The Bulletin Issue #11

Issue #11 American Division High School Newsletter

May 2018

High School’s Honor Roll

A MISR LANGUAGE SCHOOLS PUBLICATION Congratulations to the Highest
GPAs of 2017-2018
Editorial Staff
Grade 9A:
EZZ ELDIN AHMED, G10 Emanuel Melad Ayad
Menna Allah Elsharkawy
If you don’t already know, my name Catherine Bassem Gorgi
is Ezz, I’m a 10th grader, and this Ahmed Ibraheem Grade 9B:
has been my second year at MLS as Zeina Mohamed Hamed
well as on the Bulletin Reporters Aya Khaled El Hodaiby
Desk. I’ve honestly enjoyed Rawan Hassan Ahmed
working with Mrs. Injy El-Kashef Grade 10A:
and the journalism team to provide Nadine Waheed
this magazine to look back to. What inspires us to Jannatalah Sherif
generate this publication isn’t free time – we’re Mario Ramzi Stino
all actually quite busy people – but rather the goal Yasmine Osama Zakaria
to create memories for all students and staff to Mariam Mohamed Khodir
remember, not just by putting words and pictures Mohamed Hassan
together, but by capturing the moments that leave Farrah Farid Stino
their imprints on us. We hope our work helps this Ahmed Ayman
community celebrate and remember the significant Malak Ahmed Talaat
events of our school year, which has been a truly Nour Ahmed Eltaher
delightful one. I wish you all the best. Youssef Ahmed Abdelaziz
Alia Ahmed Zohny Grade 10B:
YOUSSOF MAGED, G11 Nadine Mostafa Mohamed
Malak Mohammed Fawzy
Welcome, everyone, to the amazing Jomana Mohamed Said
High School Bulletin. My name is Donia Elmoatazbellah
Youssof Maged, and I am honored to Nour Atef Mohamed
be a journalist on this issue. I am all Mariam Ashraf Farouk
about positivity and I adore music Mariam Ahmed Soliman
above all else; it doesn’t just repre- Sama Adel Mohamed
sent life to me, but it also keeps me Grade 10C:
active. I am known by reputation as Janna Wael
I don’t socialize much. I’ve been at Ali Saeed Farrag
MLS for a couple of years now, and I’ve learned a lot: Zeina Mohamed Aly
experiences, knowledge, independence and, above Yara Khaled
all, responsibility. I am tremendously enjoying all the Dalia Morshedy
happy moments the school affords us. Trips, carnivals, Rawan Arafat
sports championships, incredible lessons – not to men- Sherouk Abdelmonem
tion all the trouble we get into together. Nothing, and Hana Amr AbdelmonGermade 11A:
I mean nothing, will ever even come close to our days Nour Yosri
at MLS. Thank you all, and I hope you enjoy this issue Kareem Soliman
of the Bulletin. Nadine Elgammal
Salma El Khabeiry
Editor-in-Chief: Ms. Injy El-Kashef Zeina Amr Eweis
Muhammad Kelany Zahran
Lay Out Editor: Ms. Sherien Hussien Omar Abdelhamid
Grade 11B:
Activities Director: Ms. Deena Seleem Tasneem Said
Diana Beshoy
Contributing copy writer: Ms. Nabila Fattouh Grade 12A:
Bassem Wahid
2 Hazem Tarek
Fatima Hagag
Thoraya Shebl
Ahmed Tahoun
Omar Kelany
Omar El Deeb
Grade 12B:
Hedayette Elqabbani
Farida Elshazly
Lina Elmaghraby Grade 12C:
Mariam Magdy
Farida Elsefary
Farida Abdelhamid

MORE THAN A SENIOR

On the day I wrote this, I had had the pleasure of speaking with a 12th grade piano prodigy,
Hedayette El Qabbani. She might come across as your typical senior just looking to graduate, but
there is really so much more to her personality. Hedayette has been playing the piano since she
was three years old, and she truly is astonishing to listen to.
My first element of curiosity centered around which pianists inspired her most. Hedayette
was quick to answer Chopin, Mozart and Bach, have been on her musical road since infancy. “As
for the Egyptian scenes,” she added, “artists such as Nesma Mahfouz and Hany Mostafa are a huge
inspiration, especially Hany Mostafa, with whom I have a connection.”
When I quizzed her about her playing style, she replied that she enjoys classical, rock, jazz,
among many others, demonstrating a truly eclectic musical nature.
Did she ever perform in front of a crowd? The answer was yes and it was a very nervous
moment for her, she was quick to add. Although she is too humble to boast about specific musical
moments of glory, I had heard from the grapevine that she had animated a reception at the British
ambassador’s residence in Cairo with her fantastic talent.
Did I mention that she also sings? This much you may have already discovered if you saw her on
stage last year during the unique performance
granted to us by the MLS High School Choir. “It
was a really scary moment; I had to overcome
my stage freight,” said Hedayette, but she also
insists that the nervousness slowly faded as she
focused and decided to enjoy the experience.
“I thought to myself that I am getting a chance
to do what I like, so I should let go of the
fear of forgetting the lyrics to a song and just
have fun with the show.” Indeed it was a truly
exceptional performance.
Last but not least, I asked her if she would
estimate it easy to learn to play the piano, for
those who have not started young. Hedayette
replied that “practice makes perfect, and if
you are determined enough you’ll be able to
accomplish anything. Don’t give up if you fail
a few times; you will find hardships on the
way, so just be ready to beat them.” That was
Hedayette for you, ladies and gentlemen, truly
an inspiration.
Interview by Ezz Eldin Ahmed

3

UNITED IN LOVE

In line with a tradition established a few years ago, the students celebrate ‘Nannies Appreciation
Day’ towards the end of the second semester, in a move to show gratitude for the incredible daily
hard work endured by our nannies and workers to keep our school tidy and clean.
In the morning, the High School student body greeted in deference our five nannies who keep
the floor spotless, but by the end of the day they were all cheering, singing and dancing together
in celebration of such a job well done.

Thanking the students for the joyful gesture, nanny Badreya said “you are to us like our own
kids, and we wish you the best, always.” “Such a beautiful day!” exclaimed nanny Jehan, while
nannies Nawal, Rasha and Lateefa said “it was such a happy and fun day,” adding that “we thank
you all, and may God grant you joy such as the joy you have brought us.” MLS High is truly a
wonderful place to be for all.

4

5

SPRING FEST

This year’s spring carnival had all the usual perks and high standards of any other MLS carnival. The
attractions, the bazaar, the food vendors, and the overall atmosphere were superb and flowing with
positivity. MLS welcomed singers Mostafa Amar, Mahmoud El Essily and Rula Zaki onto their stage and
their tunes radiated through the early hours of the cool April night. Students, teachers, and parents all
danced and sang along to the hit season song “Talat Da’att” brought by the live entertainer and Egypt’s
newest sensation, Abu, who also hit our stage.
Chairman Dr. Ismail Osman, along with other members of the board and school principal Ms.
Shahinaz Shehata, all enjoyed their day at the carnival. Furthermore, the members of the AdvancED QAR
committe also paid the carnival a visit to sample the lovely community spirit that makes our school so
special. The committee expressed their delight at experiencing an afternoon that showed the school’s
‘authenticity’ and pride for its culture.
This year, students were designated by the administration to ‘handle’ the organization of this
important event. With the office’s supervision, and Ms Deena Seleem’s constant support, the high school
students were able to hone their leadership and organizational skills by delivering quite an event!

6

EXTRAORDINAIRE

7

8

9

MEANWHILE IN

Personality analysts

In Ms. Doaa Naguib’s junior
English class, students were asked
to create descriptive collages of
the well known American novelist
and author, Mitch Albom. Like any
person who gets influenced by his
writings throughout the different
phases of life, Albom’s works have
changed both in perspective and
life’s events. Albom’s dreams got
shattered after a career setback
and the death of a loved one. As a result, he threw himself entirely into the world of work and
money. Students were asked to build a collage depicting these two phases in his life through the
accumulation of pictures and illustrations. Students also expressed their views on his journey from
idealism in college to the world of realism working as a journalist. Thank you Ms. Doaa for bringing
out the personality analyst in our juniors!

10

THE CLASSROOMS...

Parting is such sweet sorrow

In the course of their journey navigating the seas of Shakespeare’s Romeo and Juliet, Grade 9 students
in Quarter 3 brought snippets of the play to life inside the classroom.

Having spent a great many weeks in the company of those immortal characters, studying their
every word and scrutinizing their every dimension, it was time for the students to carve their own
memories of the canonical text, “For never was a story of more woe than this of Juliet and her
Romeo.” They were allowed to choose (and memorize) their favorite scenes to act out, in costume,
for this dynamic oral assessment that sealed off the first half of their second semester.

11

“I Have A Dream”

As the countdown has begun towards the graduating
seniors’ final days at school, Grade 12 teachers in the
various academic departments are ensuring that they
provide their students with the icing on the cake that has
been their journey from KG to graduation. Accordingly,
the students spent an entire ELA unit during Quarter 3
fine tuning their speech writing and delivery techniques –
ahead of their commencement, of potential future talks
at university, and even of prospective workplaces now
just a short distance down the road. Although it is the
graduating class’ valedictorian who traditionally delivers
the commencement speech at MLS, each and every one of those seniors got to write and deliver a
graduation speech as their summative assessment for this unit.
Some speeches were deeply moving, others inspirational, and many were quite funny; but we
would be amiss not to make special mention of two particular cases: Aya Said’s poignant tribute to
our dearly departed graduating senior Nour Kayed; and Abdullah Salem, who once again impressed
with yet another creatively staged “dramatic context” for his turn (see Bulletin Issue 10, page 3).
Shortly before the class, Abdullah had whizzed to the High School Office seeking Ms Shereen
Moussad, our esteemed Academic Coordinator. Ever supportive of all of our students, she instantly
agreed to his idea of handing him a mock “Student of the Year” cup along with his as-yet mock
diploma at the end of his speech, as seen in the pictures.
Also spotted in the background are Art Teacher Ms Farida Bahaa and her art students, who had
rushed in as guests to the classroom, sketchbook still in hand, intent on catching all the speeches
that they could. Thank you Ms Heba Zeitoun!

12

13

The Little Senior

As the senior year was coming to
an end, Grade 12 ELA Teacher Ms.
Heba Zeitoun had the wildest,
most liberating activity for her
seniors that struck a deep cord
with them and their appreciation
for the novel they were studying:
The Little Prince. Their three-
step instructions began with their
simply painting with their hands,
or coloring in a coloring book, but with the mentality of a five-year-old child! Any adult
constraint was to be broken, any ties to what is “grown-up” was to be thrown out the
window. Girls had a particularly hard time accepting to get messy with their hands and
ruining their perfectly manicured nails.

Each student then had to write an expressive essay describing in detail how it felt to
regress again to childhood, now that they were on the brink of a new milestone in their
adulthood with their imminent graduation from school. Furthermore, the students were
also required to orally present the contents of their written assignments (along with their
finger paintings) with the rest of the class, which allowed them to share the various facets
of this unexpectedly difficult activity.

The feedback of the students was phenomenal! They all thought that it was the
most challenging end of year project by far, despite its apparent simplicity, but also the
most liberating. By breaking
their constraints and “rigid”
conceptions built over the
years, they were able to find
their inner child and felt more
enabled to embrace life’s
upcoming phases with a fresh
perspective. Way to capture
the true essence of The Little
Prince, Ms. Heba!

14

15

Three forms of fun

Grade 9 students have been studying linear functions as part of their Maths curriculum during
Semester Two. One of their assigned projects was to draw any cartoon character of their choice.
We saw Scooby Doo, Bakar, Dexter and
Daisy Duck among other favorites. No, this
was not an assessment of their drawing
skills; the students had to render their
cartoons using lines. And no, it doesn’t
end there either. They were required to
write the equations of the lines that they
used for drawing in the three forms that
they learned: standard form; point slope
form and slope intercept form. It doesn’t
seem so easy now, does it?

16

Mathematically gorgeous

Students in Grade 11 completed a study unit
during Semester Two on Sequences and Series.
That sounds rather boring, doesn’t it? But
what if we told you that thanks to that unit
the juniors had a great time with the famous
Fibonacci sequence which generates the
Golden Ratio found all around us.
Fibonacci numbers are characterized
by the fact that every number after the first
two is the sum of the two preceding ones;
while the Golden Ratio often appears in
nature – such as in the spiral arrangement of
leaves – and has been adopted by numerous
artists and architects seeking to capture this
formula of beauty.
The students are here seen with
measuring tapes to calculate the items around
them, such as computer screens, paintings
and window panes; but the highlight of the
unit was undoubtedly measuring themselves
to see how “golden” they are! Thank you Ms
Nanice El Sharnouby!

17

Let the games begin

The ingeniousness of the High School Sophomores was reaaaally tested
in Semester Two during Geometry class. Divided into groups, Grade
10 students were allowed to choose one of the Trigonometry topics
they studied and explain it briefly first in a PowerPoint Presentation
of their own making. Then – and here comes the fun – they were
to create a competitive game using their chosen topic! Under the
teacher’s rigorous guidelines for the project, each designed game
was to be played and “tested” by the other groups. It’s one thing
to be good at board games; it is another thing
altogether to be good at inventing one – and
make it work trigonometrically, too. Thank
you Ms Sara Gawdat!

18

On your marks!

If you think about Maths, you probably imagine a mind-numbing class, with nothing to do but pay
attention, turn in homework, and suffer weekly quizzes. But that’s not the case in MLS High. Just
recently after Mrs. Sara Gawdat taught our sophomores about ratios and proportions, she assigned her
students a captivating task. They were split into pairs and required to solve a series of questions in a
small amount of time. And most importantly, the task was graded, so students had to act, and fast,
given the short minutes on the stopwatch. Each pair rushed to provide the solutions, proving they had
paid attention in class. So sweet is the taste of healthy competition!

19

SENIORS GO “FUN”RAISING

A significant moment of any senior’s life is fundraising for the class prom that celebrates their completion
of 12 long years of study. The prom – and how to generate enough money to make it extra special –
greatly preoccupies our seniors’ minds in the second semester of every year, in addition to their study
load. Seniors had to find innovative ways to make money in and around school, in an attempt to fill up
and fatten their prom fund. Our cameras captured one of these activities in action: the senior barbeque.
Flame-grilled burgers were on the grill, waiting to be devoured by our famished High School students who
were getting really creative and messy and with the various toppings and sauces! A big thank you to our
IT expert Mr. Ahmed Abdel Moneim for supporting the seniors in their task by taking from his precious
time to contribute with his grilling expertise.

20

GREASE LIGHTNING

When spring reached its peak towards the end of May, we at MLS knew that it was time for our
long-awaited annual drama performance of the high school musical Grease. The butterflies were
starting to dance in our stomachs in anticipation of the big night, one week before the actual
event. The buzz and vibes on campus was everywhere: from performing students, backstage crew
and, most of all, from our directorial mastermind behind it all, drama club supervisor Ms. Heba
Zeitoun. The workers were busy setting up a grand stage in the courtyard of the school building,
while quick glimpses of props and costume racks became visible for the first time in eight months
of preparation! But our biggest surprise of all was the arrival of an actual toktok that was brought
in by our headmaster Dr. Soliman (ever supportive of extra-curricular accomplishments) to be
placed on stage using a ramp built especially for the occasion.

As pleasant and calm as the night was, no one was prepared for the storm that followed
in the form of “automatic, systematic, hyyyyyyyyydromatic grease
lightning!!” From 7pm to 9pm, the stage was bubbling with song and
dance, the audience were at the edge of their seats, singing along,
cheering, whistling and screaming as MLS was transformed into Rydell High!
This musical was definitely produced with the most professional
approach, dedicated actors and singers who put in long hours of
rehearsals both on stage and in recording studios, with the expert
mentorship of the play’s musical and vocal director Ms. Rula Zaki, to
make sure that all the voices and tunes that came out that night were
in perfect pitch and quality.
This show was truly a proud moment for the MLS community as a
whole, because such a remarkable success had to be a collaborative
effort from everyone involved and was such a pride and joy for parents
and teachers who will always remember and cherish their students’
outstanding performance!

21

22

23

An incredible audience!

24

Behind the scenes...

25

BACK TO THE

Electrical engineers in the making

As our seniors head for university life -- and a rigorous, demanding, academic life
it is -- their Physics teacher has inspired them to be manufacturers of electrical
equipment using all the information that they acquired from their year in her
tough course. Students were joined in groups of three and came up with many
electrical innovations under their belts, among them an electrical fan, an
elevator that goes up and down, and a washing machine that actually spins its
entire cycle, just to name a few. Impressive work, seniors, and way to sum up
all the skills and knowledge grasped in Physics class. Thank you Ms. Hanan Nasr!

Minimalist molecules

After their recent study of the “synthesis of
hydrocarbons”, Grade 11 Chemistry students were
required to group up and create 3D compound
molecules of different organic compound compositions.
Additionally, they were required to design a pathway for
new chemical compounds to be synthesized. Students
used clay, tooth picks, and a large sheet of paper to
compose their molecules. We can notice in the picture
below that the materials provided were fairly minimal,
so the task required creativity and a great deal of hard
work to create an aesthetically-pleasing project while
still following the stipulated requirements. As always,
the students had fun, created outstanding products, and
made great use out of the visual representation, which
helped them understand and remember the lesson.
Grade 10 students, this is what’s going on in 11th grade
Chemistry class.

26

CLASSROOMS...

Testing the waters

On a cooler level, Grade 9 students carried out
an experiment in the Science Lab, where they
applied their learning to calculate and measure
energy change in a certain environment, with
the use of water. In groups, students applied
their understanding of what Ms. Mai had
taught them in the study unit. They essentially
learned to measure the specific temperature
of water, and then measure it again after the
water was heated for a designated amount of
time. The hypothesis was that the water will
essentially gain more energy as it constantly
heats up. Using the specific heat capacity,
they were successful in predicting the energy
transfer from the heat source to the water
by using the energy equation. Thank you Ms
Mai Mohie!

27

A moooo-tivational look

Grade 10 students, on the other hand, were requested to perform a somewhat more gooey
operation in the Science Lab: they were to dissect an eye -- more specifically, a cow’s eye -- this
organ of the body which uses light to create an image of the world, and everything around us.
Students delicately cut the cornea, which is the outer part of the eye, removed the lens, then
went on to remove other structures inside the squishy orb. Students stated that most of the eye
contained a clear gel and multiple small structures that make up the eye as a whole. Some students
claimed it was quite “a weird experience to witness,” while others claimed it was all quite fun.
No comment. In either case, the students were able to identify the different components of the
organ, as they were taught in class theoretically. Thank you Ms. Pakinam Rashed!

28

IN TRIBUTE TO OUR NOUR

This academic year witenessed the Having a classmate pass away
tragic loss of one of the High School’s gave me an immediate shock.
graduating seniors, Nour Kayed, She was a person who was
who passed away after a long and full of courage and never
showed any pain during her
arduous battle with cancer. The illness, even though it was Nour was so kindhearted,
entire school community was struck severe. No one can imagine strong and loveable. I
with bereavement, especially as our the pain she went through remember the first time
Nour was an insipirational model and the challenges she had we met; her voice so
of perserverance and strength. Her to face. She taught me how sweet, her laughter filling
classmates pay her homage in these to overcome obstacles in life the air and her smile...
notes, which capture the legacy of her without complaining about it. Her smile. Though she’s
been through so much,
Marwan Wahid I never saw her sad or
crying. I only saw that
unforgettable smile. May your blessed Still doesn’t make sense admirable smile which I
soul rest in peace, Nour. will always remember.
May her beautiful soul
abtaasonthlNeinwlhfgewiloynionavectuagueyhavyrsosgr,iensnfhIbcsgytseeeahyf,moreuoa.uinlsnivui,lstYiearnmyaorugooneuewyg,nudvggeetnealwhoreberneno,rviodnasueefaevc,grtnaeeehhbtld,snthwauhis.enatt.oay,nIyowytdbbsuhocereaeuIdawynkvhwfonaeeiaannoinrcsvlddteltyee, Still making my mind wonder rest in peace. I love you
Mariam Magdy Still making my heart throb Nour, you’ll forever be in
I can only imagine how Still crashing through the waves my heart.
hard it was, but seeing Still strong and standing
you smile through all Still smiling and positive Farida Elshazly
this adversity is a lesson Still there
in fighting that I will Hana Nabil
never forget. It taught
me to always to be Her smile was beautiful. You can never forget it.
strong no matter what.

Fady Ashraf

A smile that never left her face; her face always
shinning bright. She was as beautiful as an angel.
It’s all about smiling through your struggles. Every
time she leaves, she returns back with a smile;
In 10th grade Nour Kayed got up and talked about her journey kisses and laughter fill the class. Her presence was
going through cancer and how she beat it. She was so hopeful; full of laughter with her friends while she went
always smiling. In all honesty, I always viewed her as some
sort of angel living among us. She was a true role model. through pain that nobody saw. She was inspiring
She still is and always will be. It breaks my heart that she
had won that battle, but lost the war. Through every second when she read her speech in front of the whole High
of it she remained hopeful. Two weeks ago, she came back School, talking about what she was going through
from treatment with, still, the brightest smile. She was just and how she was overcoming every obstacle. She
here with us. The next second, she was gone. This is the part always fought when there was very little energy in
that I still can’t fathom. I can’t comprehend how a person so her. I never really talked to her as a friend. Some
soulful and precious can just be here one second and gone people inspire you and show you what it means to
the next. But people say it’s a kind of relief for her. That she have hope for tomorrow and make you thank God
doesn’t have to suffer anymore. I believe that Nour Kayed was for every blessing you have.
an inspiration, and nothing less.
Lina El Maghraby Alaa Samy

You were the kindest person I’ve ever met and you were a huge full bundle of positivity. Wherever you went, you
radiated happiness, optimism and kindness. You had a huge influence on others and you never allowed anyone to
influence you. You always stood your ground and never took no for an answer. Never once did I hear you talk about
someone, whether behind their back or right to their face. You were always glowing and it was obvious that you
were something else, someone that didn’t fit here among us humans. I’m sad to let you go but I’m happy because I
know you are somewhere much better. Thank you for teaching me a lot of things; one of them being strength. Even
though we were like third cousins, you were still part of my family and I am glad for it.
Farida Hashem

29

YABAoYnEuYunBoIvdBtoEduuIekTasuuevItnn’lhtwtevwhmweoteardenoewlaytrelurorsyyoyerewyurwsoienoiotrnsintehueluieywhglena,onyenheadewtuopdoovhsvs’uiaaiwepArtenesrierrehencgrsoysSyymfe,aaaknmtuyotlnstnhygloihluyhlltiieeyuilp’noawainrtsnognteboogtlhag’osgsnueoispsiyvsenAgilteeoabydelgrhnrualolnuaow,yygsuobeioobwenatrH,uonuelhygegfvetisiarIhnenttdecekbo..kteanrlghub,oyeopeefeewi,linarto,gtcekeemta.hyEbr.lorqauacgbeh,b.ani rwsdmotcsenaaoIrihnoisodnyetwetmcthcdawaohrlitaponslitmomuiltlltostlpaesrpoehtfeooieohwennkitnrnafhaihtitrngthsseceiiigosneeerbsat,wug.hnrachwlredohtiIatt’fitouattolehlclhtelnd.eogdosksdaaheufegTnyoretlfcreohdtireanbswiia.raysnyn.aeelotWecwltstwlMueathythsaherraaaeaya.esireysdrtns.gnbnNnaAtoysdpuewiohtolunhtetsureeur,hssoaitrydroophmclhoeouefiewbovn,ysovgeehpigcuekhlfnareelagnrepuenihoatecvtettxchtlwinhooewohefedaoiuuraaprant..lllulywgdorebssseNsotrosiatsgoeabuthuhle’vwdelleosleytde,f
Zeina Salama

I have felt so much pain losing you. We’ve Don’t cry because she has left, Ygwoifhutotowaenrkyenoenwae
done a lot of things that I’ll never forget -- the But smile because she is at rest. you.
good ones and the bad. You were my first real We are the ones who are stuck, You always
best friend with whom I always loved to talk And she is the one, not us, at luck. itwnaoIYseopbwucierorietlbuldhllilefeduesnbbssewieeanv.saleglts;r
and be with. You were one of those people Set free, frZMoeiraasgtydeiytMnoyapuoserusaos.coueud.l
that could make me smile and laugh through We all know where she has to be.
some of my hardest times without trying. I’ll Nour Kayed will never be forgotten.
never forget you and I’ll never forget what Even when her life was darkened,
we had together. No matter what, you will She could only reflect the light.
always be in my heart. By the way I still have Fighting the mightiest fight,
your PJ’s, and I’ll keep them until I grow up Nour gave us the brightest smile,
and show them to my kids and talk with them And still had the lightest heart.
about you. I love you so much Nour. I still Live, laugh, and love to the core
can’t believe that I wont see you anymore, Like never before.
but I understand that you’re in a better place Even if your life is a mess,
now. I love you and I’ll miss you. Remember that you’ve been blessed,
Aya Said Because you got the chance to meet Nour Kayed.
Fatima Hagag

ao7yT.loonluWwfheheerlartitwdfesaeotacroreergty.erniItfobnhotuerGtsrheroaaetdncroldeobasum7e,tfarwdtikehieednesnhdny’,etwoabukrhundomtotjwsihsuhsesewttnhhsdeeeaiweetmmdstomoeisfddovhortee.eor.rybIhgedaoivfatfiintvcgoeurlcktyan.nonItcwicemerN,acoakluneardssswymwoheauetnaetlhIlwimnchokoouvoleadfldnwa’lttaloybtsMheehlLiaeSmdvieenamiGtso.rmraWidieleees
hedLewchYeavaaxeeeetmyprarrersrleafea.lyaynaioicnTtndfnsoethhtee.twesheh.rIceieIsnhaybhweloelseewawaoctislmarhlasslyaormIenesotnseegfcjssavuolhwhvteakleoeearsersrhridmf,lyseoydaw.rerisengniIlicaaeotdtaktnhtshhwdeboahhhwnueeehhedtgrreae,thnlsrealpateornhasvshdmpaetessilrhetrrahareIocdiawleewcoenwdi.kttdtaaehtsotsruoofmmasacbweayihvsnleceeleaairnregtstuyisthhrotitegockhn,nhrienswbmermedusanuetisaisptnosonImtrewdsnshad..ehcekSvecShilhenplnheaergeesIhiswhrsemwefaerausawarslwgsdbpsihuaneuseeleueackrrctdsh.,tohotLbtanhahuam.etkatneIyitcntrwaahmsdsnnhiehhlagceleeteesaacmwlrglhr.woaatieALletnsaesladydybissnnstehpGletopeyehhvtvrereeeowaesarrrnoydroelanluafweinb.omlsfdedyrtt
30

“Those we love don’t go away. They walk Losing you was definitely dreadful for Nour was a special and unique
beside us everyday … unseen, unheard, me. You left this world too soon, but your
but always still loved, still missed and very soul will always be with me. I’ll never girl whom I loved entirely with all
dear.” Nour was a very kind person and forget your big-heartedness and how my heart. She was the strongest
she had a pure heart. She was a strong you used to smile regardless of all you’ve girl I have ever met, even on her
person to fight this disease without losing been going through. You were born an worst days. Deep down, I could
that smile on her face. Knowing that she angel and you left as one too. You never feel that she was in pain but she
passed away was a shocking moment. I failed at encouraging me and showing me never showed it, and that’s what
will always be inspired by her and will what determination really means. inspired me the most. She had the
never forget her. I learned so many genuinely miss you and won’t forget I will most beautiful smile ever that I will
things from her. She will always be loved, all of indeed miss. Nour and I weren’t
never forgotten. the memories we used to share since we
were kids. You’ll always be in my heart that close, but we had a very good
Seif Ayman my dear friend. relationship and we would always
tease one another in a good way.
Mariam Wael The first thing we would do in the
shfEtyocrTcomavsgotioukYohchepteknhotuInnlyohoueoenoen.eotrcvouamnrtundpvuYaewwteetttsl.eeogwhnmrdheinakrirlshrui’Moandl,eawsetiasi’gubstgnyprolptmboenoaelegeientwoyrrtnoemtmhnosaa.thamnlbhsesbihhliyytyba,seinoetTviteoaeootlnvddaereayyecuwuoeegg.rpnayroykfkmvtonlrdoeuYwtboenielsiuohturrnoosnefoorihsp’sawtutagmcaoulwteeh.ftylrmahrnoreeaeosaoyYIlnyirtvlslyustotuowgiottesieftsmhlhuh,onuelwuvetlraaiay’aatrdfleeyrayrrottteeoattreet,nsewrd,yalvIry,mwyld’nojeaamgeydydohou.yuydoarooonuaeuido.cwyinIunsucttvtaguatsI.heow’dgaihenellowc,euprillolrfdidneoadlirmryneimlnsnsmanveocgteri.iam’ye’glhacwneeitvltmlvIediini.l’iefeonneybsaldarterlsugsYarihegdyethmmeboslmnerlyeoianiapeeouadoesyiaubedvsltfemotuvavesto.eaanfae,teteciuallwycIholewyeprbetbctocmiciehneeeaibptwuawyoygayaghsypelrno,orhtathcsast’husueecbttoehasfItme.hw.ernihdewbgaiiIebIceiaeaenP’elwromeamlvehwtrlnatllcnrtei,yh.udr.ewtreeotm’ortegyhG.itevdmteNu.oraIifereoboseoruoteIwbsfaoeptrrdcthtjnodhaeommhoahalaetdabsrauyebmehnlayastyulrffsl’rosrteeyautfIgeemsatt’hniclhelnobwmteloiiayf,lorudasneiaapnnynlynglmurtshinehidoandotbephgoovia-luoilveaetheiowaInirooepwapsntrnroad-vuaridsothybfboflotositahworneheeuhibieydrafacu.aaaesolouvatsene.rtryInueIu.lb’,tdmIsdrn’rIllsesl
hallway each morning is smile at
each other and talk for a couple
of minutes and she would always
show me that she has power and
strength and that’s what I loved
about her. The moment I knew that
she passed away was heartbreaking
for me because she was loved by
the whole school; it was and still is
a shock, but I am glad that she isn’t
in pain anymore but relaxed and
happy in heaven. Gone but never
forgotten.
Noor Omara

Losing someone so dear and
precious was really hard for all of
us. Our hearts were truly broken. It
is sad that I come to think about you

Thoraya Shebl more often than I previously used
to, but it is only because you are

missed deeply and loved endlessly.

I can’t explain, or express, Words cannot describe what a Nour was a person truly loved by
how much she inspired me beautiful inside and out person she every single one of us. I have never
and how much I respected her was. She had strength no one her seen someone who was so loved by
courage, her sheer will fighting age had. She fought a great battle everyone. She had a warm smile
a war without giving up and for over four years, spending most of that could make your day. She had
overcoming every obstacle. She her nights in hospital rooms. And yet a laugh that would put a smile on
had a great smile that makes no one ever heard her complaining. my face, and a personality that
you feel that everything is good. But, unfortunately, she’s no longer inspired me so much. Nour was
Now, I understand this quote with us. I miss that beautiful smile very optimistic throughout and
“Happiness can be found even she had anywhere anytime. I always tried to enjoy the time of her life
in the darkest of times, when wondered how she could go through as much as she could. Although
one only remembers to turn on all of this without her smile ever she has suffered a lot, heaven has
the light.” For me she will be a leaving her face. certainly gained an angel up there.
legend that achieved greatness 29/1/2018. A day I wish had never I am unfortunate for not having
through optimism and a warrior come. It wasn’t easy to understand been as close to her as I intended
through her unmeasurable the end of a life. My entire body was or wanted to; however, I am very
strength and tolerance. She overwhelmed, my heart was aching. grateful for meeting someone this
may be physically gone, but I wanted someone to tell me that pure. Nour will always remain in all
her soul will always be among this was all a bad dream, but it was of our hearts and will forever have
us and I will always remember reality. I remember every moment a special place.
her great smile and that we spent together, every laugh we
outstanding will for survival. shared. Nour, you’ll always have Farida Tomoum
Legends live forever. a special place in my heart, even
when you’re gone. I love you.
Marwan Wael
Haidi Mourshdy

31

It was Nelson Mandela who once said “I learned God had a plan for this beautiful soul. She
that courage was not the absence of fear, but was put into this world in order to show
the triumph over it.” and I believe that Nour was the people surrounding her how strong
the most courageous of us all. She went through she is. God took her body, but her soul
a lot fighting an enemy who’d already taken so will forever live among us. In the midst
many victims, yet she always had a smile on her of fighting for her life, she’d show up
face, a smile that can easily make anyone’s day. with a smile on her face, leaving us all
Even in the darkest hours her smile never faded mesmerized and speechless. She was a
away; it triumphed over her fear, turning her into living angel in this world, and will forever
a beacon of hope for all of us, for the rest of our have a place in our hearts.
lives.
Malak El Shamy
Mohamed Amr

To an innocent soul who will always have a weyCYTYvoeBWaooeouuuuwneuttsahweeiwawrnererieteelelhtwrlhaohaenahelvtaenlonedvdntledieehinifvsgreusbeewhprnbyarteoiesrtcaroaeilllflfdtolloaistorwacehgntneeoudtaeftatlxelhlypnlilsnoendvaeetdiroangoBtoisne
place in our hearts.... alkeoannvondoekdwnr depwomtrhawheayen metnrawbsyneeowdrusetw’trhrieleaalvteucevyapeoretruhyewwYreoherueesrseberfaAveh.med
I’ll tell you a story Even though Nour and I were not close,
A story about a fighter I really loved her personality. She was
...maybe gone from this world smart, kind, inspiring, and always had a
But for sure was one fine pearl smile on her face. Her death affected me
A pearl that tried to conquer in many ways and it made me understand
Conquer a stubborn disease, cancer that it could happen at any age and at any
A disease that cannot cripple love time. May her beautiful soul rest in peace
Neither can it shatter hope and I am happy for her because she is in a
Her only weapons were a smile and a good heart way be tter pla ce. Amna Abouelwafa
But, as you may infer
It was a tough road for her
Now her turn is over
Now comes ours
To Never... let her memory blur
To be honest, she taught me a lesson
Never make your spirit lessen
And never ever fall for depression
I know problems may feel like concussions
But at least, try to be a “Nour”
Nour, Nour, Nour
The smile, the fighter, the Nour
P.S: Yes, I did have a crush on you in Grade 3,
beautiful ;)

Bassem Wahid

32

“We all lose friends. We lose them to I’ve never been a close friend of Nour’s, but I have
death, to distance, and to time. But even known her for a long time. Seeing her battle her
though they may be lost, hope is not. disease every day was heartbreaking. But seeing
The key is to keep them in your heart, her smile every day despite everything she was
and when the time is right, you can pick going through because of that disease, as though it
up the friendship right where you left was nothing, was really heroic of her. I remember
off. Even the lost find their way home, her as a good person; one who never hurt anyone,
when you leave the light on.” or spoke ill of anyone. She was the pure example of
goodness; a role model, and I am deeply saddened
Omar Nasser at her loss. May her soul rest in peace.

Youssef Elbarbary

It’s so hard to lose a friend. I have known Nour since Grade 3, and she was always
helpful, kind, and loved. I am proud that I got the chance to know an amazing
friend and fighter like her. Although we weren’t that close, but she was always
there for me when I needed anything. That smile she had on her face despite what
she was going through. We will never forget you, Nour, you are always and forever
in our hearts. Those we love who pass away live on in us, through our memories
and our character.
Sherouk Ragab

Nour Kayed, a name that taught me so much. It taught me strength to fight no matter what. It taught
me bravery to have courage to talk in front of all High School students and teachers; and taught me
that no matter how hard life gets, keep smiling. She will always inspire me, and I will never forget her.

Omar Abouelseoud

“Son: Dad, why do all the best people Your life was a blessing, I do not know how to begin this. Just over
die? Father: My son, when you’re in a Your memory a treasure, a week ago, one of my dearest colleagues
garden…which flowers do you pick? Son: You are loved beyond words passed away. I was surprised at first; I did
the most beautiful ones”. This is what I And missed beyond measure. not know how to deal with this situation.
always come back to whenever I think of We may have not been close enough, but
our beloved and brave Nour. There is not much I am the few times I talked with her she was
Like a dove soaring in the sky willing to say. However, very kind and helpful. She had hard last
Persisting through the storm there is something I’m days but, for sure, we all learned a lot from
Appearing peaceful as you fly grateful for, the short time her. At the very end, I just want to say that
Battling it as a norm that you existed in my life, she will always be loved, never forgotten
Keep ascending high you showed me no darkness and forever missed.
You are free now and gave me light. Thank
I say to you goodbye you for being a source of Ahmed Tahoun
Till we meet somehow Ibrahim El-Bieh happiness and thank you for
being you. 33

Mohab Aly

I know I was not that close to you, and I will not pretend Isfgoeoaoeectwununtnhrvavhtehrtideeenaslevemlnnlcveripronpeevetsrufeeara.y,fi.tbivssenSnk.cteeaaaAhinhrnnrSletfohsestghdowfm.hweeoewroorrgrienp.laiguwoennesyegtdjSgraeNtothosiahsefanyoohbmefnriwaniuelnsoc.eer,regwutv.whetloIatHoeefwrhnsolvreyoeo,kretrparvegirlemseceleeaymwtnadounper’raspoegetseeyhhrlhnredescoeeaig’nfourrstsitgagnhstshfahbcdhmaeasonltoacohnirudiounenelasdreftgeslIl
to be close to ride on the bandwagon, but in the few Maya Tamer
instances in which we talked, I have always been fond of
you and thought you had an amazing heart and a lovely
spirit. You have fought cancer with a smile that was so
remarkable even though it hid a lot of pain underneath.
Your close friends miss you the most. You left a mark on
our school, and in our hearts, and everyone talks about
how much of a good person you were. I miss you.

Omar Eldeeb

I didn’t know Nour closely; she has always been a classmate and a school friend. It was when she left
us that I felt her “presence” missing in school. It has happened so many times that a person has to
die first before we tell the world what a wonderful person they were; but, not with Nour. We all knew
her value and how wonderful she was without her being gone. I always saw Nour with a smile and a
laugh despite all the things she was going through. Nour was loved by the entire high school, not only
by our grade. She will be missed by all of us.
Seif Amr

Nour was one of the very few pure- My heart broke into pieces when I heard the news. As
hearted souls of this world. She had
nothing but the best intentions – the my tears uninterruptedly fell down my cheeks, all I could
type of girl you could never speak
wrongly of. Her beautiful smile shone see was your beautiful smile. That is the case every time
brightly through her pain, and her
strength and courage could never be I think of you. There has never been a time I walked into
underestimated. Throughout my five
years of knowing her, she taught me class but felt the warmth in your smile. Your presence
the true meaning of fortitude, and
for that I will forever be grateful. was always joyful, you never complained, never made
I’ll never forget the lovely moments
I shared with Nour, and I’m faithful excuses and surely never showed any anxiety. You were
that she has now become the angel
she had always been. a blessing to those who knew you. You made all those

Farida Abdelhamid around you giggle, laugh and commit while they were

34 doing their projects and assignments. Although your

time with us was short, it will impact us a lifetime. You

have taught me the true meaning of strength, of courage

and of hope. Know this: you will never be forgotten and

you will constantly inspire me to be brave, hopeful, and

satisfied with what life throws at me. I am thankful that

I have met you and worked closely with you. You were

an angel brought to us from heaven to help us see the

good in everything around us. Your memory will live on

forever in our hearts. Ms. Heba Zeitoun

...AND CLASSROOMS AGAIN

Peace, Love and
Understanding

If the time that we spend passing
judgments about other people’s
behavior was invested instead in
reflecting on our own, the world would
be a much better place indeed, wouldn’t
it? Thank God we have Psychology – the
science that explains behavior, feeling
and thought – to bring in some much
needed awareness and understanding
to the equation!
Seniors in the Psychology course
demonstrated their acquired skills with
psychological analysis by developing
a fictional story with imaginary
characters between whom there is
a conflict. Analyzing the characters
and the situation, the students had
to provide psychological advice in the
form of a conflict resolution at the end
of the story. This was all done using
technology, since the assignment was
for that fictional story to be presented
as a cartoon with successive frames
depicting the actions of the characters.
The seniors applied sequential writing,
using action verbs and descriptive
language to express their ideas and
present their analysis. Thank you Ms.
Ayten Nayel!

35

A matter of perspective

Working in pairs, G12 students in Economics class were
confronted with a really cool activity: they had to match the
puzzle pieces of three economies with their corresponding
GDP tables, unemployment bar charts, inflation graphs and a
representative picture of the economy. Yes, even here, forming
the puzzle was again about recognizing the bits that make
up the larger picture. In this case, however, that picture is a
mental one resting on the knowledge that the students have
acquired in this particular section of that challenging course.

Blooming minds

The government plays different roles in a market economy –
everybody knows that. Well, at least our Seniors do, thanks to their
Economics class. But what good is knowing if it ends there? Working
in pairs, the students were offered a number of political cartoons
on the topic which they were to analyze. It doesn’t end there either,
oh no it doesn’t. They then had to form a personal opinion on each
cartoonist’s point of view and, naturally, explain why they agreed or
disagreed with it. Thank you Ms. Shahira Sadek!

The debt to learning

Grade 12 students in the Economics course
must grapple with some really tough topics,
not least of which is National Debt. There
is so much reading and analysis to be made
here, and so much evaluation! Working in
groups, the seniors were first loaded with
different viewpoints on the subject. They
were to read all of them meticulously in
preparation for the next stage of the
activity: a competition to give answers
comparing the viewpoints that they have
read. Those minds were on fire!

36

Escape the boredom

Have you ever been to an Escape
Room? As the name suggests,
an Escape Room is a physical
adventure game in which players
solve a series of puzzles and
riddles using clues to complete
the objective. Loaaaads of fun.
What does it have in common
with World War One? Our Grade
9 History teacher! Her Escape
Room took the students on a
secret mission around the classroom where they had to decode facts about WWI by solving one
clue after the other. Each clue was solved by a code that requires the students to think differently
in order to decipher the answer (note the picture showing the riddle in Morse Code). By the end
of the game, not only had the students enjoyed a thrilling class and raced against the clock in a
spirit of healthy competition, but they had also learned many important facts about the First War
without even realizing it. Thank you Ms Hala Abu Taleb!

37

As inspirational as they come

Ms. Shereen Touny gave our
junior class a real feel for
business/marketing strategies
and applications as well as
hands-on applications from
none other than renowned
AUC Professor Dr. Galal Zaky.
His work with advertising and
marketing communications
has made him a leading
expert and pioneer in this
field in Egypt. He shared
with the 11th graders some
of his approaches for future
strategies in the field of
business and communications.

He advocated innovative
marketing by talking to our
students about his advertising
campaigns, among them
the successful Schweppes
campaign. He encouraged
our MLSers to set their
imagination free and set

38

high goals for themselves since, in
this day and age, innovation and
thinking ‘out of the box’ are a sure
way to success and fulfillment. He
concluded with an ode, “To Fadia
with Love”, dedicated to his dear
wife and the story of their love,
commitment and life together.
Our students completely intrigued
by his talk and attentive to every
word and gesture he so amusingly
delivered. What an asset it is to
have such a guest speaker address
our Juniors!

39

Breaking down the street children cycle

The seniors have been also been busy with their sociology work this quarter, where Ms. Shereen
had them exposed to real work- as sociologists who conduct actual fieldwork! The project was
two-fold, the first was for them to write a literature review where they had to research previous
work done by sociologists in the field of street children and the reasons behind this social problem.
The second part of the project was actual fieldwork where they had to go out to Egyptian ghettos
to ask people in the form of interviews, questionnaires and surveys about this subject, and how
these four factors-government legislature, traditions, economics, and education- affect it and
what can be done to break the cycle of this phenomenon. The feedback of the students was very
inspiring. They came back with a lot of insight, and real hands-on knowledge on the effects of
homelessness and were able to derive some solid, realistic and simple solutions to help eradicate
this social dilemma. Thank you Ms. Shereen Touny!

40

Most of the children we asked Some help their mother/father/ Most fathers depend on their children
were between the ages of 5 to sibling, but most children actually for money. The ones who do, work
8 which indicates that they were work on their own -- either because as doormen or in a workshop. More
either born on the street or they don’t have parents, or because than half the fathers are either dead
abandoned by their families. their parents don’t work. or have just left.

41

Good Morning, Mr. President

As the year was coming to an end
with already emotional seniors
who are deeply distraught
that they are leaving MLS and
venturing into life, Ms. Shahira
kept them on their toes with
her final Economics project and
sent them off to face the world
with suits and formal dresses
as they addressed Egypt’s most
pending economic problems,
and displaying them to “the president”, Ms. Shahira.
They had to analyze the current economic condition, finding efficient solutions for
the rising inflation and unemployment rates, while bridging the gap between the rich and
poor, providing more economic equality. They were faced with data they had to work with,
and come up with out of the box ideas to make our beloved country’s economy flourish and
prosper. Future ministers and high government officials will be born from that class!

42

Looking back to the future

To reflect on this academic year’s learning in Social Studies at the Senior level, Department
Head Ms Shereen Touny conducted an informal survey targeting a sample of 30 students
from Grade 12, in other words, approximately 50% of the seniors. These were the questions:

• What are the most interesting topics you learned?
• How can you apply the content in your daily life?
• What would you change about the process or practice to make it interesting?
• How can you use the information acquired / what was its impact on you?

And the outcome of the survey reveals the following information on the current Grade 12
course offerings:

Economics
- The most active/energetic course
- Very intense course
- Enjoyed macro- economics the most
- Life skills: reflect & reform behavior and decisions
(Thank you Ms. Shahira Sadek!)

Sociology
- Deviance is the most interesting topic, then comes feral children and culture
- Applying theories & different perspectives
- Enjoyed class time
- Life skills: time management and following steps/procedures
(Thank you Ms. Shereen Touny!)

Psychology
- Drugs & Disorders are the most interesting topics
- Applications and case studies
- The theoretical part is boring; but, it gets so interesting during Semester 2
- Life skills: understanding people (behavior)
(Than you Ms. Ayten Nayel!)

43

No storm in a teacup

Not to sound morbid or overly dramatic, but if you Google the words “world war 3 about water”
these will be the first 10 titles that you will get: “World War III will be fought over water” (2016);
“Could fighting over water actually cause WWIII?” (2016); “Why do people continuously say that
World War III will be triggered because of the lack of water?” (2014); “World War III will be fought
over water” (2017); “Third World War to be
fought over water” (2017); “Day 10: Water
will be the cause of World War III” (2016);
“World War 3 will be over Water” (2015);
“Will The Next War Be Fought Over Water?”
(2010) and “Water shortages ‘to be new
cause of wars’” (1995). Yup. Oh, and if you
have the time or curiosity to read on, the
search actually yields 49,700,000 results.
Try it.
When you live on the banks of “the
longest river in the world”, as the Nile is
commonly called, it might be harder to
believe that Egypt has any reason for concern
– 49,700,000 Google results or not – but
Grade 10 students will beg to differ. Their
hot topic in Arabic class during a good part
of Quarter 3 has been water conservation,
which they intend to make the rest of
the High School community mindful of. In
a multi-stage awareness campaign, 10th
graders began by raising the flag through
visual products of their creation on which
they displayed information, warnings and
tips. At a later stage, the students are
also expected to go into each class for
brief talks about the necessity of water
conservation and easy methods that each
student can apply in daily life. Thank you
Ms. Safaa Zakaria!

44

BLUE AS THE BEAUTIFUL SKY

As the 2nd of April of each year marks World Autism Awareness Day, MLS usually celebrates with the staff and
students. This year, under the guidance of the Special Education Department teachers, students with Special
Educational Needs created an Autism-themed photo frame and posed for pictures with members of the High
School community: teachers, administrators, janitors and workers, students, even members of our AdvancED
QAR on-site review team who were on campus then. Everybody had been requested to dress in any shade of
blue to raise awareness, too. Along with the fun, the teachers spread information to students about Autism,
its symptoms, and how to deal with it. Thank you Ms Deena Yassin!

45

OUR COLORS INSIDE

Art, the human expression of creative skill and imagination, can be anything, really. Thanks to the
collaboration of the American and British divisions this year, the Art for the Soul Exhibition was a
really big deal. It showcased the artwork of MLS’ K-12 students from the American Division alongside
that of the IGCSE students, requiring a tremendous level of cooperation between all concerned
administrators and art teachers.
The artwork on display was really fascinating, capturing as it did the artistic talent of all ages.
Quoted before the exhibition, High School Art teacher Ms. Wafaa Alfred asserted that “the event
will be a blast due to the tremendous hard work invested by students and teachers,” adding that
“the paintings submitted by the students were surprisingly good. I am sure we will not disappoint
our guests.” Meanwhile, Ms. Farida Bahaa, also a High School Art teacher stated that “Hard working
students did an extraordinary job at creating visually aesthetic paintings as well as other creative
pieces using various media.”
A big thank you to the administrators who worked to make this wonderful joint exhibition a reality
and a huge thank you to Ms. Wafaa and Ms. Farida!

46

47

NO PLACE LIKE THAILAND!

This was by far one of the most -- if not the most -- exciting trip the school has ever organized for us.
Thailand is an amazing and beautiful country packed with countless things to do and see. We were never
bored, or out of plans to rush to; there were numerous activities every day which never ceased to amaze
or entertain us in many different ways.
We visited two cities in Thailand, each completely different from the other: Bangkok and Krabi.
Bangkok is a huge bustling city with many things to sights to explore; among them were the historical
Buddhist temples which fill every corner of Bangkok, and the annual nationwide waterfight which was a
complete blast. Krabi, on the other hand, is more of a jungle situated on the shore of a beautiful ocean,
and with the ocean come many water activities, such as kayaking through the mangroves, to name but
one.

During our stay in Bangkok, we went sightseeing at the most extraordinary temples in the world,
shopped in malls where you can literally find anything you can think of, ate the most delicious Thai food on
the planet, surfed on artificial waves which everyone enjoyed so much that we returned for a second time
and, finally, had the biggest water fight of our lives on the streets of Bangkok which was a great ending for
our time there.
As we arrived at our stunning jungle-enclosed hotel in Krabi, we couldn’t wait for what was in store
for us the next few days. We went kayaking for hours through the picturesque mangroves, rafting in the
gnarly and unforgiving river which almost flipped us over several times! We also rode elephants through
a magnificent landscape, visited a picture perfect waterfall in the midst of luscious pristine setting, and
finally hopped to one of the most famous islands in Thailand.
All in all this trip was simply spectacular. I hope the school considers organizing another one and I
hope that everyone joins us next time. Thank you Dr. Mohamed Soliman!

48

49

50