of furniture that could 2
last for years to come. Bu
Here we show two examples of chairs that have been given a new
life instead of becoming landfill.
Depending on the chair and the state of repair will dictate what can
be reused. Your upholsterer can help in understanding this as well
as advising on the types of fabrics that will give you a good look,
meet the relevant regulations for fire safety and give you the level of
durability you want for the use any chair is going to get.
The Parker Knoll coating to enhance the grain and protect
chair is a classic the wood. This is a more on trend look.
model that has The wings have been removed and a new
been in production upholstery applied to replace the loose
for many years. In cushion seat with a built in seat and a
fact, you can still more cushioned back than the chair origi-
get it today. This nally had. Of course you do not need to
particular chair was from 1981 and have the same fabric all over the chair and
was purchased through auction for on this chair the denim style fabric is a
a very small amount. Although the much harder wearing fabric than the com-
chair looks very tired, it’s really just plementary floral design on the side and
the fabric which is ready for the rubbish rear of the chair. This is a classic chair
tip, the frame and springs are in good given a modern update that is individual-
order and very suitable to be reused. ised and not something available from the
The legs have been sanded back to the original manufacturers. The chair is now
natural beech colour and given a new good for another 20 or 30 years.
The second chair was a sentimental family piece that Floral Chicken
had been a great grandmother’s that had been known
to be in the family since at least 1900. However, it had Bespoke Footstools, Re-Upholstery Service Replacement c
become very sad and wobbly. Due to the family connec- Headboards Cushions, Drop
tion the owner did not wish to throw it away. Following Manufactured &
a full restoration to ensure all the parts where in a fit Recycled, Upcycled, Window Seat
state and regluing the whole frame back together to en- Reupholstered Furniture &
sure it was solid again new upholstery has been applied. Individually crafted items
This now gives more padding that originally while still
keeping a nod to the original style and age of the chair 07796 533585
with a Rennie Mackintosh tapestry fabric. Although [email protected]
this fabric is more delicate and not suitable for heavier
continued use the chair is planned for only occasional
use but wanted due to the sentiment involved.
26 www.thevinemagazine.co.uk
L.A. Alterations
Experienced seamstress
Alterations & repairs to
clothing & curtains
Please call Louise for a quote or advice
Floral Chicken 07722081455
Re-UpholsFteloryrSaelrvCicheicken
Find me on Facebook
Re&-Upholstery Service
Recycled, Upcycled, &
ReupholsteredRFeucryncilteudre, U&pcycled,
IndividuallyRecurapfhteodlstiteermedsFurniture &
Bespoke Footstools, Individually crafted iteRmesplacement covers,
loral ChickenMHaenaudfbaocBtauerrdsepsHdoekaedFboooatrSsdttusoaor0lts@7, 7f9lo6ra5lc3h30ic57k8e7n59.6co5m33585CuWshiinodnosw, DCSruReoasephtpsIilon,anacSnese,mdaDtersnotpcIonvSeeras,ts
FManufacturedFloral Chickenwww.FloralChicken.com
[email protected] moreW! indow Seats, and
mamrka@[email protected] Ask more!
2 Cavawlrwy Pwa.tFhloralChicken.comRe-UpholsJutset rAysk Service
Re-Upholstery Service 01582 674829RecycledBu,ckAUBiynelpgesMhspcbaHoumayerknByacPeuu2adclfrC&FkAebkaaioynocdvlogeatahsu,ltrrbasyrdRumtePsrodyaePotahulrsk,phoRSIlentsuudtRapievre0hitrcdo@7eyul7csdfatl9leloel6dyrrae,&c5ldUrc3ahpFf3iuctc5yerkncd8elien5tiwtud.pepcGrG,rormoeoeawewiampswsis&pssseaBuwseariHBrowG-uerisflir os&-elwe.ucs,eaflipssysarlawuc,s,elhelCilsyrfi.ntsairpouRnur,eiblrdhWlilnegsevsfisenuipmhopoonr&iigrmdDinscllaoegiaaserdCelibnbrciioesnro&ptoreisDtcslmnypwo,ihrsmag,rinCkgeD,snoriheSea,crptorftgregmertncnoieie,ypohata,rntpdS!aaaiklmteecenlgpishsIenrnorrnna,sgtgemvrv&as,adaiSpdptes.cnnoSeaaayirledndrreasilsglpcrnatgg,otrsrriess,on.gasvetuambitaiinpneo ksscoensldrpayi.etnkndnrtsaiosoarcmtgelesllibearr,n.rplvameigts,linuonmecimsn.drpnsutngarbaisona.niklencldlb5agrp6lv3el0iuomc34imnnsgabin.nincdg
01582 674829Furniture & Individually craftedwwitwe.mFlosralChicken.com inc. poJuwsteArs-kflushing
BeFsplookreaFlooCtshtoioclsk, Heenadboards
2 Cavalry Path www.Dplruipmpbiinnggantadpgass.org.uk 563
RceoMv-eUarnpsu,hfCaoucltssuhtreieodrny,sR,SDeeprrolavpcicIenemSeenatts Buckingham Park & internal plumbing issues
Aylesbury
tstools, RIneduWRipvehiidncouy0dlscao7tlleelw7ydrJe9,cS&udrU6aseFpftautc5Aetyrsd3nsc,kli3ietat.ude.n5.r,mde8s&m5ore! Also solar thermal repairs & servicing
rds SwStwtuuwwaawrw0tr2.@t7F.@ClF7ofall9rovfoala6rollarCr5alyhrc3ahiPlcC3aikcltc5ekhhne8hn.i5cci.cockomkmeenn..ccooCmuRmWsehpiniloadncJousemw,smDtoSerAreeonsa!ptktscI,noavSneedrast,s Inc. LPG and park homes
ured
01582 674829
[email protected]
Issue 21 • June / July 2017 27
haensbmeGIanmlaleTarsddhteeeoniunttsoidaen
fyocauEclavmcnenab,etnhmae ausbmdneaoilwnllettsotihanonuodtoslaiedsiessopface
harcadlmd, aabyolthaotle wwheorerykou can
unwind after a hard day at work
rtain during theor entertain during the summer
er evenings.evenings.
Make The Most Of A Small Garden
yAe"Iu"frYKfnoaoloyeuslamueounpnnucreaTieetenTheVsdiamdiitmstvgma,ctpeakowhlereea,pdmeie"tslethigamsnnaeentyiertaanrodcslesgvluasohitgrsriem.neeaxisgfrn.epudwdelaeilirtdyhnvtvoi,tduioct-eitTnypcooltHeohodalunahaoianugrdtccenkreeitiriodn.nnheyb"ywoggceoioangrruyraupee'geotaatseapuwshtwmrnheur,iaandtahbtnwyklhaeylostieoylsuttatlatooousdnambeu'ddtvbmlnu'aesaelesle.kraeapnyfekanaueoetwtldellhftlaidiehneftsdoshegbpdmuteaepoihrscacnvlteaalecdaelmnu,hnrgowtsacasteiofhehrrusdeialteens"iCigtsttSnnruhthYameortrerraouoealduao-lculslaebltultipm'hnnlkustrlled.reraawnweeWnlwiweel,hnotespofshiin,dotcolrahfno'hrltuotldmete'ttnrs.cahslbiaetssmneaenemenecydsovobodakaretllenyerolorp.edg"pguiebmrparrraeesurenpiedpnnrsndofeeoeesarncdhcttpsasaeti.tnvrmnlosepedttva.ratialIuspolleceprl-nientakr
a"bibntCiegtiaeonlernlge.nssBofitduiuenesagsgrrhyi.aifntnHoigmta'blsveiensew.dagoboirlfteohidttoh'scalsgveiotainniongnlgianatlenoasdwbantenodst"itnooeAealblmolnoeolweigkenrvytecehoalortuteoshrreusedebgslhefstcaptstaahuouceemsemeieesynislonicpfutoeaorucsteerihzay.eegeG.sesapwypaoascunetliwg"inHkoineaoigtdttehoirngl.iuyrgeshgeetanertdvhbeeearncgckoirtgelrogeoniuvusrensbbdyeitcwgasiituvtrhsiunecfgoetuviltireaeangien.
iaablnyelasdawwbisnelper'mostsonoewomoetfoorwtaha.rleColuocalnnfipdtyphoiitinusa,gmntshd?aenIenfaosget-houevfroera"gabrAieveyeaobainlnedsnteo,dnwasohedfileoeonfplsoieenonlyfkianipnniltgadyn.fetrneodcmloosnaenedocsappneancesUsJdutoissleeltsbbcneoe'tcleomafuufeersacemntiyvooyerou.e"uhsapalvawerainaygsslmhyaaavlnledgtaoitrdgceoann
tdpS"i"ittmcnthohWLoeiyafoee,avntosfohstheiivpsointtrerneue.akkgeinngtmgonhaoioabietotpsurronssrdyotledfutoietr,rkterhntuhtvwefcaheraeelknihyecssspitp.eenhtslwlt,tooguaahhw.htdcn"ebineeethreior.gseteyYthtfofbhhitaoounheeeturcderwbwamymiiout'iagrl'osunslaegesytbteggttwestrnohpotaehmieevpneseoerigodrtlpiesooiltnerr-moFawTosg"oamDsafrfoifiatrletcslcanodyshwhahlteoynelelaanmnu'ygtlpsdtaaur'amraoistbrrnrephregieldasngeelie.nlhonemtlTtyonsf.tkhoeoataamenyatlusnrlhoteepguodpatusarortarlermeaieclnbdasbnsaosdeaeltnaapukcsnir'niraatesmeagomuchtrybihpsreoaooaeeeovfuluuftilireyltbstrnltseo.ioaa"tpesnruonnmuagt'aotyvnchsaiteeadatmhll,nlnaogwisdnurnoaiicgetgythhssa"arro"bWolfsioieqlDTkrfnllflariouelehnowt(eawd,efeagnctoatwrs,tw'rtitrtinoireeavlsmoaiffrrtregyelofaeahaoyesloclrsoptalrueotcfultiritsanahvfhg'masnlnaetalrrcoctagteeaeopselaeolen,ynoltovaohodaegwafnedeursanurcec.rwraydhpdrhAddtgsaeiohetywladtsolernieoroisnscifgdr.tuwbgt)nhteuaheconhryfwcepar.aeoaanllhassauauktpaimrstusnytlosetarearlesanotbelkhnhftoateesedeomk.ea"st
gy"2oAa8ruldwreapnywasrtiamowthatweokreb.ttthehhaaenetsvtneheaiextnitbnetogomtattorhaemeaghboaoifguzgtsiheener.e.col"o.Tutaskllopflafonltisagder.awyoureyeupandoutidnertfhueltiinnibersitnogfinggalrigdhentsina."ndit'swon-
Out & About the last Saturday of each month at anything from adventure sports to
Luton Central Library (3rd Floor) performing arts, travel and taking
SAPPHIRE SOCIAL CLUB For more information visit part in community action projects.
www.lutonculture.com/luton-libraries Girlguiding is the leading charity for
Sapphire Social Club - this social or call 01582 547 418 girls and young women in the UK.
club caters for the unattached aged By volunteering with us, you can
50+. We meet weekly in Hitchin BREAKOUT SOCIAL CLUB help us create amazing opportuni-
and organize a variety of social ties for thousands of girls around
events every month. No joining We are a club for the over forty the UK.
fee for the first two months. Come fives, not a singles club but a social
along and meet new friends. club for people who enjoy going FLEXERCISE EXERCISE
Tel Joyce 07952 678021 or Ian out but are on their own, where
07900 890583 for details they can meet like-minded people, Thursday 2 -3 £3.50
www.sapphiresocialsinglesclub.co.uk with a varied monthly programme Warden Hill Community Centre
covering Disco’s, Pub lunch’s, walks, Gentle Exercise for Older People
KNIT AND NATTER GROUP parties and much, much more, we - Men and Women -With No jump-
meet once a week in the front bar at ing about or running around, the
Every Tuesday, 10am-12pm the Conservative Club, High street class includes low impact and every
Join our friendly Knit and Natter North Dunstable exercise you will be faced with will
group every Tuesday at Lewsey For more information please contact have a specific benefit to your body
Library. Sandy on 07813 262556 and your unique make up.
Come and share your experience, The class is aimed at improving and
or get some great hints and tips, and WARDEN AFTERNOON CLUB maintaining flexibility and balance,
meet new people. thus enabling you to be confident
Tea and biscuits provided. Meets every Tuesday 2 - 4pm and enjoy life.
The group is always looking for Warden Hill Community Centre For more info Tel Lorraine
donations of wool; knitting needles (rear of the Warden Tavern) 07868 030540
etc. so if you have anything you no We are a recently established group
longer need, just drop it off at the of friendly ladies and gentlemen BEDFORDSHIRE GUILD OF
library.Free, donations welcome who meet weekly for companion- WEAVERS, SPINNERS & DYERS.
ship, activities and refreshments. If
LUTON WRITERS’ CLUB you would like some company, or A friendly group of textile crafts
know someone who would benefit people who meet in
Every other thursdayat 5.30pm from joining us, please come along Flitwick Village Hall twice a month.
Luton Central Library any Tuesday - everyone is very First Tuesday evening of each month
A free club, open to those inter- welcome. 7.30 - 9-30 and
ested in writing. For more information contact Sue Third Saturday, all day, 10.30 to 4.30.
on 07706895444 or We welcome visitors interested in
THE PARKSIDE SINGERS email [email protected] seeing what we do, so please pay a
visit to our website
Do you enjoy singing? 5TH STOPSLEY GUIDES www.bedsguildwsd.blogspot.co.uk
The Parkside Singers is a lively
mixed choir, singing four-part Guides is our section for girls aged WIDOWS & WIDOWERS CLUB
harmony music including pop, songs 10 to 14.
from musicals and some choral By becoming part of a worldwide We are an active Widows and
favourites such as Ave Verum and community of girls who learn Widowers club.
The Lords Prayer. together and share skills and experi- Meetings are held locally and new
Call Claire on 01525 753110. ences, Guides have the chance to get members are always welcome.
out there and do something really If you would like to make new
LUTON POETRY SOCIETY different. friends and join in our many out-
Members take part in a wide range ings and activities please ring Jenny
Last Saturday of every month, of exciting activities at their regular 01582 672766 or Val 01582 659717
2-4pm at Luton Central Library. meetings, and at special events or or email Carol at
£3, free for Poetry Society member holidays. Girls can get involved in [email protected]
(£20 annual membership)
Our meetings usually take place on
Issue 21 • June / July 2017 29
BedfordCsohffeierBer’esak Solutions AnswersSudoku solutions: Step On It
Night SkyCrossword solutions
Hard
June & JuA1lcyInrot2esr0s;1:47Depress; 8 Elation;
9 Tonic; 10 Plea; 11 Terrible; SLING
13 Deer; 14 Maze; SLANG
16 Severity; 17 Ache; SLANT
PLANT
Looking Up!20 Barge; 21 Enlarge; PLANK
22 Emended; 23 Press. PLANE
Down: CrosExtreme sword
1 Inexpressible; 2 Trade;
tSMheeiecsSrmoaa-tMlulersonto’fsnu:lElAnmtco1o0ou1136pn52nmERotABnufeotneintrtnfoeh;rbnwiee4Fldeniry;Dt;ide1dha7;a8an1rtSyg3Chree9iueDcsrtr;rehivev5seteJi;Pouvrs1evnaee9nte;ereCrsnlsaa;pl;. Across:
the south-eastern horizon. It’ll be some 1 Inter 4 Depress 8 Elation 9 Tonic 10 Plea 11 Terrible
406,000 kilometres away making it the most 13 Deer 14 Maze 16 Severity 17 Ache 20 Barge
distant full moon of 2017. Half an hour later 21 Enlarge 22 Emended 23 Press
you should notice a bright star-like object Down:
hanging in the sky just below the moon. 1 Inexpressible 2 Trade 3 Ruin 4 Danger 5 Paternal
This is Saturn. In contrast to the distant 6 Ennoble 7 Secretiveness 12 Befriend 13 Diverse
micro-moon Saturn on 9 June is almost at its 15 Attend 18 Curve 19 Clap
closest point to Earth for the year at a mere
1353 million kilometres away.
Look North for Electric Blue Night 10% Discount
Clouds: June and July are the best months
of the year to seek out the ghostly electric- on any product or
blue braids of light from noctilucent cloud service when quoting
displays. These extremely high-level ice this reference: LOS
cloud formations generally occur over the
northern horizon between 11pm - 2am. They “pchelpcentre
are best seen with the naked eye or with provided a very good,
binoculars. Noctilucent clouds are notori-
ously difficult to predict, so keep your eye on fast & professional
the sky to your north on any clear night this service”
summer to catch their eerie glow.
Spot the Milky Way from the Chilterns Bill Watts, Renault Trucks UK Ltd
at Midnight: From 14th July until 27th July – IT Manager
this year we have a great opportunity to spot
the dim dusty starlight of the Milky Way Visit our store for a wide variety
from the Chiltern Hills. Find a spot away of services to the home and business
from streetlights and look up. You should
see a giant faint band of speckled dim light user including:
arching overhead from north to south.
• Laptop & Desktop Repairs
• Virus Removal • Data Recovery
• Screen Repairs
• Home / Office Visits
PC Help Centre twitter.com/pchelpcentre
By Seb Jay
Image Credit: Jason Jenkins
Dark Sky Telescope Hire
www.darkskytelescopehire.co.uk
30 www.thevinemagazine.co.uk
Nurseries Get
10%
Commission
From All Sales
COMING SOON
To A Nursery
Near You!
Also Available For Parties
Is your nursery or playgroup looking for a
fun alternative to class photographs?
Kids Klub offers children the chance to
star in their own adventure movie!
We’ll transport your little stars on a magical
journey, producing DVD’s, photo’s &
keepsakes for loved ones to cherish!
For more information visit our website IssuTee2l1:•0Ju1n5e 2/ J5uly823081773319
www.kids-klub.co.uk
For exclusive offers find us on Facebook!
www.facebook.com/KidsKlubLuton
FREE
VALUFARTEIEON
VALUATION
ddooRaRealelllalltatxhxh.e.eLLwewettooururkkss
We’llWtae’kllettahkee sthtreesstsreosustoouftmofomvionvginhgohuosues,ef,rofrmombebgeigninnnininggtotoeenndd
pAWrtohHfeeatsAWphrsrretiiohsorHfeonebatnsahursrleyMiisortineonbuagnaurmrlyMoatirneywu,agsrimewrloalllerymiwn,sfiewgaolllkclejmieuunfssgaostkucojeguurnessestptuoygerinoeneouptyptreioolnmoeuuptrcoaolhmesvuecaowahsvngeedoawllnegewadsolsleeawa’spslselras’otpslmalprsokteomaeprokeotcetiroehatctisrlehayeasrlyaeonasafdonspifdtoopi.touos.urssrisbiblele..
BookByoooukr yFoRuEr EFRVEaEluVaatluioanti.oCna.llCuasll ouns o0n105185284214010040444
BushmBuesahdmSehaodpSphionpgpCinegnCtreen,tHrea,nHcaoncckoDckriDveri,vLeu, Ltounto,nB,eBdesd.sL.ULU2277SFSF
SpeakSpteoaukstoinubsriannbcrhantochdatoydoaryvoisrivt ihsiat rhriasrorinsomnumrruaryra.cyo.c.ou.kuk
t of Part of BuildingBuSioldcinegtySocBieutyying B&uSyienlglin&gSelliLnegttingLe&ttiRnegn&tinRgentinMg ortMgaogrtegsa&geSsa&viSnagvsings
not HaItrrisisnoontMHaurrrriasoy’ns Mpoulrircayyt’sopaoclciceypttoinasctcreupcttionsntsruwcthioenres wthheerreeitshaerSeoisleaASgoelencAygAengcryeeAmgreenetmiennetxinisteexniscte,nucen,tiulntthilatthat LILTIT22333300
reemenAt ghraesemexepnitrehdasoerxipsitreedrmoirniastteedrm. inated.
MowurnreaHAdyawrLsruihimsobolisnltyiedMdoiaw,urrrynereagodyifsLstNeuimorbetisttdieidndiigan,rhryEeangomigfsltNaPeonrroetdtdpinaeignnrthdyEanWSmgealraPlvenriocsdpenaesunrLtmdyimWbSeieatrrelved3ics.1en9su0Lmi3mb7ie6tre.d3R.1e9g0is3t7e6re. dReOgfisfitceere: dNOotftfiinceg:hNaomttiHngohuasme, 3HoFuuslefo, r3thFuSltforerteht,SNtroetetti,nNgohtatimng, hNaGm1, N3DGL1.3DL. SASLAELSES
son
holly