GV \, ,
1469.62 .x .\ 1
S7 ‘
584 _,, " IM
2017
1M
or
THE
', ‘1‘.\z‘1‘ ':‘.M_ ‘3 1..”
1
‘ H.1
\‘ ‘
i W.=3amV“rE}m,(w H ‘ .
‘ : » '5’rvr;« u \ ,us. .ma“
‘ NHM H r J |1 i‘
V mm
M‘tmmm -m-_-_.“.:_7_-.'_"~,_._~w' ‘
”mm-“5
muml‘ . ,5- WWW
Amnm—aunm.,. .au... 1., . flaunts»):
an
, 7 ~ 7 Av —.- ,-——-‘,."u‘—mnszj‘ng y~2~5".1....c.m'.-....w ..» .flm‘w..." ~.
._—..~———-...
. ' ‘ '
-‘ ‘ .. '
,
. V
. ‘ ‘ .. ' I l
". -.
. ' v ‘ ’
' - '’
. .~ ' .
‘ .
..
u ' v ' -
.. ‘ . v
. '‘ V
.
- ‘' . , . '_ ' . . ..
- ‘
‘. "l - _'- ‘x‘ : '\ v‘ .-
- ' -1
. ‘_ ‘ ,, w .4 . ‘
. .
h ‘ fl. ‘P, ,
. ‘2 ‘ ,
.
~ . 1V"! v. ‘
'
,‘3 ,-a .- '‘ 1' ' ' ’
~ ‘i v" ‘
.‘ ‘' ' ..i, . . . . - ..
. . - .
. . ._ 1,}, ,. . ..
.
.d- 3‘ . ' ‘ ' ‘
. .
2z w. ~ , .
.
,‘ . -, ,
. , a. - -
_
~ - ~. .'‘, ,g‘ w,-
4 ‘ 3.7. -
- , . an; ‘
. ~ '‘ . ,9 - . r.
' ‘ -
' . . , .. .
‘ - I
- ' ' a ~ , - .
4 .. ‘
.. . . \‘qv. - . . ~-
"' ' . _‘ ' ‘
.
' ‘ .. H . ‘‘
..
JHD,, -v A
, ,. ~
.
'H V. , ‘ '
"
, .
" v .'= "41.2mm. -' ‘
,. -
'
. . .
' ' H' _ . . ‘1 .
~
, '. .v v 4“ . ’
‘ ,, ,
' ‘ ' ' ‘ ‘
. E". ‘.‘ ‘ ,,‘
.u\v‘ "mi -..r.1 ‘
.‘,._.- t}; ‘:".\- ‘ .
, .
.‘ '-':v~b"‘v“.,.~- ",-x. , ‘ ' ,
. “a , ' ..
7 1' '
‘
,
_
' ‘-s ~ . . .
1
;. .
‘. ' '' i
4.
‘ l‘ - . ‘
u . .-
. ‘
'‘ I
‘ _
,. ‘
" . ,' . ‘ ‘
‘
. ,
.
‘ (\' a. . - ' .
.
-_
, . . , .‘
'
. n. *‘ -. ' . " .' , .
' . ' ,
V ’ . ‘
., ‘
' ' . l
n -. .
‘ .’~ u
' .
~
.
..-..,.,mmgwxnzmm.a'm .‘.."~.,gv.v.~..;: ‘ _ ‘ '
.S'I'AR- WAR-I'—
EMBLEPLPHVII'IG GHITIE
NO D'l'SiNTEGRATIONS
. ‘tgjuuForsavnrteitcrforneommBeOitnshUtesN,TscYcecanriHrtmceUerinN.oaTflEtIhRnceaSrgtftoeahrlli.assxt,hyae,Inailridfweu|~ecinssitisqiczuhe‘eehfarssopknianati\nse\kd-re,. »
; edixsbrt.epThuaaerltoadmctciotakstflirolnaioongamffgenst.weshtBwnehrtoeeoigeurunrnfgOeotthryaubtttaehHeenienrusdigntrRstrtheeriaamurascnndrsytoitengosirsrsnsepdtstihharisveeeriioedansuCldsteaaomlg1rsr5seie,rn,attnohotadietobnaenudharnyusatgwynnh,dte
CREDITS
PRODUCED AND DEVELOPED BY MANAGING ART DIRECTOR
Max Brooke Andy Christensen
WRITING AND ADDITIONAL DEVELOPMENT PRODUCTION COORDINATION
Leonard Balscra, John Dunn, John Br'itton, Marcia Colby,
Jordan Goldfarb, and Jason Marker
..
Jason Glawc, Liza Lundgr'en, and Johanna Whltlflg
EDITING AND PROOFREADING PRODUCTION MANAGEMENT
Jim Jacobson, David Johnson, and Mark Latham Megan Duehn and Jason Beaudoin
MANAGING RPG PRODUCER LICENSING
Simone Elliott and Amanda GroenharL
Sam StewarL
CREATIVE DIRECTOR
GAME LINE GRAPHIC DESIGN
Andrew Navaro
EDGE SLudio, David Ardila, and Chris Beck
EXPANSION GRAPHIC DESIGN EXECUTIVE GAME DESIGNER
Corey Kama/Ra
Brian Schomburg and Scott Nicely
EXECUTIVE PRODUCER
GRAPHIC DESIGN MANAGER Michael Hurley
Brian Schomburg
COVER ART PUBLISHER
David Auden Nash and Tomasz Jedruszek Christian T. Petersen
INTERIOR ART
Jacob Allen/e1, Balancz(3'>'heel., Mark Bohrn, Alberto PLAYTESTERS
Boulxrmpl, Marius Bow Mall b'x'acli’mry, JB Casacop, Stephen Playtnsl. Comdinaror Zach ’l‘ewnlthomas. "The Aim/m Sector
C‘wmg, /\HHJ.1 {L‘m’i'alcnsom Amhony Devine, Dinodrawing, Rangers" Vimce SCIMZO WiU'I Ian Dimitri, Cody Mr:r:lL m,
Lop/m Fetiniano. Aurore Folny. Minimal Anthony Gomalm. Mike Kecver. Max SLanforcl. and Felipe l,0pr:/. “Dominu, Scmn"
Audrey How; Joel Ilustak, Michal lvan l,.I.Il<:~13/ .J;1';|<,01f;l<i, ngm,Ian "CM Hoary" Hrmlihan mm Martin Thnma‘; Flmmagem,
ere’I'omér-Ly J()r.1rus/r:|<,J0[‘l
Johnson, Jaw» Jam. David Michael I’lurreH, Patnck Thom Lynch and Juhn Pope.
Keen, Jaw: Murray, Amen-11 Nakamwee, David Auden Na'sh, “Bamcgmp Anci’longu" William F. ||0SLIHEIIMVHI1Slf:|)l1f:lnir.‘/\.
Mame} Rebiv Mike '~ Arlnm Schlllm‘mI’L SLepl‘lcn Sorrmr's, I’lostmz’m, Pater Newt’nem, Gabe Ream, l'annna‘yn L H03LIHLII'1,
Awirrria Hamil Ryan Valle, :md Li’lr; luca'aliln'1 arl, zxr'rhivefi. and Hmnor N. Hoslmal‘l, "DWIU'I Still COHLFWZU'N’S", Craig Atkins
ART DIRECTION with Dong; RHH, Josh Jupp, NaLhem Wilkinson and Milk CHFMU?
John M 'l‘aillon
worth. “Devil S(.|t.1ar,lron” Scan Vayda with Mrrlanir_3V;lyr1a, Mike
Ferramc, Lind‘suy Ferr'ante, Kelly Yulw; and Zachanalt'mm:12,
CREATIVE DIRECTOR LUCASFILM LUCASFILM STORY GROUP
Michael Siglam SENIOR EDITOR Leland Choe, Pablo Hidalgo,
and Matt, Marl.in
Frank Parisi
FANTASY Fantasy Flight Games
‘v FLIGHT 1995 West County Road B2
./’® GAMES Roseville, MN 551 1 3
Q USA
‘0 r& ’M LUCEISHIHI Ltd. No part ol‘ [his product may he repr'r_)(.1ur:er| will1an.
Fantasy Flight, Games; and the FFG logo are regi'uerer,1 trademarks 0|
specific written pet mission.
Fantasy Flighl. Gan‘wa
App Store is a service mark of Apple Inc, GUOQJC‘, Play 1:; :I Lraclermrk 0| 0009,10 Inc,
ISBN 978—1655446119 Product, Code: SWEI 6
For more im‘ormaLion about Lho Star Wars: EDGE or THE EMPIRE line, I'm 9 downloads.
answers Lo rule queries, or just. to pass on greeLings, visit us omino at
www.FantasyFlightGames.com www.StarWars.com
CREDiTS
NO DISINTEGIATIONI
.‘ I
TABLE OF CONTENTS
; Bounty Hunters at the Edge ................................ New Attachments ............................ . ................. 51‘
Bouty Hunters in the Galaxy .............................. 6 ~ New Gear...L ................... '. ........ ........ 53
The ong Arm ofthe Law.. 14 New Vehicles ......................... 5...)...».............. 56
Chapter I Hunters for Hire 12 New Starships.. ........... ....... ... .... .57
New Backgrounds .............................................. 15 Chapter III: Thrill of the Chase...... ..... ........... 66
Bounty Hunter Obligations ................................ 18 Integrating Bounty Hunters ............................... 68
Predatory.Species‘.............; ................................ 20 Investigations'.......................... ; ......................... 7]
New Specializations ........................................... 27 Running Investigative Encounters ...................' 75
New Talents ............... . ....................................... 34 Structuring Investigative Campaigns .................. 77
Bounty Hunter Motivations ..................... 37 Sample Campaign: Company Man ................. ....83
Bounty Hunter Signature Abilities. .. .. 38 Sample Campaign. Double Lives ........ ........ 85
thapter ll: Guns Blazing.. ... ... ... .... 42 Sample Campaign: Hero of the People ............... 87
New Weapons......,.............................................. 45 Bounty Hunter Rewards ..................................... 9O
New Armor ........................................................ 49
9 cu sure know how to send an invitation, Koshka!" ——
The duracrete wall sheltering Viktor Hel shook
Usually, most of bounty hunting was shockingly
slightly, and dust flew free of the growing web of unglamorous—asking shopkeepers for sparse details,
worse—competition." Frost set her shoulder against
the heavy durasteel table and flared her jetpack,
inching it forward to cut off the fire lane. Hel jumped
‘behind table and opened fire with his rifle.
cracks near his head. Krandak slumped where Hel poring old receipts, sitting on stakeout waiting for
had dragged his unconscious body against the same anything to happen. Nothing like the holovids. Unfor-
wall, bleeding from a blaster wound, but probably tunately, from the minute Krandak had showed up at
alive. The Trandoshan had lived through worse. The Hel’s Speeder shop and dropped Frost’s name, his life
“doctor” could patch himself up later.
had been altogether too exciting. The hunter swept
“I didn’t ask you to come here, Viktor.” Koshka his rifle's the sight across the landscape from his van-
Frost dropped her depleted blaster rifle and pulled
her pistol, then steadied her aim on the edge of tage point atop a low hill of rubble. A glimmer caught
the table giving her cover. “And I’m not sharing the
his eye. A camp, several days old, sheltered by the
shattered husk of a skyscraper. His mark’s location.
reward when we take Melos in.” “Found you, Melos.”
‘
Aura “I told you, I’m out of the game.” Hel hurled a gre- “Heh, heh. Well now, who did you find?"
nade over the edge of the crumbling wall. Viktor turned his gaze to the heavy blaster pistol
av:.*4:‘“a"_"_:x
“Naturally. Which is why you’re here on 0rd Man- pointed at his head, and the Sullustan holding it.
7.: tell, hunting a deadly, Devaronian pirate hidden in The Sullustan’s colorful poncho flapped slightly in
1,41,; a wretched nest crawling with guards, killers, and the breeze, and he tipped his hat with his free hand.
“I just wanted to make sure you didn’t get yourself “You sure you want to point a blaster at Viktor Hel,
killed on this job. I still owe you one for last time. friend? I’ve got a bit of a reputation.” A reputation
that was almost, but not quite, entirely unearned——
You know, when you hunted me half way across the not that Hel was going to bring that up.
The Sullustan gave his dry laugh again. “Viktor
Hel, huh? Never ki||ed anyone famous before."
galaxy and nearly burned my arm off. Hel weighed his options. “Hey, I have a better idea. .
“You were the one who threw that thermal detonator." Viktor slipped out from the shadow of the building, an
unconscious Devaronian slung over his shoulder. The
“But I threw it at you, so it’s still your fault.” clop of heavy boots came from behind him. He Iooked
back briefly... and found himself facing a blaster.
Hel grunted, leaned over, and grabbed Krandak
as the duracrete wall finally gave in. The Trandoshan “Viktor!” Koshka’s tone didn’t quite reach surprise.
mumbled something about spinal fluid as Viktor
dragged him to their new cover.
Blaster bolts rained against the table, and the “Koshka! We got Melos, but we need to go!”
group hunkered down to weather the storm. The Sullustan rounded the corner, pistols drawn, and
“We’re getting nowhere fighting these other hunt- the pair quickly flicked up to target both of the other
ers, Vik. Time to change tactics. You’ve always been hunters. Without drOpping her pistol, Frost hefted her
good at sniffing out trouble, or at least plunging head- rifle into place with one arm to aim at the Sullustan.
long into it. Go find Melos. I’ll take care of things here." “Before you two shoot each other and also me, let
all" “By take care of things, you mean..." me make introductions. Koshka Frost, Nom Lumb.
“I mean leave me your weapons.”
Koshka, Nom helped me take down Melos' guards,
sol cut him in for one-fifth.”
Hel grumbled and unholstered a pistol, two “You always were a terrible negotiator, Viktor."
knives, a few assorted
clips. “I’m drawing the grenades, and several spare “He had a gun to my head! One-fifth is a bargain!"
line at the rifle, though."
Hel could hear the carnage beginning as he ran, but Lumb holstered his pistols. “So, we going? Hel
he didn’t look back. Getting killed by a stray blaster said your ship’s nearby. I need a ride off this rock,
bolt during his mentor’s moment of glory was hardly since my former, uh, associates aren’t gonna be
happy about my cutting them out.”
befitting of the infamous Viktor Hel, after all. head back the way they had come. He jerked his
Frost looked at Hel and Lumb appraisingly, then
lowered her weapons. “Your good ‘doctor’ has the
ship warmed up. Let’s be going.” She paused. “But
you know, Vik, you haven’t lost your touch.”
“That’s what I’m afraid of."
BOUNTY HUNTERS AT THE EDGE
he bounty hunters assembled on the bridge of the condition? to brimg their targets m alive—for the maxi~
Executor in The Empire Sir/hes Back emanated pali mum payoff Operators complement their hunting
pablc menace, even in the presence of Darth Vader. expertise with a knack for piloting, so that Lhey can
Imperial officers on the bridge voiced their disdain, capture running targets. Skip Tracers make the most
but their eyes betrayed their wariness: beneath Lhe of their irwestigaflve and social skills to capture Lax"-
ragged appearances of the hunters for hire lurked gets in the urban jumgle. Finally, new signature abili—
a deadly edge, These professionals were all clea'rly ties leL Bounty Hunters develop their characters even
heavily armed, well-trained, and ruthess, sparking beyond the scope of their talent trees, tracking down
the countless imaginations and offering tantalizing quarry and dispatching foes with unparalleled skill.
hints about the deadly nature of the Galactic Empire's
Chapter II: Guns Blazing presents a range of new
seedy underbelly. equipment tailored to the Bounty Hunter in need of
potent firearms, durable armor, and a fast Ship to
In EDGE OF THE EMPIRE, Player Characters explo'r'e'the catch any prey. These include iconic weapons, armor,
modifications, and specialty gear such as devastating
fringes of galactic society in ways that are only lmted I’nicrorrockets, versaLile grapnel laumher‘s, imposing
Mandaloflam armor, and much more. Characters can
by the group’s imaginaLiorL AS Player Characters, Bounty also consider new Starshlps L'haL are partiCI.,Ilarly well—
Hunters have clearly—defined short—term goals, which can suited for the Bounty Hunter career, Including the
complement nearly any sort of Star Wars campaign. A blister‘ingly fast LCH‘ICEIZCIaSS pursuit cram, the highly
contract can be the central focus of an adventure, appear custon'nzable Kihraxz assault fighter, and the menao
as an Incidental subplot, or present a difficult ghmce mg YV»666#t|‘1e vessel associated with the notorl»
when its fulfillmer‘ut conflicts with the original mlSSIOn, ous Tr‘ar1dosl’1an bounty hunLer Bossk and his crew of
lfl any case, a contract of this sort can bring a Bounty bounty hunters
Hunter PC into the story, tying the current adventure to
his life on the fringes of the Galactic Empire. Chapter III: Thrill of the Chase helps the Game MaS»
Ler customize adventures and campaigns that include
N0 DISINTEGRATIONS substantially expands the Bounty Hunter characters and themes Each contract
resources available to players and Game Masters can have a different arc and flavor, amd this section
interested in the Bounty Hunter career in EDGE OF THE introduces a range of approaches to offer LhaL variety.
EMPIRE. The materials in this book present new ways Ideas for structuring investigative adventures that m
to personalize a character, Offering alternative devell-
Opment paths and focuses for a Bounty Hunter. This the tone of EDGE OF THE EMPIRE are a|so presented.
volume also presents a range of different Ideas to aid Finally, the section concludes with ideas for" Lailor'img
the GM m making each hunt unique. rewards specifically for Bounty
Humers, such as bounty pay-
Chapter I: Hunters for Hire offers more options out guidelines and exploits,
for Bounty Hunter creation and development In a system for gaining noto-
the form of three new playable spe— riety as a hunter.
cies and three new Specializations.
Independent Clawdites, shrewd
Devaronians, and savvy Kalle—
rans bring new approaches
to the Bounty Hunter career
through their species' dis—
tinctive characteristics, abili-
ties. and tendencies, Martial
Artists train themselves to peak
BOUNTY HUNTERS IN THE GALAXY
n Imperial Peace— Keeping Certificate (IPKC) grants - of society. Cutting through misrepresentation bro-
n a being the legal authority to act as a bounty ' ken promises, and outright lies IS a sizable portion of
hunter but it does not confer the respect of peers their daily work, and seeing through deceptions one
or guarantee even a modicum of professionalism. ,In of their most kéy proficiencies. Bbunty hunters can ill
fact, it often earnsonly disdain fr'om the disreputable . afford 'to take anything at face value when pursuing a
figures who operate on the ffinges of the Empire ’In bounty and must; always remain wary. Nob'ody hires
the galactic underworld, bounties are common, and bounty hunters for easy jobs; desperate to avoid cap-
trust can be a deadly weakness Few fringe--dwel|ers ‘ ture, their pr'ey’is unpredictable and willing to resbrt
seek out the companionship of someone who might; ‘to extreme measures against their pur'suers.
later accept money to hunt them down. Consequently, '' Despite a grim reputation, bounty hunters are .
a successful bounty hunter has few close friends out- integral to the maintenance of law and order across ‘
v
side the pr'ofession—and any fellow professional is the "galaxy. T--hey are a necessary check on lawless-
and foremost a rival A boUnty hunter's guild‘ we” as the
first - ne'ss that stabilizes galactic society as
'offers a support network and social interaction that criminal underworld A planetary government—or
some hunters find valuable but such membership
'even a global crime syndicate—seldom has the
also demands a level of obligation that IS a poor fit exp‘eirtiSe and resources to pursue a crimina| into
for many independent operators. other systems. However, they can post a bounty to
.
Béunty hunters are characterized as callous and attract the attention of a skilled professional who
. mercenary by most citizens‘ of the galaxy, with good already has the time, contacts, and interstellar capa-
‘
reason. Their assignments are fiercely competitive bilities. Even the Galactic Empire depends upon
and their livelihoods are entirely dependent upon bou’nties for criminals who flee beyond its reach or
success. Most bounty» hunters-develop a necessary when time is of the utmost importance. As no ruling
level of detachment‘from their peers and from socir body can enforce its will everywhere‘ bounty hunt-
ety as a whole. Anyone could be the next target, ers fill in the gaps. Further, bounty hunters also act
as deniable assets, and posting a job anonymously .
and their next meal could depend on whether they allows a corporation, crime syndicate, or governr
ment to get unsavorywork done without damag-
choose to purs'ue ignore a given contract. In the
'04"
course of their assignments these professionals must
constantly observe and interact with the very dregs ing its public reputation. While often a last resort, '
bounty hunters remain a potent deterrent for
some crimes as well as a valuable tool—
and like any tool, they can be used for '
good and for evil alike.
BBUNTIES IN THE REPUBLIE
TtcJathhrehbairmdlhoneeiuuinOngtpaRothorelesdsrt,ptresthiaunretctbghhiiklnraeictbnmceorrSStaiuvhmeesenenntintneiaaGeearttyseelasilnoafhoacfcasrocttduihrcucpoelhlsdaEesrFsmtmsoirscpreaecuniqrteclteeaue,teorerdrdlsrsyeos.tmeoeJesfateg.fhifidbrnaReciointgiaeuwgitonnhtehutteorlyeseynr typicaHy operated without explicit legal authority
within the Republic. Of course, when politicians
cal! to assist the Senate. needed jobs completed efficiently and discreetly.
HSomfrtowicrhzerioofogeegelawminbnnderateetoitdnfiasaveuitcm,czeshxnatuarcceustt,npthieoceitooteeJrhsopbnnedroEmosddoefiruimlidnpoaedwndoOrspteiettnsoihyrrrioteenndddeet,sfeeuidolrh,certprrhuoismrencdcensemngroitaaireaemdbnectrbieothctosefhrlnrtu.eanlioystnscmBt.nyatutoyseonpbeCcandrroohaoaeteinsucuoun.qtoathnsstuutheteeaLreeereleqvocsesrstaiuces,thsroaieselalanoaalvnsnsfebetmsldgttflyceiwhuose,aivlatosnofijajeootstttrlrrhnhlbuknareecei—eesltd—reoyy.sraf they often hired bounty hunters off the record.
sFiuvEertmhaeprisrmeysotrleaemt,etrhfoewroRluiceldep.nusbTilnhicgerdbeidfoourneno,tyt bhhoauuvnentteyarssheauxspnattenh—res
The Confederacy of Independent Systems also
employed numerous bounty hunters to vari-
ous ends during the Clone Wars, from sabotage
to kidnappings to assassinations. This led to
animosity between many bounty hunters and
Republic representatives, including the Jedi‘
While bounty hunters occasionally worked with
Jedi under extreme circumstances during this
time, these alliances were usually matters of con-
venience to both sides.
At times, bounty hunters were even employed
as mercenaries by criminal organizations against
Republic representatives, including an incident
when a group of Hutts hired Cad Bane to hold
senators hostage as a negotiating tactic. While
this was an extreme case, criminal cartels were a
relatively reliable source of employment during
the era of the Republic.
Different. levels 01 governmml. offer van'iou; typos (fl
bountics am can value Lasaks of similar difficulties in
eUh0GpCiII3aIg’''SWHtWhhI’SwHdUGoLaeIoHr’cpmkLcraieSahcssinralsltedgrerdlyLaka0,dstnoyIdld'0neei;aamvsrhvteroialavymboarnrfllkmLiucseienhemrgaesrbfeeuasoldalyumfitnnlijloode.tnibidecsMssal’qtxaceuinaapinryscemkbbwelyeemoittuh‘eOLnnhbrbtetnchytraaseslhiulmuygrwennohts—mgvto. very different ways. A ImgieraLe on Chow-gamma might
have a standmg (gonlxacL for new carcasses, but LIN:
releafse Lho most ILICI‘aLiVC commas. rewaui might be of SLHJsLanLially lower value Lhur] price
galaxy's 51'1ad0\«vp(,nts. In
cimqals’aIHuUenTDcnncihhdOLmLieflsWo"ryoCrcisrlFg'aefDaiunsncInIlyudfiibrrlemoveleeprjsfligdecboa,aanenndtmhtHsie:/eaoanfifirwtcdneicoeedpiyanvrleeit3hlri2sctm;ao1aeetnanrbnftoeaoa{bfaettle.himjLdvoeoeibdnmrnsigSg,osimt[enwa'meieipch-swjlrsliaiil.dfethjbflieoTilsoU,lnhu1aesL0crorhmoigdbln.peaootswmruahWnnaLocu‘Itnte1my1sya- Lhc pelt would l'etch at: me migl’H [ox/vaml the capture
some sewers, 0m: governor
of a known 31'11I.,1g;glm‘wil_1h the value of the stale“ (mgr),
while ammer governor could gram; Liv: l’munty humor
bulougmgs‘, including the alarm”). In :in
Lho criminal's remrnwsibiHLy oflhu hunter to agree
(gases, 1H5 the upon
the relevant value 0| r;<,>rm;)(2113>“er bebr’rg Lmdrjrlflkmg
Few {goverm‘nunts are open Lo n<::g01..ialimg the
the )0!) a posted bounLy when tsouumne (10mm lr) mlr
terms; 01
|er;L on iL. 'l'hc bounty hunter who 0ch estimates hit; bay
gaining positicm may [ind a Lalgol, painted (m his back,
215; II) suddenly I'E‘DI‘OSEHLS LIM: (My obstaclu hem/won
guild is more elficiem. 19:33 |’)arl.ir:!,lla| htu'xlms’; amd HM: posted bounly.
iOfcrSniaaiYo,nm;Doks<nreBcgcGi,sldal)l.ilDolHu0|ocer"AE]usdcc’hd)rIlneIiel,e’'ab.Uolt["|soiiotlarComeaeon[Lr”Luls4dduiijI1ooiIne”trvEtnnh[cht[cIio"rydmeee'ia0Igr{yusmod|kolmamrperp,a1leLsao,amo30S,ywLr(Temeouee3eachrxcal0uslrooChe'rhncnnrmsxhslchb:mea>liao0medsi1slullilml.‘osn‘meliamntinhdenngbtouglLduigleetvr‘oel,inetisnd'rdcrwnst9euheaecc,Irw.aermivsithmmtayajoau1osr5rolmteiglbdniaornmoemsrnIgef,ttonattlogs’heusytib[atrnnaIaOh:u'trogmmceIl'lv.prL.li/e,ceege0jaowcnonnshbrbmscutthh.hosmcorliwdLeermum[e‘nCamoslsmallI.xMlllHaklUeLraemlPiWl1thlsnryonl0Lcsy:
Of course, rallkil‘lg ITNM’THJCI'S rul [IIC Gellarilir bupim
periodically issue bomwliess, as well. 8011101411193 muse
jobs an: publinly ac\<.I"10\.A./ledgged, winlr; other [H‘HQSV
Irm’mial oil'icialss use [reelen'weraa to (flLliUUy cover up
Lheir own ennban‘assn’u; misLakes, or to [Illdt‘l'ljlkll
work [hey do mt dcizgn L0 cormnlele Il‘mmsel\/<%is. Ono
ol the IHOSLHI‘HmJt-s lnuim’ini Mountica 13:11:30 0110 0| its
most lC.)I’lgS|flI'l¢HM); Hm vex/\Hn’d 101' Judi heir; mI'I'IZIiIU’écl
open since the cxr;<:1_xlion 01 ONO! 66. This pan’lmllar
bounty is quw: challenging to (:mllmit, and um (My
i')(_:calui-;r3 ot’ We f.IEl|J&H)HHiCi~L 01 the prev
Limr: 1.0 atlen’mt H.
INTRODUCTION w
NO DISINTEGRATIONS
Bounty hunters pursuing Jedi can also come into a distant system. Standing contracts are only likely
conflict with Imperial agents pursuing the same tar- place for members of prominent criminal
gtoetss.haSreucchreedliittefoor pthereairtivseuscceasresestywpiicthalloythuenrsw, ilalinndg to be in
have no reservations about killing a bounty hunter syndicates, such as Black Sun. Further, collecting a
or two if it proves the most convenient option. bounty on a high-ranking member of such an orga-
nization carries its own risks, including being denied
jobs by that very group in the future.
Other bounties
more attainable. from Imperial Governors are far odsmhcruimfaBfinl.eeoctev.uueMrnlIsntntiutethmucsa-ora-nnlnopynotfouisectlasfieosldtlehianserb,geryfitwnthiyndoephirmnikacg,batiolajtloaynbfindslotlsfsaiontoamnfathelilseteicomvagleaneantspebsdseb.mocmCuaitoonlileleroteysr-
Standing bounties exist for infor-
ootmhffoatRuthiogeenhbirelrtcehArgeimllasiaeerdnsic.ndegoSpotehftfiycecpifieiccwrashlbleyaorsuenrawetbieqeolusluirtaesasreasthnyiednmpnaealcvtahitdmiivzeietnifrecnses,r
CRIMINAL BOUNTIES Cormectiona play 1 vital role in obtaining jobs from ‘
a syndicate. Offering an illegal! bounLy requires a high ‘
When some upstart [ails Lo respect its authority, I crim level ol‘ discretion, lest; word of the opportunity reach
law enforcement. If a bounty hu:"uLcr"s work SaLiSl‘ies
imam orgamzaljrjm needs to make a firm and I'nel’norable a cr‘me lord, however, it can often mean a steady
demoeraLion of its power: If the target. is beyond the erLam ol‘ emjloymcnt Alley" all, the bomww hunter
group’s grasp, l.‘nen a bounLy hunter offers an ideal is now privy to many Of the (:rimmal's secrets, and
SOILIUOI’I Lo Ihe problem. I/lowevcr', groups offering such
Jobs se‘dom have the legal auLhority to do so. As a [he syndicaLe has irmentive L0 keep the bounty mum
consequeflcc, Lhe act of undertaking such a cqntracL
is—Junctionally amd legallyrexLomon, kidnapping, or busy with work Lo insulate against; the risk 01‘ betrayal.
even rmn'der. Imperial law enforcement frowns upoh
anyone who openly affiliates with crminal orgam Unforturlately, an established relannsahip mm a pow
zations, but Sometimes LLIr‘ms a bllnd eye wprn the
lfldividual in questiom is useful enough to the tmplre. erliul member of a cr'il‘ninal organwation has substantiai
A orweitimc oll‘ense might be overlooked if H; ls [or a I’mgative ramificaLions as well. Cr'lrmnalg aware of a
hunter known to conslStentw and effectively collect bounty i‘|I_,II'11;er’s illegal} actions are often Willing Lo use
mat Normation [Or blackmail. /~\ publicly known a550—
Imperial bounties, Repeat oflendersrat IeasL those ciation with a (:rh’ninal orgamzanm limits the number of
Who are caughbhave any official authority they H’tht groups willing to work with a hunter; leaving the char
acLer' unable to coHecL goveflm'lem bounties vviLhout
possess revoked and are treated no better than the
criminals who hired them in the eyes ol' the law. being arrested, In time, outsiders consider the bounty
hunter a member of thaL crimmai group, regardless of
As with govermnent boumLics, criminal bounLies any official standing. A bounty hunter such as Ketsu
Vary m scope subatar'ltially, in concert with the reelnch Omyo, who has @3118 so far as to join a crime f’amHy,
and power of the organizations and mdiVIduals tnat essemially loses independent status, becom—
issue them. When a Black Sun Vlgo posts a contract, ing liLtle more man a syndicate enforcers
the target is likely to be high profile and the reward While the stability of this lifestyle has
is certain to be both substantiab and reliably paid on advantages, it also means being part
time. In contrasL, a tenant who tries Lo hire an assas» of a cril’ninal orgamzation: if there
Sin to take out a haLed lafldlord is less likely L0 be able are standing contracts on mem-
[0 Day LID—assuming that person was able to contact bers of that group, the lwnLer
a bounLy hunter to even consider the asgignment.
is now officially and perma—
nently one of the hunted.
Reliability of payment is a much larger problem with guiding regulations, and reports of Infractions to
criminal bounties than with official government, assign- oversight groups only ever get logged when the
ments. All too often, a criminal lacks the resources to wronged party survives. Successful, veteran bounty
hunters are more prone to trust their instincts and
pay the bounty hunter when issuing the bounty. Oth- their weapons than Lo trust In a competitor, a subcon-
ers simply intend to double cross a hunter when the tractor, or an outside group.
bounty is collected] or even attempt to involve law
enforcementaan approach that seldom works well CODES OF CONDUCT
for either party. Veteran bounty hur'lters often only
work with trusted middlemen for just such a reason. When operating under Lhe authority of an Imperial
Some require that funds be placed in escrow aL the Peace-Keeping Certificate, bounty hunters are expected
time that the bounty is issued. However, developing to comply with basic Imperial laws. In addition to the
a relationship with a reliable go—between poses its Iimited legal authority to act aggressively against their
own challenges. These criminals are naturally as sus- Largets, bounty hunters acquire a subset of the rights
picious of prospective bounty hunters as they are of accorded a law enforcement officer] However, these
individuals looking to offer illegal bounties. rights do not extend beyond their pursuit of the bounLy,
NO BLASTERS! In theory, this suggests that bounty hunters would ad
Interactions between bounty hunters are challenging in accordance with Imperial law. In practice, most take
even under the best of circumstances Those who pur- liberties with both Imperial and planetary laws, particu‘
sue this career are highly motivated, naturally suspi— larly those regarding weapon ownersl'np, surveillance
cious, strongly independent, and often volatile. These practices, and other matters of personal liberty.
professionals quickly assess one another, always
trying to identify the most dangerous person m the Beyond concerns of legal realities, however, the
room. At the same time, they also take care to iden— conduct of Bounty Hunters has broad—reaching impli-
tify vulnerabilities, so that they can quickly eliminate cations. If every humer were little more than a dam—
the competition should it prove necessary. Trust never
comes easily, and betrayal lurks even in seemingly gerous criminal, the Galactic Empire would have to
Innocuous gestures. restrict their authorities further and limit the number
of bounties they offer. To prevent such a fr‘eeAfor-all
Bounty hunters who routinely undertake Imperial from Sharply decreasing the bounty market, unofficial
and iocai government bounties are more likely to treat government policies work in conjunction with a limited
their peers fairiy. After all, a bounty hunter known for degree of self—policing among bounty hunters. While
causing collateral damage and killing off the competi- few of these professionals take criticism from their
tion inevitably finds it harder to get work or coordinate peers very seriously or personally, repeated remind—
with peers for jobs too difficult for a single hunter. Yet ers [and threats] from other hunters have some effect
the saying remains accurate: the dead tell no tales. on all but the most callous. Even the most individualv
Even if a bounty hunter’s organization or current
employer forbids certain methods, an absence of wit- istic bounty hunter benefits from some degree of pro
nesses means that he can “adjust” the rules as neces—
sary without risking his livelihood. And, of course, the fessional cooperation from others, and those deter-
dead are renowned for the reliability of their silence. mined not to heed the warnings of their peers are
ostracized by the community, which usually involves
Bounty humers connected to a criminal syndicate a lethal hail of gunfire at an inconvenient; moment.
adhere to those codes that organization enforces. This
means an explicit level of cooperation with fellow mem— Most bounty hunters follow their own particular
bers of that same syndicate—including those from dis- credo or ethos in their work, and some guilds have
tant branches. However, that creates its own challenge, rules, byiaws, or regulations Lhat restrict the conduct
particularly when rival bounty hunters are affiliated of their members further. The specific details of each
with competing syndicates or have government con- creed vary between sectors and guilds, prioritizing dif'»
ferent elements in keeping with each group’s goals
nections. Further, some criminal enterprises encourage For example, the creed of a hunter devoted to fulfill»
ruthlessness amongst their members, and those who ing government bounties i5 generally more conserva-
betray the most effectively climb the farthest tive than that of one who regularly accepts criminal
targets Central to most creeds is the notion that; the
Codes of conduct and oversight groups are in target of a bounty is no longer considered a free, sen-
place to address these continuing problemg How- tient being Instead, a target is prey to be secured
for the client. Many creeds include requirernems for
ever, not everyone adheres to these supposed interacting with other hunters~particulariy any hunt-
ers currently attempting to collect the reward for the
same contract.
INTRODUCTION
NO DISINTEGRA'HONS
A core element, in mew imelacmns la; LhaL huntms For hunters IntercsLed ir] a level oI mmu‘ity, and
consider Li'lrsn'rlfaul'vcs L0 be a class apart from oLller
beir‘lgsi Largetir'lg one another is Lmseemly and disrry possibly even some control over all bountiea WlLi'Iin a
spechu‘. Other comn‘won elements m a codeofljr,>l,lr1t:y regiom, membership in a guild is a rewarding option.
humter' ethics concur] the pr’iofltizatiom OI' capturmg a
lilowevcr, me secur'iLy of n'uen’lbel’sl“|ip comes Wim a
Largel, over {mew slayh’1g them [or vice versa).
105:; of indepemdcrm, Guild members have an obliga—
Regardless ol its origin; and age, any creed that. a
bOLmLy runner r,.i‘|oo:;es Lo follow 15 Male I’mm than a tion to fulfill bountios that the guild assigns as well at»;
guideline for proi'essiormlism. It; is not a legally erflorcer
able Ir‘landare, esporially since i‘ew bounty i”lL|l’11.Gl'S a I’CE:LpOI’13il’)M[y to assisisL their fellows when r‘uece‘isary.
record their own acLIvitics. l1'1stvead, follow/Mg a creed Guild leaders have a duLy L0 manage the other mem
bers, making certain that. everyomc is I'ult'iHing mm:
helps [0 EESILEleSl'I a network among other Hl<.e-minded necc gary duties—~21 subgtantial dwallemge m a group
of beings: Wim strmwg, il"|de]')cr1dent persomliLies. New
professiomls, imleing l’eHow t'unwtcrs. Peers may be
more Willing, to coaperam WM] and LI" 1'1ler3r when gLIHd Immbom often a(,:r_:usLorrIed to working alone,
must learn Lo defer to me orders of the guiid's load
they recogni/o that, they follow SiITIHEH" codes of etincs. ex’sl'lip Loom corll‘cderatioms, WiLh limited responsi-
Officials offering boumies (3mm direct them Lox/ward bilities, such ‘ [he :mwdirgz—ue Boba Fem led durmg
hunLcrs who conslsLemly demomstrale the I'equisiLc the Clone Wu! 3, resolvu Wine of thew (IiIZlHCHgCS. In
levd of discreLion or respect for the target UlLiI’flaLEW, baLL‘leI'iCld conditious, |"|OWCVCI', a Clear (JUL sham 01'
a creed can be a means Lowar‘d germaflng a greater leadership is vital for 5!,1rgr,:esr;. VVH.1’10LHI 11;, tean‘ls fall]
and more reliable revenue stream for the i’wnmr; mak
ing the code selfiscr'ving‘ SUII, even upholding a cow prey Lo miscommumcaLion, ir'lfigl’mng, and peLLy dis
313mm code of SEII:--il‘1|;€I’GS|; makes‘ a bounLy ruumr put. 5 any 01 wiflci’l can allow L‘Ho mark Lo slip away.
much less ol~ a Lhmal: to peers and socieLy alike.
l'iunters who work. alone more Often (MCDUHLCV Lluoir’
J peers only in a con‘lpel.ii'ive CI’IViI'OHITICHL. 'l'hoso WI’IO
have come to know one anoLhcr may i'lave a star'lde'nrd
Most bountie“ flgovcr‘rmwent or criminalgare posted [0 working analrugmmr‘ul. for corrupCLiLive siLuaLiom. Some
a Wide range of hunters, H not entirely openly. Profes— may agree [.0 alLemate, parn’fllm’lg OHC‘ amoLI'ler Lo com
tsionals musL work quickly afld corrlpeutivoly to secure
a target; before another bounty I'1Ln'1ter can do so. jobs. Others mlgl'll, imerrLIpL thew ‘I'ILW for a briel’
SomeLimes, the only way to complete am acquisiLion is dis , ssion, a game of chance, or even a biL ol' barLermgi
worklrlg in concert, with peers to overcome a target’s Lradmg Ups on 0mm jObS, agrocir‘lg to no!” inl,crf'er"e \«vitl'w a
defenses. At, oiher Limes, ITIisdirectiI'1g peers is the sur=
dil’fex‘ent bounty, or even ol’fermg equmem m excl’lange
est way L0 Will a I’)O|,.H"|Ly, while they are dislmcled.
for {Wing one complete the task. at: hand AL Limos, how»
Many f’lunLcrs try L0 keep r'CJaLirmsl'nps with peers ever, a pcacetul resolution car‘n'loL be acl'neved. Both
hunters I'nighl desperately Heed me rmney for Lhe job
friendlyflgr aL least. non|eLl’1al~becat.nse they recog» at: hand or lhr: LWO panics could even be ptll‘fjllng Dom
We that today’s competitor could be an ally m the
Lieg‘ that are nultually exclusive. In these “warm“ the
fuLLer However, 51 [CW are L00 h"|dr_apol’1dcn1;, driven,
or” egocentric Lo Si'lOW any ITIOfE concern for We well— issue usually ecscalams 1.0 threats and b
boing m a compeLiLor than they would for their Lal'gets.
fire. A J'mmer's credo i321 CI‘iLical A
When teams of bounty mmLers I’Hust cooperate, [he
[neuter of dividing up the reward for a successful job Lor', than, in wheLher LO use lethal
i8 (Men cor"ut_r:|'1l_ir)Lls_ This is particularly Lrue when
the alliance 13 both trxmporary and recemly set— or I"|OI’]|CLi"IEJ‘ (one in the (LOI'IIHCL.
I.led. Equal shares are rare, as everyone feels that
Lhey l‘1ave undcnaken me greatest Msk or made
the most gubgtantial cor'ltrlbution to success.
Partic1flafly ruthless hur'lters elimirmte Leam—
maLes L10 iflcrease Lheir si‘uar’e of the reward.
When in COI'npetiUon LO capture a target, the
batLle of brains and blasters might not end
until after the bounty is actually collected.
Some Donn Ly hLmters even dare to steal the
reward from the individual who collected it.
a?
HUNTERS
FOR HIRE
"The way I see it, you have two choices for how this
goes clown. After all, I’ve got two blasters. A third op—
tion? Well, I think I’ve got a grenade in my pack."
—Nom Lumb, Sullustan Bounty Hunter
.~} from Darth Vader himself. Who are these dangerous-
Iooking individuals? What drives them? What did they
tthctplRmlaiivilntyiweemigz,t5snoe,i.esttunhWsnSdOePpnihigsfslaufiaestfcrnatoifteearenfQgorltltstbraguiaoptrkaynwtsaheruehltl;ngheIesoTenmneumvhotgperaitebsrfamcfnehrlianiiwsr'‘aeso‘xflhél‘uydeeos,sonapfwfptnpfisinecyrcteCd§iioaatiahsjllniulslstetyldaousnuttatmEhrisccnuImemeedea,fppooibilntirearnnhoewreesuithaahhteclaeteoltopvncermfOieft.mvoqr1msrulaTicplucltguhaetepesetens---r do to earn such an audience with a Dark Lord of the
Sith? How far do they go in fulfilling their contracts?
tcabnarraoiienmtuieosnindnttrya,.elthaOcdunhnendelptyderoertntsdholyaeoatriwetobhhnaoinessnni,cetsoeiovt opefsnrtfuhopwietteeshoacetctnhneleykt‘hmEeOemypauiphnntiagsreevrbe.ayRrAtehiWmsemtsfhI_rnauohgmcmlhia--, These questions, and the nature of their work, make
citizen of the Outer Rim can seek justice. Bounty Hunter PCs extremely compelling characters.
tEatIWahmnmebaBdplprOeeQsitr.rhuueiaanearCltsSryrtehNeetnrahrsiaakrdutvaleensyocsct.tefkewTrBtrshoishtaehfeacytlrkhmitekheeeoseoxttEnuialerBxednyeodedocbicsufamortetituonhywtrFcse,ttefoiegrvtifcotree,yomhtntuaaDiinncnrteghmtdenpegortashmarruetrefsn,arinroinfaooBmdocfroremdSpsTesoteoharkrdnse-,r
In EDGE or THE EMPIRE, the Bounty Hunter career
reflects a diverse collection of sentient beings eking
out a living as freelance enforcers of the law (or
something like it]. They operate throughout the gal-
axy for anyone who can pay their fees. Whether they
belong to one of the many bounty hunting guilds or
work as independent operators, most are licensed
and bonded, granted limited authority by the Empire
to capture or kill fugitives with full legal backing.
They are used sparingly, in Situations where their
unique skills, mobility, and freedom from normal law
enforcement restrictions are the only way to get a
job done. Admired and hated, respected and feared,
bounty hunters are among the most controversial
figures in the galaxy—a status most of them enjoy
very much indeed.
___ _H.U_N-T_E_R_S_F-O_R_H--IR._E 17:13:
1“.
A
THE LONG ARM OF THE LAW
0 hapter I: Hunters for Hire presents a number of use broad webs of informants and traditional detec—
new opLions for players creating characters for EDGE
tive work to track down their quarry, no matter how
OF THE EMPIRE. First, three new species—the Clawdite,
far the trail may lead‘
the Devaronian, and the Kallerar’liare presented as
options for players creating a new Bounty Hunter PC. vFinally, there are a0 new Bounty Hunter signature
Clawdites, Devaromans, and Kallerans are species often
associated with bounty hunting. It was a shapeshifling ability trees that add powerful and exciting new tech—
ClawdiLe named Zam Wesell who led Obi~Wan Kenobi
and Anakin Skywalker on a hairAraising chase through niques for established Bounty Hunter characters to
Coruscant after a foiled attempt on the life of Padmé
Amidala. Devaronians are no strangers to the rough use Always Get My Mark is geared toward the hunter
and tumble Outer Rim, hailing from the untamed world
of Devaron. Janus Kasmir, a Kalleran, helped a young as an investigator, and allows a Bounty Hunter to
Kanan Jarrus escape from Order 66 by disappearing
into the galactic underworld. That is not to say, however, quickly and successfully track down a person of inter—
that these new species are limited to working as bounty
hunters. Like all sentients in the galaxy, individuals from est with a single check. Unmatched Devastation is for
these species are found in any career imaginable.
the Bounty Hunter who prefers raw firepower and
This Chapter also provides a plethora of new
options and guidance for players and Game Masters shows of force over detective work, and allows a char—
alike for the creation and advancement of Bomty
Hunter characters, There are new backgrounds, Obli— acter to unleash a powerful salvo of blasts from every
weapon on hand.
gations, and Motivations to help flesh out new char;
It is important to remember that while the new char»
acters and give them plenLy of backstory. In addition acter options presented in this Chapter of No DISIN-
to the expanded character background options, three TEGRATIONS are tailored for use by Bounty Hunters, all
new Bounty Hunter specializations are presented in but the signature abilities can easily be used by any
this chapter. Martial Artists use their whole bodies as EDGE OF THE EMPIRE character. The flexibility inherent
weapons, and strive for perfection in their techniques. in the game’s character creation system allows for an
Operators are master pilots and drivers, pursuing their incredible amount: of character customization, and
targets at the controls of powerful ships or hot rod with enough XP, a player can choose specialties from
landspeeders. Skip Tracers are somewhere between any career. A Hired Gun could be trained as a Martial
detectives, spies, and law enforcement officers, who Artist, for example, or a Smuggler could moonlight as
an Operator, taking on bounties when smuggling work
is hard to come by‘ A character might even take on
Bounty Hunter specializations without ever actually
pursuing a bounty; a Colonist might take on the Skip
Tracer specialization to improve upon existing detec—
tive skills from the Marshal specialization, or a Tech—
nician might branch into Operator to reflect piloting
skills developed over the course of the adventure.
NEW BACKGROUNDS
Character might have become a boumy hLmLer for Martial Artists live by their fists and training rather
9 any number of reasons, Exacting justice from~or than by fancy gadgets or fast ships: Their outlay for
weapons, armor, ships, and high-Lech gear is the IOWA
visiting vengeance upon—a hated foe might have led est among their peers. It is not the pursuit of gear, or
to the realizaLion that the character actually enjoys even money for its own sake thaL drives those individu»
the thrill of battle. A PC might instead have been als to chase the credits, but Simple necessity; among
taken in by the romance of the profession, believ— their peers, these handson hunters have Lhe highest
ing the Lales and hole—dramas until the harsh reality medical bills‘ Their fighting styles can be extremciy
of the job set in, Or, a character might simply have punishing, not only for their foes but also for their
needed the credits and found no other work available. own bodies, and their list of injuries incurred ON the
job often reads like a medical dictionary. Martial Art—
Each of the following backgrounds can be com- ists can easily spend tens of Lhousands of credits in
bined with any of the Motivations or Obligations m medpacs and stimpacks, bacta and physical therapy,
this volume, the EDGE OF THE EMPIRE Core Rulebook, long hospital stays, surgeries, even cybernetic replace-
or another EDGE OF THE EMPIRE supplement to create a ments. Good medical care is eye—watermgly expensive,
unique hisLory for the PC in question. and no one knows that better than Martial Artists.
IN IT FOR THE MONEY There 15 an old joke among spacers that a starship
is just a hole in space to throw credits into. While all
Bounty hunters are, at their core, exceedingly merce- spacers have some idea that owning a ship is a pricey
nary, While many bounty hunter's may Claim to adhere proposition, Operators know all too well the numer-
to some higher order or serve a greater good, at the ous hidden costs of keeping a galaxy—I’lopping craft
end of the day, they all serve one masterflmoney‘ functional for any length of time. First there is the
Those mdividuals in the business who have embraced initial purchase price, registration with various official
their love of credits may seem crass and avaricious to agencies, the fitting out, and, of course, expensive
others, but they are, perhaps, the most honest about insurance. Then come We thousands of fees hidden to
their trade. all but those who travel for a living: customs, docking
and berthing, fueling and arming, repairs and mam-
Assassins would seem to have need for wealth Lenance, and for some, constant and costly modifica»
beyond What it takes to maintain their equipment. A tions. For many Operators, it seems sometimes they
good blade or rifle, a suit of black Clothing, and a ten- are working for their ship more than for themselves,
dency toward skulking and hiding in shadows looks, at
first glance, to be an achievable goal for anyone with and it shows in their receipts,
moderate resources. While this is true, a number of
assassins are very concerned with money Some do not As an integral part of their work, Skip Tracers main—
Chase it to keep Lhemselves in fast ships and high—tech tain a broad web of Informant; spies, and contacts
gear, however: they chase the status thaL comes along throughouL the galaxy. Always on the move, Lhey have
the common expenses of their pml‘esgion—ship and
with it The best assassins are the most expensive, and vehicle maintenance, gear upkeep, medical sorviccs~
but a surprising amount of their money goes toward
there are individuals whose fees are in the hundreds of maimaining their contacts. The constant upkeep of
thousands or even millions of credits for a single job. such a list of contacts involves a I'nassive outlay of
While this money does buy them a high standard of capital in the form of bribes, gifts, regular payments,
living, it also ensures that only the wealthiest, most and loans. IL also requires an amounL of quid pro quo
discerning clients can afford their services—and Lhe that other hunters rarely need to address. Skip Trac~
higher~class the customer, the more prestigious the job. ors Know Lhe value of a good contact, and they know
Lo the fraction of a credit just how much IL costs Lo
Many Gadgeteers are constantly looking for that keep each one happy and reliable
next job, for that next score. Not out of a pursuit of
excitement, or the challenge or thrills, or for a chance Survivalists are yet another group of bounty hunt-
to uphold some high-minded ideal, but for cold, hard ers for whom money might seem largely a secondary
cash. They are Lhe flashiest, often wealthiest members concern. They spend their Lime far away from CivilizaA
of the bounty hunting trade. They wear Lheir successes t:ion—~traipsing Lhrough the trackless edges 0! the galA
on their sleeves in the form of their beloved gear. Fast axy, carrying only what they need to perform their iob,
Ships, powerful weapons, and dazzling, high-Lech equip- surviving on very littlegand live almosL ascetic lives.
ment are not cheap, however, From the initial purchase Their bounUes are found in n‘munLainLop hermitagcs
prices to the constant cost, of maintenance, Cadgeteers amid screaming blizzards, deep beneath caustic oceans
often spend more or] technoiogy in a month than an
average galactic citizen makes In a standard year.
HUNTERS FOR HIRE
m DISINTEGRATION!
of far—flung, abandoned worlds, and in countless places As dedicated as they are to their ships and vehicles,
Operators who put exceptional faith m Lhe rule of
where civilization does noL or cannot reach. In these for law often pursue bounties associated with ship? and
vehicle-related crimes. With Lheir' knowledge of ships
saken places, hunting desperate fugitives, the only thing and vehicles and the various cultures that surround
standing between life and death is a hunter’s training them—criminal and otherwise—these bounty hunt?
ers are uniquely positioned to infiltrate swoop gangs,
and survival gear‘ Conditioning the body to withstand Speeder theft rings, smuggling operations, and various
hostile conditions and making a study of the ways to other such organizations in search of their prey. They
survive in such places are lifelong pursuits and cost no are also commonly hired to track down and recover
small amount of credits No mere training can keep a stolen ships, and many an Operator pays for a ship
hunter from freezing to death on a mountainside, how and its modifications alike by trading this kind of work
ever. Survival gear is also shockingly expensive, espe— to shipyards in exchange for drydock time
cially when it is custom—made for specific uses. When a
slim survival pack costs more than the purchase price
of a new starship, it is easy to see why these hardy free
lancers might be concerned with money.
Nothing makes some Skip Tracers angrier than an
LAWBRINGER abscondert Fugitives who have jumped bail, escaped
prison, or have otherwise run away from a lawful pun—
ishment raise their
Law and order is not typically the first thing that take other types of ire to such a pitch that they rarely
comes to mind when considering the bounty hunt- bounties. They are tireless in their
pursuit of these fugitives, and no matter how far an
ing trade. Most galactic citizens, when they consider absconder runs or
bounty hunters at all, imagine freewheeling loose can- abiding Skip Tracer
Where that person hides, a law»
will follow the trail to its end.
nons who skirt the edge of the law, useful only in des~
perate situations to capture difficult fugitives. While
this is largely the case, there are some among the pro— TaewifintfinonnnrhaosSdedetnarutdlyeudrtpd.teerhsoervd,WoeoeiWfatvifpotrahiena—thfkeewdnelesiestrsahuetertyocjecsasohoottrbiehwnkmwadsdethoieteytorobhtfeoetdegbhefnaerlioeihxosoevuheupnmefbn,enlloioonittatsyihputfrdattepenhhytorshrdte-uwoyeoerntenafsehftbnsa,icnudopacptgenueetrroueeotncdaiwrsnpsttacoyhgabhlfuaeoneyrhwnpprccrluearspottoini—,htrwtrfytelewedesrcis.roamocilssaahsrfuiwtoanmtigohnrafgeOrnertlieuenrdfttearfrghueoeslteerey-,.rl
fession for whom the rule of law is sacrosanct‘ These
hunters consider themselves extensions of legitimate
law enforcement
an unjust galaxy. or, in some cases, agents of justice m
eovf KeArilylsewsrhsaesfrsoeirnsihnireathsehamgvoeatliavaxnayt,eudnasnadbvyoitrsyiosmreseptrtuahtniangtgeionatosntehhaiginrhlky;
minded as a dedication to law and order. There are
those, however, for whom dispensing justice is para-
mount. These hunters often see themsetves as aveng— THRILL OF THE HUNT
ers, using their skills to
wicked—for those who right wrongs and to punish the tTslapptmehhexhruceoeeycertr.ystienmohuThgruaiohustrnisaoetsnthotvutseifamigntsihgmhgtboraeaipornrlsoelgluitoynfhenemcgastantusnyeedanmnnnfibasrteudiioenneansamygnntitsmor.tsetsswpaFebittolcosneoayhreirtranielaleednfmgn,rnsmoeotatauonsonidcssdtrdrdew,ebsceaaoLFhopdhitroauodulerldnwbrleesbotpenyo,aynargmnfuyfuheesdseoluow.,,uinmnsfthtaekeeotsfichrnowstteetdro,eorsrvg,ctehoabotorleloe-;-rf
can pay their fee, at least. ctwghcdawmmmmooaonuiohuseueainMlynnoulccrmtjeosteoelhoeedctnarrgasrrti5moesontttnaydhfidutwtnoewlfaherAqyougamdhbersufsy~aeiosoitiasArnrek.uboenaseigtkWlterrdlssmlveiysmlfaseltcod.hsohsniogor;nenessSeflfsetittltoonhiaeeihdyfsrfmselcne.aektatsryaedhwfirofltnFiaeweitnaAgmsyhuupyrgihstseerpehstterniwhrhteboarophoeaaeeasno—riarnssrociltf,ryecabionkgfnanehrlnoasbgtm’sinoiLn,tbsnoeshsoogltttuiheaekeosotsbnnohidy,rnlteslwcteetaieirlheenetrofAilhofsensogvslsel,etjerelhposocirwapraayrg,wfrorfa,sineaottotiafasnihernwedmarrirgrofine‘s.ndgo.nuassad‘tenaaTegiHottTo,mnhh,hVLnkahteciiehntinaloenheisesimtao—l—woedesyoylt
Gadgeteers who are driven by a dedication to the
law are often extremely
hunt down other slicers talented slicers employed to
through the galactic HoloNet.
aeTontqhhdeueyirpHsmuoswleeohnNtotheteotbirrcceoakamnpkotmuwthrueleendhimcgoaeastntioiolyenf slctaeowtrhmrsorporgiuusotgtvesher,sornfuraiatnnugtddhsechtoeigEmrhsm—p,putaiertnceedh.r
Martial Artists devoted to the rule of law might use
who are guilty of preying
their skills to pursue those
on the weak and defenseless. Lackeys in the service of
a powerful crime boss or crooked politician may have
driver] these characters to the bounty hunting trade
by harming the characters’ loved ones or destroying
the school at which they trained in their chosen com-
bat art. Because Martial Artists do not need to carry
the obvious arsenal of other bounty hunters, they are
often able to blend in with the ordinary citizens of the
galaxy and bypass security measures fixated or] con—
ventional weapons~without sacrificing any of their
effectiveness,
HUNTERS FOR HIRE
NO DISINTEGRATIONS
leave HEW: hints L0 their presence and purpose Where sound and danger of a faSt Chase, The faster and
We” Larggts can find them, and ratcheL up the pres— more dangerous, the better, as eacfi Chazc proves ma
fiL'm and par‘ar‘loia before delivering the killng blow superioriLy or'their pflomgsldlrs, L|"|eir's|'1i|:>3, and L‘mflr
ability Lo Squeeze every lasL bit. ol’ performance from
H” “19"“, a Clean, fast kill, while efficient; and profes—
their trusty I'nacl'1il’1es.
iilonal, is har‘d‘y worthwhiie at all.
Skip Tracers are the cor‘lsun‘lmate urban hurlters.
Gadgeteers dedicated to the hunt are master‘s of sun They use their arrays of conLaCts and inlomlamis as a
Vfi‘illance and im‘Or'mation gathering. These hunters love spider uses iLs wob~~drawing their prey in slowly then
pinning [hem dowfl for capLure. Skip Tracers are dedir-
a good stakcout, a long night m an ar‘lomymous SDGGCICI" cated L0 the Chase and ITIEISIZEI’S of mo LaH, of Hack
ppm“ kimld out with a highied} array of sensors and mg a single Individual unseen Liwouglw a 5Lmet choked
memflg apparatus, They spend their Lime building with Llafliic and pedestrians, and 01' panemgly waiUng
surveillance systems of ever—increasing complexity and for [he perfecL moment; [0 ad... Skip Tracers I’notivated
SGHSMWW, and studying any security used by the target. by love of the chase are moLor'IOLIsly hard Lo shake ’
Patient listening and watching are these humicrs‘ most even among Bounty Hunters.
[undamer'ltal teclmlques, and only after everything has
been recorded and analyzed do Gadcheers strike. Survivalists’ knowledge or Lrackmg semienLS and
Martial Artists 506 nearly every bounty as a tbeasts alike Lhrough LmLamed wilds borders on me pre»
chance to 1303' and refine their SIGNS against: worthy Lemawral, They know just. what, [,0 look for; jusl. Where
ODDOnents. Each LargeL presents a new set: of obsta—I to place their feet, and just how to track a hL—footed
{4'93, and for each new seL of challenges, a new set of fugitive in the dark across a plain of |"|a1"dApad<Cd clay
Skills musL be honed Lo overcome it. These hunters The Chase con’1esnaLm‘ally Lo these hunters, and those
prefer the running, sneaking, climbing, and tumbling who derive their joy and satisfacLion [Tom the pursuiL
asbects of the hunt. They usually do not Lake on cor'r itself have been known Lo prolong the hunt by taking
Lracts that they view as too easy, for these present no their Lime and giving their targets numerous
ODDOrmmLy for them to advance their" Skills‘ Chances to rest or' escape.
Flying full tlwrotLle through tumbling asteroid field 8
0f tl'n‘eading high—powered Speeder bikes L‘nroug h
crowded thorough(ares, Operators are the masters
Of the Chase Pushmg their skills and their vehicles
to the limit, these master pilots revel m the
BOUNTY HUNTER OBLIGATIONS
m ost Citi/Cns of the galaxy COflSidCI” bounly hum 'mLmLy humer' 13, hOWBVGI", Lherc is always someone
org 1,0 be a necessary (:VH‘WDOH'I a fayrmvlpm 0(' or someming from her previous vm‘zlrures waiting Lo
cxtracL a biL of rrlonov, l‘avor, or revenge. ’lhe past is
and an answer Lo the growmg lawlessnesg and unresL as dogged in its pursuiL as any i'wnlfir’, and il: has the
advantage of time.
LhroughouL the Empire, Neither true law erflor‘cemenl.
AH Obligation helps define a cl'laracLer, afld is
officers nor CiViHaH vigilante; Lhcy inhaoil. a moral and imporLanL both mechanically and 1,0 the character's
narrative II. gives; 2.: cl’mractcr pathos and drive, and
often legal gray area where they are both bound by helps Lo Mesh out; Wl'l’rJL might otherwise be onc—
the law and, at, Umes, above iL. They carry out a hand» diI’r'Imslonal dwaracter. ObligaLior'IS help explain why
[LII of'jobs usually perfom‘led by law enforren’lan, buL a character is a bounty hunter and give both the
are not, constramed by the rules and r‘cslgflctiionr; 0| AI player and 1,heGamr-2 Mastera numberofsmry hooks
bonded law officer. They are answerable only Lo their to call upon Ll"n“0ug}'10u|. the cal‘npaign. IL i3 important
employer, and are alien only loyal to me alrmg'r'uliy to remember that: characters can take on additional
cream-a moral compass that. offers dubious heading Obligation in exchange for extra ir'rgarr'le bermfits, but
at the best of" times. LhaL makes il. I‘nore likely that: their Obligations will
come calling, likely at imonvenient Limes.
The ways in which an individual finds herself in WI;
line of work are as many and varied as the bounty Players may use Table 1—1: Bounty Hunter Obli-
iwntgers currently operating in the Empire. Some are
chasing an easy credit; others are char-sing glory or gations in place of Table 2—1: Obligation on page
vengeance, or simply enforcing the law m their own
particular way. The life 0m bountyhLmter~esser1lially 59 of We EDGE OF THE EMPIRE Core Rulebook, Players
a fr‘eelamc law enforcen'lent ofriicorais a hard one, It
takefs hard work and ambition to find success in such can roll r'andorr‘lly on the table, or they can select an
a cutthroat busin as and those who are successll.tia1re
Obligatior'l that they fem best: fits their character’s
often some of the most dar‘lgcroug and feared
motivations and background. Each character
individuals in the galaxy, No
matter how schessfui a starts with an ObligaLion value based on
the size of Lhe player group ‘
TABLE 1-1: BDUNTY HUNTER OBLIGATIONS
dlflfl ‘flngafinnType
01—08 Thrill Seeker: Some people are addicted Lo alcohol or chems. others Lo gambling or other seedy vices. This ‘
‘
character, however. is a confirmed adrenaline junkie and chooses bounties not by their challenge or price, but by
how exciting or dangerous they are. Avoiding the Obligation—perhaps by being a responsible business operator \
and considering every job's cost benefiL analysis—results in an almost immediate case of excitement withdrawal. ‘
When inactive, the character is edgy, moody, easily distracted, and germrally unpleasant: to be around.
9—16 Vigilante: The character has seen the whee‘s of justice grind up [he immanent and let the guilty walk [190. The
character hag sworn Lo take the law—for a version 01 it, at any rate—and m mg justi Lo those who deserve 1L,
When Lakil'lg on <10nlracts. this (II'IENFACLCI’ tends to pursue me mos-2L hardened (.‘rimirmlia,
l7~24 Blackmail: Some group or individual has dirt on the character, and is using it: to the greatest advantage possible.
Perhaps she kiilcd another hunter and claimed the bounty, or maybe she is operating in the Core Worlds without
the required Imperial Peace-Keeping Certificate. Whatever the case may be, Lhe blackmailer wields an inordinaLe
amount of power over the character. However this power is leveragedanoney, favors, services rendered~~~the
Character is subject to the blackmailer's moods and whims, lest the dirty secret become common knowledge.
Contract: A powerful and stlict comma binds the character to a specific enmloyer. This could he :1 crime hogs,
an Imprwial commier, or a wealthy comorate CEO. Whoever holds the char ‘UJI‘S contract hag neat ly total control
2Jr_7J2 { ‘. I
' 1mm;
“4+0 over the . future career. All are ~ by the corm‘act holder, and (,lewatmg [mm the 1
hom'ltms ‘
CI‘Iaractor 5 lurmshed
of the corm’ad. can lead to a number of potenLially harsh fines and punishments;
3
Rule Breaker: Either the character very pubde and flagrantly broke one of the rules laid down in the bounLy
hunter's code, or everyone wrongly believes she did. Whatever the case, this breach of Lhe mixes of the code
affects the characLer's personal and professional life in a very real way. Contracts dry up, colleagues refuse to
speak to or help the character, or the character is treated in a condescending or irritatingly sympathetlc manner.
41448 Debt: The dwaracler owes quite a bit of money to one or more individuals. This could be money owed to a
shipyard for some expensive modifications done to the character‘s .9in on credit. In [I.u'1d:~~;put mm. by a patron
who backed the character's entry mm the bounty I‘Iuntars' guild and expects 10 hr.) repaid or 'amvir‘zr»; rendrnud.
49—56 Betrayal: In the course of the job, the character has either" suffered some kind of deep personal betrayal at the
hands of another bounty hunter, or is the perpetrator" of such a betrayal. The betrayal affects the character's day
51-64 to day life, whether through physical ren‘xinders, emotional scars, or some combination of the two. If the character
was the betrayer, Lhe victim may come looking [or answers, compensation, or revenge at any moment.
Family: This hunter's family holds an incredible influence ever the rzhalaclel. PUI‘hapS Llle PC comes from a long
' lmc of boumy hunters, whose honor mug! be uphcrd, Altmnatcly, UN) bounty I'1I_ml.r_>rr:r)l.1|d altao be studportmg a
Struggling (army, and is always cage: [0 pick up contra “1:- IO send Immzy homo.
65772 Favor: The Character owes a favor to someone in a position ol’ power: However this favor came about, whether .5J&; 5,
75780 1 personally or professionally, repayment of that favor is coming due with interest. This favor may be called m all at
.
once, or a little at a time, prolonging the character's Obligation
1.’
Criminal: The Charade: has; been accused 0f con’mliLting a arin'm during the LUHGCHUH ol' 2': Irwgsfl bounty Tln';
could be anything from stealing a speedel m order to chase a fleeing fugnlve, m iHlUIHEICI'ICU wiLh banded law -:-‘
‘ 2a
‘ enforcemem to killing innocmns; during a ESI"I')(‘)U.)L|1,W!‘IaL(‘V('§I”H1L‘ LEO, Hm (inmslanl Ullwll 0! vhsmverv and
incarceration hovers over the r.:hamcter, Whullw HM) :Ir" ' ions am Hue 15 IIIUlDVEiHI; the Characm has been
accused and more is an outstanding warrant that. makus the PC an appealing target to nther bounty IIUHLL‘IS.
Keeper of the Faith: Much to many other freelancers' an'msement, [his character has sworn to faithfully uphold 3
both the spirit and the letter of some code of honor. The PC believes very strongly in these edicts and adheres to
81~88
89—96 them with an almost religious fervor, The Character never knowingly breaks any of the rules laid down in Lhe code,
and may turn on colleagues who do so.
Fame: [he character’s rcpulann mats a Iona, she‘ldmv, Perhaps the PC look a Izunous and difficult tummy. rn
owns a lecogmzame and deadly Ship, 01' has beaten Hummer wall knnwn hunml 1.0 the mud. in NW mat.v\/h;1m\/el
Li‘u) case. it is hard for the Ci‘laraclm' 10 move LII'H'rOHCCd lln‘omzhrmt HM: galaxy. Tl'li‘i makes; t rwmt Uporntion‘a IH'HU
diffifiUlL, but also means that inlormants. are mom likely to spiH what they know whrm the PC :mive's.
9 l" I 00 Roll twice on this chart. Starting Obligation is split into two different origins. [This does not increase the
Obligation's magnitude; divide starting Obligation into two equal parts. each with a different type.)
HUNTERS FOR HIRE
NO DISINTEGRATIONS
PREDATO RY SPECIES
lancdtiviinduaanlsimwphaorLiaaslaemsasnna esr itauraetioomftenobwjeecltliivseuliytedantdo whom feel that their species’ cultural and techno-
logical contributions to galactic culture are ignored
lives as bounty hunters. Emotional attachments and because of the fixation on their very peculiar genetic
irrational decisions are obstacles to success. Ulti— ability. Because of their shape—changing talents,
Clawdites remain in high demand for careers focused
mate1y, bounty hunters are mercenaries, profession— upon deception, including espionage and other; ever]
less savory pursuits. Their natural abiliLles and scar—
als who musL constantly assess the costs associated city give members of the species legendary status as
with completing a spies and informants. Rumors of a Clawdite’s pres--
job against the reward offered for ence naturally alert guilty parties to be more vigilant,
It When the costs abruptly change, a good bounty while a crime lord who reLains a Clawdite’s services
gains prestige through the hire,
hunter needs to be able to back away from the job. If
a panicked target makes an emotional appeal, then vwCsactpsttttitSopayitPrronihhnhrooietureorerrouhdloaeheeoefitaeulpurleetmevurtlyrrilfyewgedeoestrteenareeaissvrehe,nalmwdfsgcainluleaoiaeaitcioitstOtsntttsidiarhtCintaperntlotlieenmyetvonoonoaaosldlrgxaawdkdung.ttfbktornCwne,twtanyieudkTaohaieltotrntnuldh:dlvherhawahebeaiweeeteltoaeergipgtiwrsih.CsmkleotreCpoei.ohytetdmdesttlaihytihlaoHhohIneialgohxnsbrtaawdiineagesowrpcreoniysetsiepnrtwdtrsenridshefeamouovOietsaasceittyenroahtaehfbtsunitvoetpufpt.iatafosreslhetrrueseimiietnaetgcptocyr.mThinhd,ndslouahiuayhnaalcTdedse,dynreaaslAeieetmhele,iofulrsryrsspvadfedteaanprtattioepouuinaashleodtrsoinmrorneunganldewfrvpentythgplngirehyeaateahqlatefphasugeihantaoclseulgmhs,treyelmCeltrstt,enpaeiaaeumiisnuannnlnrcaclwgajoaitgaeroiearsgdtthonnieewfilchnhcfb,vclbesmoesyoewtedtetteihhiy,tircoithnlclayidnrphhsrioitaeotseteeftaheerSyrbeplipmisdrvctoorsnhmri~eeehhcrefaipmrayairttvoeseugoirorlegmsnzeatywhfusisthphtmcuCkrredahrtheieopoithiigliifnn.lbeneaslastmdraeermgsytetseyftTbo,wtheocehfkhehgwoirtfteiitdClapswwnahmLnahlhoeOryiisaaohWdmueetflelhsiameSulettWlawyiegloyhyoines«a-,t,‘rt
the hunter needs to resist sentimentality, recognizing
that emotional weakness has severe financial implica— asctcopmeplahakefhrngsreeinCinyaltpvymihsbrtleeahtmeisloccsewesiiaaniTorokfidritlenhpitclclinhyty.ehsheaemakissscUtisiprhnnpeteswhpirelhcsilciaenistnaalhaoovl.ga,krtateneliryTtcpadaaatdthnehnwnkaisde‘sidcecsoCyn,sehsCyeghtoicathnrrleinonanooCehemnwgwmOendttihcdlnrraaiocpeofiaigrsbftto’anloeep.,lnerwtpstrathesTahscpaawcnhtoiyhhtoittteiryoytrefehrautssemshfittihishnooqsrelaseyeluutiophttricdiforegrfiaaoeiesisbcnctnCs.cyiodateehtelrdhRlapnsoaxwyewrtetnli,arsicpagdtpctpasahleiitriastttnciarwcscpregatceteiitcrtphlttccCi.hheuiieechafl—tmaaSregni»rt‘t
tions. In many cases, these traits come from an indi« mmnaamBlseoascrbaiinaluiltstiteeherseaCttpiloaorownscsdheiatsteposse. t~Tdhcheehisi{ar);flCsémfliz’deee,aUbnthpaseosnyethdtachatoenntihrnteobhytoedaicryalt’dneser mnintsthaeitekry—ei,r
vidual's social background, which can often be linked
to their species.
Droids make some of the best bounty hunters for
this very reason. An assassin or combat droid repur'»
posed for hunting is programmed to completely dir-
regar‘d any emotional response A target who begs
or pleads doeS Httle to improve the odds of escaping
from a droid.
Many other species with strong predatory instincts
are inherently capable of success as bounty hunters.
This includes Clawdites, Devaronians, and Kallerans.
However, individuals from countless other species
have achieved notoriety without that cultural and
SBLdopeneheuretyll'kdiessaurtioimotgchflaoisentghxaaiheacntaimadovglnepMrlebesaaaasunntccedtokucsf"ge,tprtehorrhedeeuupesninrapddtreSe.ecarpd'tsseCinvcaebeioedslofyssu,..hBnwiastEyenvreteeih,mnuhenalat,LhreDdodruslruyi,rae‘oCntshsht,ooauawraghnacihdssi
Ultimately, a bounl‘y hunter must rely upon
instincts and personality as much as physical abilities,
eAoDretriyqfsfuepsoihrerfeecasnidpektesil”fshlohucrtinrfoatstimeniutrsgcbsc,,inecssaaaustnric,eohnancsobahresianedneveodexfipcttsiaahauncelc,tdyicceesbgds.uustTastrhehatinhrsnosetuoceyargeyrhearreoeaerrsgvuuanalltntorsisi-.t‘
statmhoeaanpcnstroeeonolfyicntoaeedfdbeielppneeehfrneamsdripleausennrceunttepitviorofe,ntahwiteschhheicloaeofartsaebrtcesniltcietboyare‘gsctnloeoiSzamcpirnoeengcmeitedpotshlo.eetrtehaniigtehhcu.renasTttsshhieatiynrt
CLAWDITE
eaTatNhxrhxaeeyipstiirovptkherrnitianmsattn~ocaaktlr'0ttaiehglryerteahakxnpebnctlsaioelcinwethtyhednaetsgtaZrosaicnopnrleoaytorcsnaisfoenfismnsthtfaahoethnrevmeyriarelusCMhettlohiadomtewofidRerttihwihtmeaeeosp,r,gpllCadaesr’lslagaoarewmxaorydnetgihctafeeeool<s.rrf
HUNTERS FOR HIRE
NO DISINTEGRATIONS
1% {3311' ,V Kalleran
Clawdite ‘. d"
but they cannot substantially grow or shrink. Their symdlcates, and military organizations. Now, Ciawdi
humanoid anatomy also prevents them from mlogat—
mg organs, except in superficial ways. To heip offset iLes are found all across the Outer" Rim-v Lhough some
this limitation, some Clawdites wear an automated Clawdites live in secret, preferrh'lg that; Lheir acquair‘l-
saline pump. This enables them to adjust the amount [ances not know their true species, lam Lhey dier’usL
of fluid within their bodies, increasing their" abihly to them for it or worse, try to exploit Mi.
change their size wiLhin a limited range‘ Homeworld: Zolan is a warm and arid wofld, iocatod
eSOCiEty: Clawdites have a particularly rong mc-Una- near the Corellian Run. During the developmem 01‘
the Clawdite species, a spike in solar acLivity bamed
UOn toward individualism, and many have a dime-UH:
Ume forming dose bonds, everv—ox' especially/4mm the world in radiation. The ClawdiLe’s abHity to mod
members of their own species. This is in part because ify their Skin color and body shape was one of many
trusted con- adaptations that r‘esulLed from this rmszive change
Of the mutability of their appearance. A in Zolan’s Climate. The predatory momu and numer
taCt COUId vanish with a shared resource, org decglt-
ous oLher species from Zolan share this traiL, though
M individual could easily assume anoLher’s Idermty. many species developed different means of surviving
society on Zolan has dgyel‘ despite Lhe ongoing radiation borr'lbardment. As wim
As a consequence, their Polmcal any event that disrupts a period of cwflulflonary stai
006d various r‘neasures to verify identities. levels of sis, most M Zo‘an’s lifefor‘ms were Lmablc Lo cope with
and social organizations depend upon high Lhe 1'16igl‘1L6flGd radiation afld died Off precipitously,
and those that remained dramatically shaped by it,
redundancy, and records are maintained m the ope’n
so that individuals can freely validaLe one Hex-mothers Zolan’s radiaLior'I levels evanually reverted Lo a more
WOW Nevertheless, personal responsibility gm
survivable level, as its sLar’ complel,ed iLs eereI'r'le radia—
accountability have remamed Challenging prl‘nuplés Lion emission cycle. TraiLs developed to survive this
LO em’OI'Ce across Clawdite history. Most Clawdltes alte catastrophe were turned to new ends, resulting in a
greulayrdOendcoenvevnerswahteionnaglreceuteinsganfadmpiliearrsomndaiVlitIydulailjlagI,LsanIad:" number of species that could change their physiology as
more than physical appearance to verify identity. well as oLhers with Lhick bony plating Lo proLecL agaimsl;
radiatiorm Beyond that, the exLinCtion evenL reshaped
ClawdiLes’ emtr'ance onto the gafactic stage an large Zolan, Large portions of Lhe planet becarr'le desolaLe
wasLelands. Most of the plants and ar1il'1'1al3 mat had
had a substantial impacL on their culture al'ld‘h'O'W once dwelt there Were eliminated, and new life forms
they Viewed their ability Their unique si’Iapesl'nflmg (my slowly crmr‘oached or] the most devastated regiom
perfect spies, and many
Han, made Clawdites Lhe by governmemls, crln'mal
hired Lo work Off'world
were
HUNTERS FOR HIRE w
N0 DISINTEGRATIONS
This pianeLary Lramsfor‘rr‘naLion had SCHOLIB‘ reper- SHAPESHIFTER STEREUTYPES
cussions on the world's environment, as well as its
ability Lo provide for the Ciawdite population. In fact, Clawdite’s natural appearance is easily
the resultam scarcity of resources very likely conmbi recognized, particularly among those who
uted Lo the cautious and selfirellanl; nature Of Clawd- regularly work within the galaxy’s dark under—
ite society as it developed. belly. Crime lords who hire a Clawdite are very
proud that they have a shape-changer in their
. '5‘ ' Language: Virtually all Clawdltes are fluent. in Basic: employ. The species is uncommon, and having
Zolanese is their native Longue, though it, is rarely a loyal Clawdite as a member of an organiza-
‘ heard off the planet. Clawdltes generally refuse to tion carries a level of prestige. Further, most
teach Zolancse to offwor‘lders, and it is used as a pri— syndicate leaders believe that their allies rec-
.y.‘ ognize the Clawdite could be impersonating
mary language only in the rural regions of their world. anyone in any situation. This can be a strong
During rare offworld encour‘nters beLween ClawdiLcs, motivator for a more honest relationship, at
they often use Zolanese as a secret: language to Idem: least on the part of their allies.
tify themselves without breaking [heir cover:
Fora Clawdite PC, such expectations can repre—
-H,.\. Life on the Fringe: Clawdites excel in careers that sent an opportunity or a challenge. A Clawdite
prioritize independent competency. Though many who does engage in various forms of skuldug-
gery might enjoy having employers pay more
rer upon more nefarious [or'at least (self—serving] for her work, while one who is engaged in honest
trade may be frustrated by clients‘ unfounded
applications of their shapeshffting abilities worries that anyone they meet could be the
to work as Smugglers or Bounty Hunters, Clawdite in disguise. To help alleviate such con-
many other Clawdites work as Explorers, cerns (even if they are unfair], some Clawdites
Technicians, or in specialized Colonist; teach their friends and business partners how
roles. Many Clawdites who originally to identify them by their behavior and manner-
hail from Zolan prefer selli-rcliar'lt isms rather than just their looks, as Clawdites
generally do with other Clawdites they know.
professions over which they have
a high degree of control, rather
than having to trust that others
will act in their best interests,
PRESEN'EE“ ‘
0 Wound Threshold: 9 + Brawn
0 Strain Threshold: 9 + Willpower
0 Starting Experience: 95 XP
<9 Special Abilities: Clawdites begin the game Wim
one rank in Resilience; They still may not train
Resilience above rank 2 during character creation.
9 Changeling: As an action, a Clawdite may suffer
5 strain and make an Average (Q Q) Resilience
check. If the Clawdite succeeds, she changes her
appearance to match that of a silhouette 1 char—
acter whom she has Observed before, An observ»
mg character must make opposed Perception
vs Deception check to detect that something is
amiss with the imper‘sonated char‘acLer‘s likeness,
Dorlmannerisms, or behavior. As always, the CM can
add for situational effects that might affect
the check, such asD if the Ctawdite‘s garb does
I"1,
:1»
not match expectations or if the Clawd—
Ite has studied the impersonated indiv
Vldual’s mannerisms closely,
D EVARO N IAN extremely unpleasant when inhaled]. When a Deva-
ronian breaths in sulfur, the substance rapidly enters
Known for their history as explorers and their striking the bloodstream, granting the Devaroniam a burst of
prodigious strength and speed. However, sulfur is one
[and often intimidating] looks, Devar'omans are a spe— element that their livers cannot. Cleanse as effectively
cies familiar to many galactic traveler's. Unlike most over me long term. Extended exposure to sulfur can
other species, Devaronian explorers actually made have serious medical consequences for a Devaronian.
contact with the greater galaxy long before the Repub-
Society: Devar‘onian culture 15 primarily matriarchal,
lic officially discovered the other inhabited systems m no small part because Devaroman men tend mm to
stay in one place long enough to achieve leadership
near Devaron. Members of this entrepreneurial species positions. Whether these tendencies are purely cul-
tural or have a biological componemt remains a topic
are a commom sight in spaceports and other centers of dispute amongst both Devaronians and offworld
of trade, and they are found all across the Outer Rim. academics. Devaronian women, by contrast, tend to
value security and prosperity, and have traditionally
Devar’onians carry the odd burden of resembling been the architects of Devaronian society, building
the mythological demons of many galactic cultures. and maintammg its cultural institutions and physical
Because of this, they are one of the galaxy's most structures alike. Thug, most Devar‘onians who become
distrusted species. This created numerous n’flsunder- corporate and political leaders, enter law enforce—
standings during the early days of their species’ expan- ment, or pursue other careers with strong long—term
sion, especially as they encountered galactic denizens prospects are women.
unaware of life beyond their own world‘ Though Deva—
ronians are no more prone to diabolical bargains than Male Devaronians, for their part, are more likely to
any other prominent species, their reputation still be risk-takers, driver} by wanderlust and the thrill of
suffers because of their looks, Anyone who has tread new experiences. While not averse Lo creating lasting
the galaxy extensively [or even visited a cosmopolitan emotional bonds, most Devaroman men stay m a sin—
watering hole or two in the Outer Rim] likely knows gle place for only a few years before moving on, if they
better than Lo judge a Devaronian by looks alone, but remain that long Male Devaronians who start fami-
newcomers are shocked every day when they see a lies often support them while working remotely, tak—
demon of myth ordering a drmk in a bar ing on positions where they can send their earnings
home While sLiH satisfying their desire to explore Lhe
Through their species' collective Space travel expe— galaxy—thus many become starship hamds, traders,
rience, Devaronian explorers played a role in mapping or even smugglers. Those who remain in one location
the galaxy. While some of this work was done under to raise a family or maintain other relationships tend
the authority of the Republic, indepemdent explor- to Change professions more often than female Deva?
mnians, and develop a wider but. less expert pool of
ers‘often with strong economic motivations—discov— Knowledge and skills as a r‘equL.
ered and classified many worlds‘ Some Devaronian Of course, many individuals and even some culLural
organizations possess maps thaL are believed to be groups on Devaron defy these gender stereotypes.
more detailed and complete than evem those in Lhe No few Devarox'lian women are starfaring adventur-
ers, and Devarorflan history contains many men who
official records on Coruscant. achieved promirmncc il"| a single insUtution or field.
Still, some visitors to Devar‘on are initially surprised at
PhYSiology: Devaronians are a bipedal mammalian the seemingly low number of male Devaromans in me
Species. Their skin color ranges from red to green, upper echelons of society on Devaron, as compared
and a pair of pointed horns dominate the male Deva- to vastly the I'Iigher ratio overall among the species’
ronian’s head; commonly, females have dark, vestigial offworld population.
Spots in the same location as the male’s horns Deva~
ronians’ mouths are filled with sharp pointed teeth, Homeworld: Devaron is a Lemperate world in the Colr
particularly effective at tending the meat that domi- onies region. The planet includes dense jungles and
nates their diets. Besides these identifying character- cooler nwumainous regions. The species has estab:
istics, Devaronians have a great many physiological lished prosperous cities in most regions of the planet,
Similarities Lo humans#mougl’1 few observer‘s would though the oldesL and most populous are within the
low mountams. Devaror‘l's jungles are home Lo a range
Confuse the two species. of dangerous predators, which cormnue to thrive on
the largely Civili/ed world. Journeys 1:0 these wilds are
Devaronians have black, silver—based blood. This dangerous for even accomplished explorers.
unusual trait is linked to their particularly thorough
blOOd filtration and cleansing system, Members of the
Species possess two livers, which constantly Cleanse the
body of toxjng and camnogens, This grants them an
exceptionally high resistance Lo poisons, also enabling
them to consume foods that are toxic to other Species.
Devaroman physiological quirks cause sulfur to
be a particularly cfl'ecLive stimulam [unlike for most
other OXngfl—bI’CFJU'ng SpGCiGS, WHO “Nd SLlllel’
HUNTERS FOR HIRE
no DISINTEGRA'HOHS
LUST AND HIDDEN REASURES
D evaron’s jungles are expansive and largely dangers that led to their abandonment may still
untamed‘ Few Devaronians ever travel to the remain active. Finding and salvaging the remain-
darkest and deepest portions. Since the advent ing goods in these sites is an extremely profit-
of space travel, male Devaronians frequently ven- able opportunity, but any venture into the jungle
tured offworld to stake their wanderlust, ignoring means facing lost and forgotten dangers as well.
the far closer wild and Lmexpiored jungles. In
spite of this. Devaronian empires have risen and Player Characters might uncover maps or jour~
fallen within the jungles for tens of thousands of nals that identify facilities concealed
years. and remnants ofthese societies can still be ron’s jungles. A mine might still have by Deva‘
found by intrepid explorers. Over the millennia, a vein of
countless enclaves were built far from the sites of ore, which could be better obtained with neWer
modern-day cities—including a Jedi Temple that technology A pirate's base of operations might
remained active during the Clone Wars. have treasures that were
droids that remain active carefully guarded by
Many of these facilities continue to harbor valu- centuries later. A lost
able goods even millennia after sentients last city could still hold the treasures of those who
dwelt there, but the plague that killed its inhabit-
used them. However, the predators and other ants might yet linger in local wiidlife
it without displaying the symptoms. that carries
twmhoeiDgrlhedttescprsehietmeneoatlDihoneigsvyuaanrs‘ttooanam’cssleetrldaoarnnHggthoeewhiceshlvtoooecrriayc, l,ewHthFhooielrreaa,jusnoDspgmeelevecasieSmsopnefiwactiinhethses and cultivating crops in the jungle. Thanks to Devav
r‘on’s long and ongoing involvement in galactic
explo-
ration and trade, however, certain technologies are
Widespread, making sur'vlval in the jungle far easier
believe that doing so would be shortsighted and fool; for the current generation than it was for" their ancient
ish. The dominant form of plant Me Wthin Devaron’s
jungles is a partiCLHar'ly hardy vine, which intercon— ancestors, who lacked such equipment.
necLs and grows to form massive Lendr'ils tens of Language: Nearly all Devaromans are HuenL in Basic,
meters in diameter that; run for many kilometers. though some speak localized dialects specific to their
CLIlLure on Devamn. Relatively few study the ancestral
obef Tlothhwee.sejTuhntegelnendaraittnusdraolefvtpeeannsscraeoganeccwheaayltshtehtehuepsbepaseicrcmretoaestrertaimlnevaelkialesr language of Devaronese.
travel through the jungle far easier
than it is on worlds with similarly Life on the Fringe: Deva romans have become increas»
lush biospheres, and while pr’edaA GsOeotilnihofnfueguecdnatltiiyhssreetey,trnylpaeap.RErsstaoiumsDmrmoortepaifcciviolniruEaaevdeltxre'aesunoprrdtrnllodaytihariibsnewenaitrlrimsitutlthrah,yseose~tCzn;ttmogohoIFu(le3aeofrt.w3cihmkra8eeelsdimaecteslLinlpevcm,hsspialeseaiedzmosfleaeasfdsdradaa,vaeBlnlolpisosncrsoiouyrcoaprm»trabesittaorsuyllteesn.m;mHsabT; uWesehaonflcCesHLatfH‘SeUilrtetreShhs6gO1dee.e»3f’
tors are a threat to travelers far
from a city or town, there are
few creatures on Devaron that
cannot be dispatched with a
well—placed blaster shot.
Further, the biodiversity
of the jungles offers
Devaronians numer=
ous advantages, eC0~
nomic and otherwise,
especially in a galaxy hold: H '|- Brawn
where many worlds Strain Threshold: 10 + Willpower
Starting Experience: 95 XP
have been reshaped 0 dSWmup.aitrheyincgonianolCet hAtrraaabrnianilkcittSieienursrcSv:riu’veDraavleLivviooaarnlr.DooCrrHCDaGneDscUeObpHetgioainnb,otvhTeeheragyna8mkUC2”
into vast, planet:— o ConRfaheettsuhcireklaiselSlnytphteehMcyaieremsdtyaaakbadeond. dliasrumetso:imsDtaaetnvicat rto%orntaotonxinapslhl. yRMseieosmliolibegenyrc‘Sei5
sparming cities.
Devaron has a few
industrial cenLers
and some large
Citigs, but many
Devaronians live
in small, tight
knit villages and
survive by hunting
KALLERAN for others in a variety of fields. Others, however earn
reputations as independent contractors, or as mésters
Descendcd from a scrni»amphibious stock, Kallerans In a broad range ofdifferent fields. For these Kaller‘ans
Y
We a lesser-known species, native to an isolated world their starships become their true homes of Choice
m the Outer Rim. Though Kaller was a battleground Physiology: Adult Kallerans average over two meters
during the Clone Wars, neither the plamet nor its peo—
in height, standing eye to eye with a Wookiee, They
Ple ever achieved prominence on a galactic scale. This are slim for their height, though their physiques tend
'5 partly because the species has never been united
to be flexible rather than spindly. Kalleran feet and
Under a Single governing body to pursue expansion hands each have three fully prehensile digits, arranged
in a radial manner. They do not normally wear Shoes
beyOnd Kalfer’s orbit, Further, extraplanetary invad— preferring not to restrict their ability to grasp with
their feet. Their green skin often has distinctive black
ers have occupied parts of Kaller on multiple occa— markings, which vary in pattern by individual,
S'OnS throughout the last few thousand years, limit-
mg the Kaller‘ans' ability Lo expand their own culture
aCVOSS the stars as they grappled with the influence
0f Colomzers‘ From the Republic of old to the Pykes Kaller‘ans are not capable of respiration under
to [he Mandalorians, many different powerful groups
aCY‘OSS history have had a hand in shaping Kaller~ water, but retain one key holdover of their amphibi—
Some as economic partners and allies, but more as ous ancestry, as they breathe through their skin as
Crue| Oppressors of the regions they controlled Other
parts of the planet, especially resource-poor regions, well as their lungs. While they do have lungs, a sig—
haVe largely been ignored by colonizers and have
far back as history records. nificant portion or their respiration occurs directly
been ruled by Kallerans as outsiders has directly gov— through their skin, freely drawing oxygen from the
While no single group atmosphere while releasing carbon dioxide‘ A con-
of sequence of this respiratory system is that Kallerans
erned a majority of Kaller. many different species and must consume more water than other species of com
parable size, Kallerans do not have noses, as there is
no need for them to be able to breathe while chewing.
Cultures with wide galactic influence have a stake in Kallerans have antennae that move in an animated
the World’s economic prospects. fashion as they carry on conversation. These are often
used to add emotional emphasis to particular points
Kaller’s location and its matural resources have both of discussion. The antennae are also sensory organs
for the species. These are their primary olfacLory
, receptors, as well as the secondary aural receptors,
The fin—like structures located atop and to the sides of
made the world an important targe tfor other groups the head also augment a Kalleran's sense of hearing,
W'tary and economic expansionism. system providing extended surfaces to detect sounds.
The
SW3 at the intersection of three different hyperspace
’TOUtes. This has made it a convenient layover point
I‘Or Obtaining repairs, transferring cargo, and refuei—
extended journey Plateau
”1% between legs of an and surprisingly cosmopoli— Kallerans have a higher muscle density than most
CW Kaller's preeminent humans, but oddly, they are also more susceptible Lo
tSbrtoaeUlaflmrnhpaSaer'iipntng.ad-mclAveegapllyvtuohaarerrtbe,ielssewtihyliaeeesenoxrtfpbovuhdroiaitlftlsrfued,lmowreaneonngodtodafgrtahoffrrreeeobimgyimnhfdtitoenhurreeessrtiagrkivlnesaisslliinnatiauntnerdtgoreutrttsnhheteedes harm As a Kalleran’s skin is a key breathing organ,
“7986 and other productS drive much of the KaHeran damage Lo the skin can leave a Kalleran substanLially
weakened even if internal organs are unaffected As a
economy Lo this day. result, Kalleran combat Lechniques tend to put an even
higher premium on aVOidance, redirection, and use of
oW0CmmtKOLfmah'NFtlteuhlLmhoge‘rsVeer‘rree‘oiEtrVaaSunhtenncpuherddoasmeirntnheidpfoithelnrsiafoocyflrgutmrustseo,cseeesavtnwlgotgneolcurei,acrteonhrralpcawsmle,cionltoKesttfiio,cncanoatrtlghlKsiulseveatoragtsralhhclrlsiensedoiae!s”uevatgeepirWhersoseasgv.hfseretifowolHuarenruidrotnetphswh‘vsmnseeeoeawvoirmanrnerigttebershaai,endiecnitbKvneponseaavarntcenlmelrtaeestiuscnau‘attrlueeugsac—Idedehenn their flexibility to entrap [003 than other, similar styles
Society: Kalleran society places great value on personal
achievement, and has much less interest in collectivism
than many other cultures. Kaller has no history of acting
as a united whole, and many galactic organizations hold
some mr luence on Kaller, so few Kallerans join ideologi«
cally drive n causes like the Rebellion [or Empire],
Homeworld: A Lemperate and arid world in the Outer
Rim, Kaller is the native homeworld of the Kalleran
Species. Its binary star system has led to a complex
by a Single alliance of Kallerans. Susypesoetnemmiintsgloylof cmasetiilaodsnocnionanlidtsiwtiooeanrbtshitetrrr"ealnavstaiivtriieoantitoonot,vheedr etawpoepnegdrueiomndt
fatbhahnOereSdymioerferkenovtnkadvmaisonckrigtlkssothlt,fbaheosoermuKstasnheantdeallyfialyebsrriiulKeHitfsasayfi.lyvclesetiTerhtl‘e.hanamencStsiy,rothmiOhpneeaufdytvreeesfincpunaeridts/na1nergkdIrcOeveaenttnrhefitetethnotirreedsmntfodrwoanewrovtnureetmkhnl”ii.nnegemggssir days into more extreme conditions with
of just a few to those unfamiliar with Kaller's weather,
little warning
HUNTERS FOR HIRE
no ulna-manna":
ostatLpoiuirfrooeorKnnnffvasaorfiwie.cdlnlseeemeMholrl’owwsoprrwsaerootiatruneetttoendherpfcd—iargl.LanetehlctdoynTeaenpohdiarfiueecnfswicawrrdoilitltmicyhthedrouasermdntdiphvuadimeLeerrr’eniareuo<dedCnns‘x~iarmttetufilrheotaepeosroalmlum,ricnsceaowahrnSleinawittvLherdeoegl.cnoaneptectiuroeharcnpceatoetuirlLndlaascisectotrtcinnsuyoeecdl‘nets—aioAsssr may do so as long as their antennae are visible tO‘ We
li[IElqtimriaemc]umrmToyesepfhn‘hrrsieeersopiendeerro.tedtqeCvsKuHreooeeaKerronnadslnawlfceletellteelrriedma,vuredeli.tintrurithlda;irticucisytnthyar.hgiemwneTgroeotshehrfyeletdushis,IntGCenedsdlmnroeeawoenr,enpaeidscneantognnWianAnddngiarttedrmrosntaidhn,ysltaegdoyionSusfEIfnemytmohOLspctheptfoeueeirrotGmeihtauRhealseetlpaacmwuaskcobnyaeitl—nisdLrcs,,i another, though the vocabulary of a silenL disgusslon
oKotdBonogoBoLoffaanfeuafnaaelaSspleslmnesLeLileiiclhtmgclrhomase.ne‘uaeKsfpnadoBniJatagrtthsevhuseigra!unrcmeeowc.eswpaodmaupei:otmsmhiuFpailev.lnosm,usPalreneemrnaTramntctwahyrnhnaetlecnstehditnehasLlg,eiroocdta,iinemcgcoialttnnaaehrntttaoohiliaalnaK.slonyouvdealsncLyaesdpsephaneamielfbngrecslmfitlaaoogeuaeamckonvutalrtKulwtnoeeavgstlLalehvedemtgeolsedeleemseefeeo“omsnxrKvnetncoarhheetadnehnnismriatnletbaasi3at.tovKirlit"stsonasIneaoomALocaawllnodotltntelthphemofhpiervfeeerK,teeeimemiohrrnsrdaridoseattllestiaieltarlncseeogpnppaxrnrsesdg‘deleeaaplaiueesnlKlnamekelagpgdeokpacengereraiililarecnnemeleansreeregegnssk,-tr- gatlhsounaoavdlliegmefaoisdtreteodsmanu.lagtryvuPwievasairtttthlehmoianLffosftrourheouceigmhtgnriaedtnhsoeeiprleisepnFnrvdeaciocrseotsmnitooh’onnfatettrhkI‘‘mleOnt.rso'aewn£y8nisa7Kta9awH3euQ“s?l'eadtfflwuhé.
tamtsemfLrroerauia'arfplliesvfknto-siterrnote’soteoeihlnnlmniroataihtsnrntint'eamglhceemld,eemwsoKcsemdooaFasHfmelacrl'oeihanqnrn'rtndacuogahusdatmeeI;alei::rntr‘)heetLStHaianoseprndtanaeedcevtdrcxheeieainpeesatlrglyos.oyd,itLadbThabw.cecorhuenecatethl'illiigbtremahlrrtuwcaoeetnuitdtetsthlomtluowbqarowythuenhLei’yethcs[n1h,k0eeglrftbWyohrsu$Ocettt9trouyU‘6agta”hn0pro6elg9sefVfl?dCo3”l!
o Wound Threshold: 8 + Bravvfl
'3 Strain Threshold: 12 + Willpowel"
Starting Experience: 90 XP
oSSntpreeeecritaawnliskAebinaiblioStivetrese:eratwKnkaisne2erdaTunhrsienybgesdgt‘ilinallr’atmhceatrVggr a“cm0reteatWWio)mn?.“
gHaympeerwsiethnstihtieveHeAignhtteennnedaeA: wKaarellneerasnssLablcegl’litfl- the
EUNQUEST MID KALLER
aooiatbtrnieemtnfehtcpdeebeehrlenirou,ernoaastpnohctcauetlct,hinsoiivdunoeadagelpvfynvniueaei.shdelbssarsuitwssvoOoutoae,niftthmnfshtheaahtderervetaheoreanoKdttiKhvsmcp.ageaefoplorellrseolobsertrumr,reat‘tpaeunhetsnnhsend‘sei‘thdwiih”treaehCaovsevaverealefrdhttpstebaoatlrervaai—benenntKrsileeonyeoabffiugtflu‘eelotsgereceavcrhtd.necnestudrswMlalhotnahduaroebndiivrslsweedise~tt doorbRanifeefnfiepseKcnuxuaibntlleltleie,acrxnr.bpiaahuTulsaotntsfiginotsedgarhcdoyaewnssweatyuhh.lmnriekodteouhergenethrihaeetbvhmileiyGitlrhpaiatarfanfenerdsyceittnAeicdhrnematetshyorevgf eooaKnfolaitdeitlohlnenIesS-
tanmdhhtRSbyhevaauyroeeewevadcmdpernemKtiuecetdttbsaoobidenollerilcecneefeohl,,eirttnkvhanhwbheernfoeaouusrslsomcumcttetoogshhgieapntmieahcievnlpelolelseeesenndS(3ndqiceagiOhsgunopnaerrinetnnuoavdesropeurroattlmtpohchrtethssapeiebidscateeihtanrtsretoasoshanttvttt,rlherhelhaioeisaearcspibenrnvkusheecetscKorehekehocaniassnbodil,nelgyaecuodthsrcycvi,ataniaoeemvncotsprdehsrtrepil.heeoaoxirdnbnghporaieatuOtabrwleneoloevlllddeynnd»esit wsTporihmeesmnpeonlyspcatoesfKaosanicbltlleeKor.afallinlSfeseor,,msttooehebloaenliinegefnxltupheslaonpticetfeecediweosffeovroheauanvtdsevrideahmenarteasdmgeIaS-
came to inhabit the world, their
rDnaeonwsincegitcieonsne.owmOtihtchreceoiarepstnpstoatraroetsuentnshietteiawebsoclilosdfmoheresedttrhss,epuoarawvrmirevirvbisniin.tgigoKuawslleitO—hF
Tmmmmlehsaooaasyrpnneookobltsetirhthuaeetmrnorarulstpcphphecaeeorrscitmursoiesoncisoro’n,sefsn.KKstlaipaamwcellllthieecteorirweasdstnie.tehsanscdfmroconteomotmmapbctphuteaetrrwselmiidttotholfetroceasoltticheuooenscn—iksrt
MAmI m: Anfifngfi' I
1:75: 7x91 5.»: 3:», V131 i ~43 ”.311
«.31
rom tf1¢,,Kage Warriors of Ouarzite to the enforc— A Martial Artist benefits first and foremost from a
high Brawn rating to empower the Brawl skill. HOW-
Fers of Black 5,131: organizations and cultures across
ever, Willpower is an extremely useful secondary
the galaxy have developed their own unique hand-t0- characteristic, as it not only gives the Martial Artist
the higher strain threshold needed to activate the
hand combat styles to use their‘"spec'ie's’ physiology specialization’s many talents that use strain as a
resource, but also the ability to face Intit'mdating foes
to greatest effect. Over decades, centuries, and mi]- up close without flinching. Further, talents like Mind
Over Matter benefit from a higher Willpowcr, and let
Iennia, these combat forms become more than mere the Martial Artist fight even longer without becoming
exhausted. Finally, the Martial Artist benefits greatly
means of inflicting violence; generations of practitio- from investing in the Coordination Skill, as talents like
ners'work to make them into art forms, philosophies, Martial Grace and Coordination Dodge let the Mar
and ways of life A desire to practice self—defense can tial Artist supplement raw strength with finesse both
offensively and defensively.
become a belief in the value of self-betterment and
the‘innate potential of others, though not all ideolo-
gies’ develop along such lines. More than a few Bounty
‘ Hunters have picked up techniques from martial arts
styles across the galaxy to help in their hunts. Some
' are éh‘ining exampleSme their school’s philosophies
and‘tlra'ditiQ-nsffist. others are disgraced students, or Unlike characters from most other
-, "1L5‘nave'neyehxfive built around Close-quarters combat,
trained formally, earning their skills specializatiOflS
"7 'z Martial Artists
,- Nthmggh-éfiafrg exge’fieme cm the battlefield
ln' ‘add’itiéh to- '-th'e' Bounty Hunter’s does not need a weapon to fight competently. Martial
Artists generally value precision over brute strength,
eight "career skills; *thé Martial and strive to execute efficient unarmed
Artist receives Athletif'cs, strikes. By wasting as Httle energy as p05'
Brawl, Coordination, and sible, they can deliver extremely forceful
Discipline as bonus career blows even when unarmed. This is reflected
skills, If this is the character's in talents like Precision Strike, which lets Marr
starting specialization, the tial Artists exhaust and weaken foes as they
'Martial Artist may Choose see fit rather than by chance. Martial ArtiStS
km of these skills and alsQ seek to leverage their enemieS’ strength
gain one free rank in against them in battle with talents like Overbal-
‘each without spending yr ance, which allows them to throw Foes off—ba|~
, ”.‘'1gtarting experience. ance after they attack. Martial Artists also have
d,
‘ ’vfiw‘.‘ 2‘
.41.. ,
-1 access to Parry to mitigate damage, and can
even use Parry when unarmed
This unique combinaLion of precise offense
and controlled defense allows Martial Artists to
contend with some ofthe toughest
\, galaxy Of course, not every battle
fighters m the
is worth
mg, and a trained Martial Artist knows to fight
only the enemy but also the situation
not assess
before
dCCldlf'lg Whether to join the fray Many schools
of martial arts teach the idea that fights are
to be avoided, and that the ideal way to
wuj a battle is to avoid having it in the
first place. Unsur'prisingly, this attitude
is less prevalent amongst Bounty
Hunters who wield martial arts,
as their profession demands a
certain amount: of violence, but
‘ _‘1 some still apply theao over»
arching principles L0 a CGF‘
am degree.
« .‘ ’ L w .
, l
-;‘ , ,.
9
; .1. - w," i
r,
zJ . A . -,
v
'r 5‘~ I ACTIVE
, I PASSIVE
.,
- 11 .
Bounty Hunter: Martial Artist Talent TreeCareer Skills: Athletics, Brawl, Perception, Piloting (Planetary), PilulilngFSPacel, flanged [Heavy], Streetwise, Vigilance
Martial Artist Bonus Career Skills: Athletics, Brawl, Coordination, Illsclplme
I _._\_______________ ‘ I PRECISION STRIKE
IRON BEIIJY
When H1iw’haw:ltu 'HIHWS
Renvwe-per mum Imn When ml W a melee n, a CliH’firll Injmy with H
BrawLM ‘ rJI’LigHL ‘ '
Horly [mm C(mr;lmcuu:)rl /Wk” WW- 5 Emmy) IE:
duw dzn .l‘er by plu; weapom ’mHm
and Rwliunr'z: chcr'fl. 1 H
Rerlucr: Hm crflicu‘ ramw mnksm WW [O civmge Ihr: Jill“, to anv
u0| Lmarmcd n W I) Easy (Q) CHLICEI‘ IHJurv
yirifr amk ()1 Wm BOW ['0 a
nm_anm of I).
When W by :1 ”Mat: 9|“ mm 'i- 2 wowml H'H'CSHOM. V COST 1!]
Lack WW)! :3 “Armin I") “3 [DST 10 I ”‘\MARTIAL GRACE
(.[uce cie'unage W 7 PM Once: per round sutfer 12
:m‘eml m add damage
ranks; m Parry rsqual to mnka in Comdir
mHom IU r'wxl Brzwl Check
EDST1IJ
mz1r,ic[hi'»-,Lum
CDST 10
I a WHA 7I",”ERAPPLE I‘ "w N Bony I IMPRIJVED
U ”ARMED PARRY PRECISION STRIKE
OHCC per lounri, mm per Remove-per rankofllon Once pm mulnvi, when
“ infliclmg a CI'MCEJ‘ lrliw’y
I! mn’dinaLion NH] :1 BMW 01 Marni)
on, may WWW I)
W J r’hw" 'k: " rim to rfnrmgu L‘nr: rezmh
r' Hal ralLir’w, l0 aw Average [Q Q)
[mypN]JJ‘\7, 1. , W, W‘ " Ufliumeri Wm Mm (Hawk: I‘II-FIHEL‘IV "' mm Critical Inwry.
“"1””: 'mm mm m Pm’ Until the Lnginnn'xgpt [DST 15
BOWx "Mr
and I GRIT
U‘rLl
t Ml}hd'wx. (jam 4 I 3mm Ull’L‘SiMflLl,
V wry. (h: "rclel‘w next mm, le rank. 01’ [mm Body (m a‘ ii
‘ \ EIJST zu
the of Inmmcd an rcm my
WWHW: Imau’mwl W l (m I SUPREME
1005. PREEISIDN STRIKE
”IEl HHHHTHHH I] I Hum 51mm 2 n’xammr OHM) per :«minn, when ill
WI; 1,0 mow: [mm llulinanfiJnir'nl Marlyn/Hi1
mg, M HHIHIHLIHIM ||. rm Hrwnwl ammk, WW
auflm’ é SIMIH m wannv
[DST 15 m :1th inisiead OI 1‘ Hm mum to :mv Hard
(.QQ] {Itilirile Irmny
[EST 15
When :1 COHIML Li’mk (mm *2 mmuul threahold. MIND [IVER
MATTER
made by :m er Wm W: I DEDICATION Tm: mc'n’auer‘ may spend
“ler one Dummy Poim to lemv
Ihay‘ V.‘ m (9, (C?) ({2}, (17ml i' \ 1(1):] Mill equal [0 \IVilIlmwel’
Valium. ”MS mm m,
(alrnclm :1er I iu'llru, ml’islic £'!i,)()‘./l‘ (3.
. NATU RAL
”chLim {3| VJ ruf hi3 Im'n BRAWLER
()nr..(:5mt imminayw
[EST 20 mil my 1 Br, NI 0r [\flon'rre
chor‘lé.
I
EDDRDINATIEIN
DODGE
Whun Imggpud iw y,‘ mm
Ilel f'i1(\r'§x,, IHZD/ 7’”)er |
f?'3’if‘llv I’uml m «’11le Y
”MI ‘7') “Mn'n‘ in (k‘vwlimr
Mn” Ln (3le k
[EST 25
M
EIA'I'IEK
QU'VT7K‘JIQ7
o catchna target,‘ a Bounty Hunter must be fast, A high Agility rating always benefits an Operator.
especially when paired with a solid investment ifl
Tand even thé sw‘iftest sentient being cannot hope Gunnery and Piloting [Planetary] or Piloting {Space},
depending on the Operator’s preferred vehicle. An
to outrace a spée'd'er or starshl'p 9n foquAn Operator Operator also benefits from an investment in Intel—
prefers to undertake all pursuits from within a vehicle lect, as this characteristic 15 used for both the Astro—
or spacecraft, keeping the garget in sight gation skill—critical in tracking quarry across the gal—
with deftmaneuvering and On the. axy—and for the Mechanics skill,
rumwith withering firepower. In
a high-Speed chase, few char—
acters can match an Opera-
‘tor’s expertise, and fewer still Even if the Operator is not the group’s main tech-
are'prepared for the arsenal nical expert, having a strong Intellect and a rank
tof daring moves and dirty or two of Mechanics means that the Operator
'. can make repairs on the fly. After all, most
. tricks she can hieash. "5; Operators put their craft through its paces
Int-paddition'. ‘o
. the Bount'y'HU‘W?r"’s;,'f [and even push beyond its limits from time
'
3’5".) eight: -.,car§y'er§¢'$'—ills,f to time]. Knowing how to fix an overtaxed
-f;1;-’-i‘i'*the'opg:_adr " ’’ engine can be the difference between stay-
-' recegzceék
"Astférgaigla ‘ ing on the trail and drifting for weeks, waiting for
15mm;
'L nery,' Pi_k‘5ting'r_' ‘ a repair team to arrive. Any Bounty Hunter
‘._ -,1 y‘- who has
value Of
. (Planetary), and; spent time adrift in space knows full well the
' being able to perform one‘s own repairs
Z;P.i|qting (Spacql'
as bonus career Operators are sometimes lone wolves, Chasing
their targets across the gulfs betweem the stars
"'
with no company but a trusty ship. HOW—
ékills. lfthis is the ever, many Operators are part of teams Of
character’s start- ,‘ bounty hunters, conveying their comrades
on to the location of their foes and run—
. “,ng specializa- ning starship interference while they cap-
tion, the Opera- ture targets on the ground Some such
Operators are loathe to leave their ships
.‘ ;Qr may Choose two entirely, though disembarking from time
to time is usually unavoidable on the hunt.
of these skills and
‘ [flgain one free rank
H “I: 'e,f,;:,VLm each without
' ""' sipending starting
experience,
Unlike many other specialization s focused on pilot—
mthgghai,veneOlpsjpuabestrricandhtgoearsrstatarcorngtyeeerettshdaectmtocoe.asdTsihhsetaaolbtO,lnepuinem6crnleauertdoomiurnysgspstDehaiclepeibasniltlisizrtaaatttthhiioneangrt
Shot, Hindering __.V.
Shot Overwhelm and ~“__AAV_¥#_A_
, Defenses,
Wfi: Offensive Drivm g. All of these abilities are use!
m: for taking down fle eing star‘ships~or, in a
pinch, disabling the vessels of rival bounty
' "n. hunters pursuing the same quarry,
‘f
it?“
_
A..-ru‘l
‘
: “1;.
:2 f
LHUNITERS EDR HIRE
h Wagslmmmm
A ’-
”'2'" ' ‘-T”“ m
.a (.1. ‘w' W Y ,
Pl ‘ 1‘
"I V if,
"‘ ‘
.
W
'-' '‘ ‘m I . ._ . fl
,
I .‘ "- _ . ~-
arse
J: 2‘ .
‘ A
‘ * '
‘,
’«z:
3‘ .1
I;
Bounty Hunter: Operator Talent Tree I PASSIVE
- , Piloting [Space], Ranged (Heavy), Streetwise, Vigilance
B _
5km“ Brawl, Perception, Piloting [Planetary],
AthletlcS,
":27“.0” 1' Bonus Career Skills: Astrngation, Gunnery, Piloting (Planetary), Piloting [Space]
I GALAXY MAPPER ' I UVERWHELM
IRemove DEFENSES
Dwimgrlciv" _ ;
(u";m' »'r I 3‘ mm' \I''u'rgs‘mhl. per r‘auk of rank in Simxlr'ul. 10 any Upon LH'ISIUCOS'SHII {Mack
Galaxy Mapper I’mm A‘Y made 10 cade or WIN] a BUNCH”) or vehidr:
trogmkm CHECKS, A‘stro
ggliirm dunks lake half t} 0\yvcaprm, may Spend
per rank. 01 OVBIWHCUH Dr:
normal Mme. Imus/:5, Reduce rim {trait SE)
m the Laugrwzd mm by l
U Ufor marry Slflml,
I PLANET MAPPER I DEBILITATINE
SHDT
IRemove dper rank. Cam +1 SHEJHI HHCS‘HUM Upon Snagnz'sm amd< mm
(.Q.)It”m?e:1aHHMaTrdhwm :‘Mjlirm‘ anpmPWer EDST 1|]
from Sheer.» a 3!: Mp or vehicle wwp
P:
. '— wise 0! Survival Checks U f)0m may aprmd
lfllng check m incre' H a {0 I0
[(,I]Ir:‘C'; mp aprrmt W I waz‘rd for mwgaliou on a duce the maximum spew
or)" f] IwIIIi'Jrrl' ol IDLING WWW. Sum £11ch 3130 chlr)f'Nl(:1;1thLi)‘/ I HIM Iht:
,{Lml In (iruwmle',
[aim hall nurmal Lime, em! whim W uni
EDST in [EST 1|]
[DST 10
--, I OFFENSIVE I GRIT
IRU Imam" (Iain :7] 5mm Hrloshnhl.
[\kg'JT'DV': pr); rank 0! As‘ anewel', sutl'er EDST 15
ijvjlgd Jodwy [mm WM Dr) Hm 3H”BI usuzfl perm! system ‘zlin up to vehir
('Jrz's mm , (lemme Io
3” {Hdlmmyj and [filming tics m d 1ng through «AM:
- 1,when using M Hpalade ‘ rllllmmy 01
UP’’flt‘n] c‘ums .. ‘
Wm U7”. we
-2
Mrém ‘3 Iloxl, PH'JI my, check.
MW“ [Mammy/‘J,
[DST 15 mm, many MINES.
[EST 15
M I BVERWHELM
DEFENSES
Dminga (:‘n ’ anldee: Gain H 5min Mnesho‘d. Upon unsm 35';er ANGEL.
0H (J: pm' mum, may Shortcut Iu auy EDST ZIJ mm 21 31:113in 01' WiHCIC,‘
H1 ado In or
[TIM r)l - E] m» rank m with U 0wcapm], H my 9pm )d
W)! 1"“
(Msmmmr Igi “2‘ij
(-()},f’,(?' ”0331, m mlur a lepu an opponom pm mnk 0| OWW/hulm Dc
42M! 01' WUHDOH alatirm Manse; Rerlun'c [he detww
(3” t Voiw‘m Hr , ~‘ m llw [mg-3mm [one by I
, 1 f) 0for ovm y
View“ «,m mar
We, H“
[DST ED CUST 20
I HINDERINE SHOT 7
I IMPROVED IRemnm [m lélHk or Intjmzntu.‘ Hus difficulty ml
SHDRTEUT 11(er (,Lummv Filed; in/ l
“U''Ii: S|«.H|r_1d Jammy fmm PHOl H rlwrk WWII‘; dammit), Mn
I rlm<c' lw,J1.HanH}h('n;,;1-r, UM“mm:Wilm unggngw, ins}, in :1 51m \lnllljilu) u: \/L)i1i<'1(: 511!
Wm“;rm", IU‘I“ Humor Inhw‘ :1 ‘ my (Maw: ,w] Jun! Pimwtg {cm walem «mun wwzll In
«prwl when it mr‘uvu‘; IHHH
I , HI mu; muy Hum 2511:.‘ n [Smur] whatkfi,
1:) gm xfi} equal In WHICH/10! "l!‘<,.‘rIU)I,IHI_HI.
"U‘M'VV‘L'H’ FNMA/(Y (,5. ‘ w
WHAT:
[EST 25 Shumur. In If"?
[EST 25
at all debLs need to be settled with blasters. Some— somewhere along the line, whether this takes the form
times, a Bounty Hunter just needs to do some of gaining leverage on the target or delivering a threat
legwork, find a target, and gel; that individual to pay of violencemat the hands of the client or otherwise.
what is owed with a few weli~choscr1words.Thisisthe
specialty of Skip Tracers, who Lake on commissions to In addition to the Bounty Hunter‘s eight; career
seek out people with unpaid debts from clients who skills, the Sklp Tracer receives Cool, Knowledge
WiBI’I to have itemS returned, caSh given back, or rec— (Underworld), Negotiation, and Skulduggery as
ompense paid in some other way. MOSL Skip Tracers bomus career Skills H~ this is the character’s Starting
prefer Lo keep their guns bolstered for the whole job, specialization, the Skip Tracer may choose two of
and try their utmost to avoid caus— these skills and gain one free rank in each Without
ing negotiations with their Lar‘gets ' spending starting experience
to breakdown explosively. Prop— All BounLy Hunters have access to inves—
erty destruction and medical tigative abilities through access Lo Percep"
bills cut into the commir5~ . tion and SLreetWise as career skills. DUE
Sion, afLer all‘ Of course, Skip Tracers are particularly strong at this
as most Skip Tracers aSDGCt 0f the job. Several Skip Tracer tal-
know all too well, things ents are eSDGCiaHy useful when backed by
a high Cunning or lrflelliger'lce; Improved
rarely go so smoothly.
More often, the Skip StreeL Smarts and Rer;0nstrt.1cl;t.he Scene
Tracer ends up need- \et 5WD Tracers find leads on even me
ing Lo apply pressure scantest or" evidence, and BypaSS
Security can heip these investigators
reach secured locations where their
targets might be hiding. Through dedi—
cation and keen insight, Skip Tracers C61”
locate and pursue a target across nearly
any distance, which makes them ideal for"
finding people who wish to avoid notice
‘Skip Tracers also benefit from an investment
In their Presence, as once they find their" marks,
they must convince them to mm with what iS
owed. Several of the Skip Tracer’s Lalcms, SUCh
as Good Cop and Nobody’s Fool make it diffi—
CU't for targets to get Lhe better m Skip Trac—
ers in negotiations, and ensure that they
recover the client’s property. If maLters d0
become ugly, however, Skip Tracers are
not defenseless: Hard—Boiled and Rapid
Recovery allow Skip Tracers to doggedly
pursue LhOil" quarry even afLer taking
a beating, and Soft Spot lets [them
Slip a finishing blow through aL
exactly the right momcn l1, ever]
against a tough opponeflt
B°ufltv Hunter: Skip Tracer Talent TreeCal-9e Streetwise, "iguana
..____~Ww__\
I —\BYPASS SEEURITY
. IAmtuhsleCti.casre, eBrra5w““l5, 1PeBracaelp, tKionno,wPleilodtgineg[U[Pnladneerwtaorryl]d,],PiNloetignogti[aStipoanc,eS],kRuladnuggegder(vH; eavy),
.
Skip 1:32r“:
I53mm? U UMay ‘ii1f‘ll(I hum a Whun Iet‘nwiw mum HI
When mcovmim; 51mm Chew 0r Negotiwmn MumHaw .‘1IH3H(‘HHIW‘I, |
pm rank 0! 0Elflm an (EWJLHILCI, may (‘hm‘k tr) ll])é:1?l',[i‘ ri‘nHiM/ of ruldm'mefl mam (m mm,
(hi)? yergwily 1W" up I0 flunk; in a Hifl’gli.‘ aHv': 'dHl';.{."|UUIIL nf Rapid Rwy-M \/‘
5min] hummcxitm r‘iw’lx
. mgnlv m rimrmlv Tl spend
Emit 0HamrBOilud m mmvw’ 1
.’
W:1:IW(1UVH,£§HI UPC” ‘71 ‘J‘JOHHLI pm spam. marUrolzwrgleznumber
)wrd (turn. e1
0! mm: muml m mum m
Good Cup.
I STREET SMARTS '
IHymn/I Rumow pm mm. ml Imlwd u! HMHMHHZ‘, ,, Ialwwl
mm: r'hcwla, Imv MW Fl
m ,_ par Mnh of D: Slruvl Smarts hum 8mm!
'4eri'énuzghl hm» il<HUll1
I w L‘ ), \rvolmfl Ull‘f’ihoh'L per! 'héltkm hum (‘Mrflik‘l to WISE or {\mvagu [I Jndm
[DST 10 #5; m Mada: timers, (WIN (vrllufl m UH Hmrfin
Wm M] rjhrrr.l\;9.
IiuHHiHMIlM/nl Hwiwm km
DULH. Hmr: m mm» a
wk; WII‘H UH!“ 3?}
‘EJléW, by Ml, [DST 1|]
£051 10
I IMPROVED I STREET SMARTS
STREET SMARTS IRUM/w
pen mm? H!
{)IILU17V?!"u"1;fwi()ll, mew [SH-LI:
mmW? m1 mum nine, m HUM-:1 “.111an lmm ’Hw-I
{Cr'U‘x/xiil' rm \mmwml “flute! Smml';
Whr1H IONA/(”MR SH’HHI Im em Unromm: r', 5m I'élllk HL‘UW HIZUUJ n Formidable wixr: m i’\'|1 V‘U’ 1&4“ WWW
:Jtidilinnal SUE” M
(I‘m, ”H "Hrjnlmrw‘ l ' “Wv u ) Streetwise wJull¢11Li1vr£ x.
, )0 ’ 01 Knowledge (Under—
u world] check m 1mm um;
WW due 1mm UM: GM Rr‘
Vinriilidpg “D M {Jinks m m Rnpwl Rerovoly, Lime: Iii!) (liflmmv 0!" U [W EDST 15
\,\/r)I|||.:')I((f(l{';J ””UVL'I | 111% mi Stu-(7:1 Smmt'ra.
* 3" spam
EDST 15
,rj !”(.1|hog/p ., u7‘liu, l r U 0vCM'ihwaayrr‘“m.fipL0m”d0M" gulwNug:Mm[mWinmlin0n11A OW“ Mt! wmm, um
Hy 1w: mnlz m’ 11.: (Ilfllmhy an,/U;H:1{_nr\lrw WW 'rIH
w: [my 1mm mnnng 01mm“ (.Vfir{l4:l‘)ll' :l 2mm \lliirfiwwwm “me3‘11“" Huh! 1m 4]
t'im‘L.
ilHll[)UCHIJWJHFHCflnvaIIU , gHMWL
" "‘r-Wm mark: Ir; ‘l‘erhlw‘ f1 ml mm]. of Nnijudv's i'vxml‘ 5mm NHWLI'HUH ‘ [DST ZU
“"‘ju’fflj ,_1 I‘m: 11mm! :1 munim
~‘/ (IN/i. ,. 'H t) [Hn I :»1g:mr;l
.
‘JKMHMHJU! [DST Zfl (J [Hum wwzll Ml Emkh m
(lwnr1(_,<‘)p.
(min ‘r'l mu <;in;1h.w"n:ws "W" “WW: Ix 'MH’u-.,n,ml
fhmrmu m iwng :1
E nlrrlm Hmswir (IHCJL‘MN HHV “WWI , ”WM
lw {mm in MM WHH-‘w-
Pm,IWIH W l‘3‘3"')ll'ulmu HWUVNHIIL) rimmum PM :11 may r,
(“1W’H‘l‘nmingmnnpW
Hard[.‘ ”(1“)“, man; 4 f)WamHrhIumMamm![:MmHLM‘IUUl mpmuuwpnHnmWHwY,U./MU/M! Wm
[DST 25
\.v.'rnmr1imr
Perception
“Nth” H“I,r!MH.“LI,H]HH1. 'V1'”lhHu""“WWWUIII
PWWHN.H
.) 4 ., HIM ‘,( “HI: WHHIH
”OI” ’) HUNTERS FOR H!RE
[DST 25
N EW TALENTS
The following pages describe each new talent added ability a number of times equal to the character";
ranks in Good Cop. A Single check may only benefit
by No DISINTEGRATIONS. Every entry includes the from one use of Good Cop,
information required for gameplay, See page 127 ofthe
EDGE OF THE EMPIRE Core Rulebook for more on talents. GRAPPLE
ALL-TERRAIN DRIVER
Activation: Active [Maneuver]
Activation: Passive Ranked: No
Ranked: No Trees: Martial Artist
Trees: Operator Once per round, the character may perform the Grapple
When piloting a vehicle using the Piloting [Planetary] maneuver. Until the beginning of her next turn, enemleS
skill, the character does not suffer the penalties for
driving through difficult terrain. must spend two maneuvers instead of one maneuver to
move from engaged range to short range of her
BOUGHT INFO
Activation: Active (Action) HARD-BOILED
Ranked: No
Trees: Skip Tracer Activation: Passive
Ranked: Yes
When required to make a Knowledge skill check, the
character can instead make a Bought Info action. She Trees: Skip Tracer
spends a number of credits equal to 50 times the dif— When making a check to recover strain at the end Of
ficulty of the check and counts as succeeding on the
check with one uncanceled 12!. At the CM’S discretion, 0an encounter, the character may Spend to recover
the character may not be able to use this ability if
the information sought is particularly esoteric or hard UI wound. spent this way cannot exceed her ranks
to find, of if the character is m a situation where she
could not purchase information [such as marooned on in Hard-Boiled.
a planet with no access to the Holoth] HINDERING SHOT
COORDINATION DODGE Activation: Active (Incidental)
Ranked: N0
Activation: Active (Incidental, Out of Turn] Trees: Operator
Ranked: NO ToinhfgeaschGhouatnroannectreayrvcemohmaicybleavtoIflcuhsnheteackrsiluyocncicneecerdetosasaiennfdltihcdet eaadlishffiindcdauemrlt—y‘
age to the target vehicle’s hull trauma threshold, the
Trees: Martial Artist vehicle suffers system strain equal to its current Speed
Whenever it moves until the end of the cncoufltef
When targeted by a combat Check, the character may
equal to her ranks INFORMANT
spend one Destiny Point to add Y
in Coordination to the check.
DEBILITATING SHOT Activation: Active (Incidental)
Ranked: N0
Activation: Active (Incidental)
Ranked: No Trees: Skip Tracer
Trees: Operator
Once per game session, the character may reveal a
0 f)cvvmU1eeu)pahhrourxiieccnnimllnteeitlumsmwwtahpakeeesisaneppegdteornaendravde,edosloumuifnfcctagecthhydeeeiststssnotfpaeumertlxhgntaeedaxrttoitnmabuecyunwkmd1.mw[IaSitftoxhptitehmoaeeaudmrm,sseittnd.aaitiurrmsschhhueaiimsppthioootesrrf contact who possesses information on a par‘ticular
GOOD COP subject of her Choice
cslbx, heogWenhatthkvaneoacnonitlswattbshheleeexthpctimesohraatctirhstoateeencrttPaemCcriniStgd,haoqbtreu1uscdetosthshtthotii.osew,nCsthhMTeehemdcoeucmcsoiadtnceetLasxcpcWtlaahnSinahstOhhtUoheIwedd
IRON BODY
Activation: Passive Activation: Passive
Ranked: Yes Ranked: Yes
Trees: Skip Tracer ITrees: Martial Artist
0atTNhlhleeyeg’ssocatshimauatberiosatencaqtreugcreheentmctinakSyotthocseiapulespnIagndmrteaedraeecntti{coh3oenunsafrtkboeilmirll.itCyUhaepocgCfkrhaaaadgrsemainitngholseert Trbhayheterinl gCcphoeOaorfr’rardtachinnteeakrtcioorhfenamIrraooacnvnteedBsro’sRdyeu,snpitlaieoerrnmacraeemndiknCaihmoGttfCuaIkmcrSok.snoTfBish1oe.rdeycdruiFtcircoeamdl
HUNTERS FOR HIRE
NO DISINTEGRATIONS
MARTIAL GRACE before soak is applied, 50 immediately after step 3 of ‘
Perform a Combat Check, page 204- of the EDGE 0F
:‘3
Activation: Active [Incidental] eTHE EMPIRE Core Rulebook], the Character may Lake a
i
Ranked: NO Parry incidentall She suffers "‘5 raim and reduces thn ‘‘
Trees: Martial Artist mm to damage dealt by that PM by a number equal to 2 plug ‘
GENO Defl‘ound, the ‘
character may SUN” 2 her ranks in Parry. This talent may only be used once 1
‘
:Kidlthflal damage equal to her ranks m Coordina— per ml: and when Lhe character is Widding a Ligh’t t
~
23‘
3:32 uo one hit or a successful Brawl combat check. saber or Melee weapon.
H
MIND OVER MATTER PLANET MAPPER
‘
Activation: Active [Incidental] Activation: Passive
Ranked: N0 ‘
Trees: Martial Artist Ranked: Yes 1
Theplfl'araqel" may spend one Destiny Point to r{:‘COVEI' ITrees: Operator per rank of Planet Map— i
SLram eQual to 1'1erWillpowerraLir1g.
The Character removes |
per from her Streetwise or Survival Checks used to 1
OFFENSIVE DRIVING navigate on a world. In addition, such checks take ;
50% less Lime [this does not decrease with additionai ;
Activation: Active [Maneuver] ranks of Planet Mapper).
RankEd: No PRECISION STRIKE
Trees: Operator Activation: Active [lncidentaL Out: of Tum]
A‘Sa maneuver, the character may inflict a number of
high—
:YSELZFTI s‘tram on her vehicle no greater than its Ranked: No
Deflense value and choose a vehicle wmhm dose
Trees: Martial Artist
character inflicLs a Critical Injury with a Brawl,
”h? CPhgaloraLcI’tnegr [Pdolaensetsaor,y]upog-rraPdellotthmegdJ[USIpCaUcIEey] Lightsaber weapon, she may suffer 1
{an eWhen the rain to
of Eh”
Melee, or
change Lhe resulL to any Easy (Q) CrlLlcal Injury regu|L
Chwketln»eXL makes beiolrevth‘g end of the”
ML VGhXCIC s pllot; system strain Infhcted on he: Additionally, Whenever the Cl’1a1"ar;l:el" defeats a mirr
enC?pumer once for each
cIr”aft this Way,
ion or rival NPC, she may always choose Lo do so by
nonlethal means, even if Lhe environment or excep--
°VERBALANCE Lional c1rcuu‘1’151:ances would normally make Lhat very
Activation: Passive difficult: or impossible.
Ranked: NO PRECISION STRIKE (IMPROVED)
TreES: Martial ArLiSt
an enemy engaged with mg character
ygfryerH Aa(L«t”thaaacrkaCecotremrupnmatitlaytChheSupceeknr,‘dldaof1tf%e?trhoe[rhea(£L3atat(tc<a2k?)cckr(9‘-sI)SfltoCreXsSttoatulgvmgeed,,r Activation: Active (Incidental, Out of Tum]
inWe
Ranked: No
Trees: Martial ArtisL th C Character inflicts a
Once per round, when
CriLical lrljur'y with a Brawl
OVERWH ELM DEFENSES
or Melee weapon, she
Activation: Active (Incidental) may suffer 2 stram to
Ranked: Yes change the result to
Trees: Operamr any Average [Q Q)
Critical Injury result,
ajrjfrnflyakir1g an Lmsuccessml attack with
Or vehicle weapon, the char-
05515'?“er
Ofig [Hwy spend Q} per rank
Reduce
dviurrjvyhelm Dergnscs.
We te’wse ratmg In the defense
ZOne @rg‘ited by Lhe attack for the
W”T'.amder of the encounter by l for
U UQVBW SpenL
PARRY
AFFIVation: AcLive (Incidental, Out
Of Turn)
Ranked: Yes
Wees: Martial Artist
a:a Character-suffers a hit from
[th
gthaber combat
. Melee,
n(11ka,aILer damage 15 calculated [butor
MMMPROVED)
: Active [Incidental]
perator
a When engaging in a chase or race. the
3 \‘\\character may suffer two strain to add 3%
_
,a\ equal to ranks in Shortcut to the check-
.. STREET SMARTS (IMPROVED)
Ranked: No
Fees: Skip Tracer
Once per session, the character
\ may perform the Improved
- 21 Street Smarts action. She ‘
makes a Formidable _
(O Q Q Q 9) Street-
wise or Knowledge
(Underworld) che‘clf,
“4‘”1a}-I reducing the dIff'I-
culty once per rankof
Street Smarts. lf_ suc-
cessful, the GM must reveal
one vital clue pertaining to a current mystery the
character is attempting to solve.
The clue should be something that the character
PRECISION STRIKE (SUPREME) could not normally find out, but does not have to be
the full answer to the mystery (it should be some-
thing that cancels a false lead and otherwise helIO.S
move the story along]. The GM should tailor the
information depending on the skill used; Streetwise
Activation: Active (Incidental, Out of Turn) may mean- the character learns about the informa-
Ranked: No tion from an ad ‘hoc netWork of street urchins, While
Trees: Martial Artist ‘
QvsaO'ua'nCftQecfreei)trtihcp3CiaserIsritttaigrIcnalaaejimlunnrt.eyItnocsjawuecnrishytnhsaoirnoteangsbn,euewlutthm.hneeaaCndrromeemtshewbuedailttthcavthotctaahanraecaynckcyk,wtseeHsrahtaopeinrodfanmlicst[ta.t0is-y Knowledge (Underworld). may mean the character
draws on her own vast knowledge about crimina|_
RECONSTRUC‘i‘ T'HE SCENE enterprise to discover a previously unseen clue.
UNARMEDPARRY v
Activation: Passive
Ranked; NO‘ -
Activation: Active (Action)" ' , - Trees: Martial Artist ‘,
'Ranked: No . ' The character may ,p'erfor'm'the' Parry incidental]-
.
' ,Trees: Skip Tracer while unarmed. When the character performs the
Once per session, 'Parry incidental while unarmed, reduce the strain
the character may perform the -
Reconstruct the Scene action. The chara'cté‘r makes 'she suffers from the- Parry incidental by. I, to a mini-
‘
--
(99 ,., a Hand
Q) Perception' check when present at mumof.1.- .,
a single crime'scene [or similar location). If the char-
acter succeeds, she identifies all prominent physical
characteristics of one person who was at the, crime
scene in the>last 24 hours per #3.
‘
BOUNTY HUNTER MOTIVATIONS
Otivafions are an importam; part of character are, TABLE 1—2: RANDEIM BOUNTY
HUNTER MDTIVATIUNS
m atlon in EDGE OF THE EMPIRE. They give both Lhc
172 AnMLion
CM and the player a 561156 of [he Cl"|ara{:Ler’s bade
ground and explain why the CharacLer was drawn Lo '3 7/. Cinnc
her Chosen promsion. A MoLivaLion also provides HIE)
player with a starting point Ior roleplaying Lhc char— 5—6 Relationahlp
acter. H' the player I’BaChOS a quandary abouL how a
character should act, asking “What; does my character / 'VJ ‘ C0111?
warm?" car] help direct roleplaymg efforts, amd Moti»
vation provide: one answer. IO Rn]! mum: on each 0| any two uncaoflea
Chapter II of the EDGE OF THE EMPIRE Core Rulebook presented in Chapter II. For those players looking for
provides a comprehensive Hsl, OI CI'IaI'acteI' Motivatioms a more taHored approach, No DISINTEGRATIONS [31733
as part: of the character creation process. These Moti» 61115 a number of Motivations deaigmed :sI’Jr.2r;il"iC:.-1lly
vations are broken down into three broad cal,egories— with Bounty Hurners in I'mnd, called Codes.
Ambitions, Causes, and Relanrmh{psgand presented in
easy to read tables LhaL allow a player to roll ramdor'nly or Players vvarwthwg to use me new MoLivatiom 5,)I'(_2:;er1l‘ed
to choose a specific Motivation Ll'1al.[itstl'1e vision for Lhe here can simply choose one, or they can roll randomly
characteli The complete rules for Motivationg are found on Table 1—2: Random Bounty Hunter Motivations.
011 page 94 of Lhe EDGE or THE EMPIRE Core Rulebook. This roll replaces the ome normally made on Table 2—5:
The MoLivaLions presenLed in the EDGE OF THE Random Motivation on page 94 of Lhe EDGE OF THE
EMPIRE Core Rulebook 1"Iecessarily cover as blOEid (J
spectrum as possible in an el'fort Lo serve the careers EMPIRE Core Rulebook. If Lhe player rolls a Code result,
for a PC, the player then rolls on Table 1—3: Specific
TABLE 1-3: SPEEIFIE EUDES Codes [0 deterrr’line the dwaractor’s MOUVEJUOI’I.
017710' Rule of Law: There is; I'HJHHHLJ, more impouanL than the mic ol‘ law and W: vhf-uncut! 1:; swom to ptoercL iI, A3 a
H 7‘) Downy hLlan, the III'IUIEH'LCI' is an OXICHSIUH of galacLic law, and works 'stl‘irLly U) upiwld M.
71* ‘30
71‘ "/10 Score that Matters: Only um min/g, 11mm; [0 the v'hinamw: imvmg 1hr: Irisgile‘n WW I HHIIL. Hm PC
"1 howl \HAW" if i1 «lwmm [In Hm ma,ul 111%in wiI‘H Wm likw
4 I "30 mv (MM, rm w. m z ommnl rum
I
U! (30 The
{J} ,0 “mmUllly
H H" Only I
8' "9U
Mk
I“’Jlr ((
individuals In Md; [I]! W: mm! kiH‘s.
Survival: A code is hzudlv rcievzm? it [he brmnw immux 13100 (lend to upheld it ’mdWirilr.‘II‘Ji"('|‘I:1I'L1<:!e| mwm have UIIIOI
principlea or oaths, the Hm and [mammal vs LU survive at all! ). Whiin W Il’) hm mty
in any cmymunlrml,
m:hUl'IICI can avoid tilcm. altar {IN 7 mizs PC wm ‘m U.) mmimi/e [hum and 3H Wes Lu be run Hw winning
Always Get Paid: A i10HHW HIHIUH whn «lumn'l 33% pan 1fi('11";¥|'|_(‘éllfrmd‘al1l[\/IHL1\‘JHH4‘IH-‘lllllv’liHiIHZPIHrHlYWIN‘,[PIHIICIHUH
i'u ';lill ulsuving. 'Hliia Human Lurk». primlplu‘; -. |JliHl£U|IV mmmn‘nk , {HM arm-Jul ml lflllt‘lb mm m; win/31y» ‘.r‘.")H“iHQ In! "HO
mgium MIMM, Injvijl rakim: rm yum out ml "-M'JIIUIW‘HT. :md 4r r:t3[‘;lin¢1 1w wwrnml imwivs WM hand I wlitw
Never AgainzThC tl'lamr1mrhas ’suffemd some VJ] "19101) 0| ‘93:; 21ml vowed new w repeat it. Pomapg [he chmnnlul
broke an 0am to DIOLCL, and m . -H1r.2p oplrj, m was sonmhow framed I'm doing so alto; mum; the wumg [)t’l‘ufll’l.
'l'hmlgh the simnw 01’ failure {AH [M be crasmd Iully Llw uharznlm has: vowed Lhat
it, will never ourm‘ anain.
emlQr'huiuierwt 'Pmroiff;eIsllsr;io(n7a1mlismmm: mTwimuurrir‘ijmxlnaLmHww:v1 mmgumng:Hu«eHMarWmI,IIHHVH|1‘ L< |hI1z1lr\rIlln§l{xll-fr’1lpir_m'TnHlm£wIMIhHuVmI£1ilHityW;IIW<IWHrI'lllUru‘W(I{ilU'VIHIHIIU'l IL(I“'grwm‘ v31i wl!iIL‘
{IUCHHUH In vlanl UMH mm! Hm PC 343m Milo [m Hmlw :‘HJ wiwmunl u! HZW‘HKEHiULI'i u‘rmvx ml pWJwJ‘m.
' Jillillé} the 21m " “mar: 01 hi." ' an mnulunlinay untaloppzlm;
Reputation is Everything: To a bounty mum”, m of \lel U; 'sm.r;ut_:d in HM? thaw" While [alga bravado
:I's anlunlw HEIVIIH? IIU‘: 3 g and S'H'CIIQIJ'I many Downy humut‘; wmk inmrgl [u uphold U‘wil
10m: i5 I0n1ll1zc;mHpa'sdlli,nilnpo(uina; nI l'. (:01 me clmilern 0.):1bountyI'mmm hr
usually
I’ewlatiurls, lupm/mg sligms gmd provnmalion with di3g.)m|,mHanan-a Vim‘LHICC,
imruug/ lmntw; \ww {HI WV"! HM mun Mwyw, [liwuicix whvln mm», mm a: Hill!“ MN MW
mmnLive Capture: Sumu m IIHVH. mm rsm iw ,I I UH“ mmny‘ irutuwl] Whr‘lim w. MII «ml «r! [Hula
mr' PC rlmy; My,
wwrmr ‘, ,v. [:Hwtl 1w
umwmuulnm'u, m vlmfl‘w MI HI" mimlmlm WWW. 1le, v ‘Hauvlt w uni/willinllv Il'lH'u' In MM liu' Mi: Ni 7x HRH".
0lNanwo,[JChuoolmwllalmgtu/encrLdal:WmDr}‘ar’lWlmt1ImIa',HgmDeHu:IsUt,HH“mW; eulgitmohm”sWoamiwnenm/0ph>1cHmhz},ri“ccLuivilneil/inIal‘inyum([,.‘LJL1h‘:H;aIl{imU;|L|]IMicHI'S;,mhLU!o(mH"“111i.5l)y1[3M,inIHNmownullr’y;locblmulnu; lrgmlu:su1 omH‘u11 guUe)N! l]omninag,c)a3JwI1V)m,YJiinJnW“:wU[IInHmiCdmMMu[uiillid{nIurgw:luinrn'iwauimpirmr/;'\;.
w1F"inUiIsIHhHtHhLeJHJ‘,’obm:alml i:'§rH1Ml-"’ll"im‘HlrmMlHv WinWmIHwIHII»MHINllfw‘ a[1’‘;[H1w|,-1II1v~aNH|I’,u['p|-"w‘/w(”W‘, 1WWI\}“!SHWUM‘HiH‘giivHaHIH‘xI/JIVHM/iii‘lWll‘,-IlIlIMIWll!H”’IILIIE‘H’JHINIIJH‘I‘'IM'JVIUHP‘ II
erhumL111:u|d<m m {HILIW M pt‘HI:1[um‘-¢I:H il \lew ,1 M: Imam iw [ml UH IIIIIHI L rm/ r- I‘Hw lnml mm: 1 Im wrvwr
fl4‘HIIIII1’Ll‘IH‘ViVIW‘H” ‘ ‘H HHUN‘. Ive/mm»,
ptlr’LH‘LuH
Iw Winl‘nrr iMIIH'J'
HUNTERS FOR HIRE
NO DlSINTEGRATION-I'
BOUNTY HUNTER
SIGNATURE ABILITIES
In addition to the specializations available Within
a given career, a character" also has access to that
car‘eer"s signature abilities These abilities are special,
elite Lalean for experienced characters of the specified
career. They are feats only possible through the skill
and ability gained over a long and successful career:
SIGNATURE ABILITY
BREAKDOWN
A signature ability is composed of three elements:
Lhe nodes linking it to a talent tree, the ability's
basic form, and a series of upgrades that aug» ‘
mment the ability.
NODES
Each signature ability has four nodes lined up across
Its top. These four nodes match up with the four tal—
ents on the bottom row of a talent; tree, Each node ,
can either be active, showing a bracket facing
upward, or inactive, remaining blank‘ To be able Lo
attach a signature ability to a tree, the character
must own all of the talengs along the bottom row
of the destination talent
Lree that match up with
the gum nodes on the signature ability.
ABILITY BASIC FORM a Lree, no other
WtemtarxekuhpeeseestnraifienuranspdLccetiphhs uecaroprcasuehctrnacttoeshirfreaeesaaLefichcdrqehsutbwuirarpeiotsgshwicraaeodfoxefsrpmtieghisrneioelaisfntsutctieghredeneaipanatuobbriiitinelsliitttsyyba.,,obTxTisl.hihhtiyees signaLure abilities
may be attached ‘
to that tree, and the”.
attached ability cannot'""'
be removed or switched
UPGRADES to a different tree. A char-
ettAaLhaahbfelecteielhnibtrstyasuigts,phibncegyaarfrtaoCuepdrrhumeeparcrumahaorbcacfathisytelhiiatnreoysg,nheaaldyubsshpiblwegipteryiuatchrpdoacuenhrresacax.shfpupeaUerrdsteprheivgedetihrnoraecuidfecseIbultsyaspc,stopooimcnuimnnrutcfisezoch,hecramtssaltienhktoddoeef acter can only acquire a ‘
si‘gw
nature ability from her caree’fv
and can only attach that ability
to in-career talent trees.
To attach a signature ability to one
of her talent treis, the character must
upgrade. The experience cost of each upgrade is ctauOnhhcWpaetagtHiuvrrdaraeaeedcllntseeaotsoirbndfiumealiLssttahiyioneyognnhpLaeuattsxhalrepcelbenheetnsarseiitsegneaflntrlcaoeatehtnetu,tegarjetcuahthsbhaaetieltbidaLislmybit’Loysia0f.ttttbcaohTahmehstyaeiuclnewrp,onfoewLowrrnemittocrhetefaaelflate,hdnestthiSigtCs‘‘
lisLed in its box,
ACQUIRING SIGNATURE ABILITIES The Bounty Hunter career has access Lo two signa—
ture abilities: Always Get My M ar‘k and Unmatched
Before a character can purchase a signature ability or Devastatim.
any of its upgrades, the character must ”attach" that
ability to the bottom of one of her current in—caresr Kali
ent trees: Or'lce a signature ability has been attached to
HUNTERS FOR HIRE
N0 DISINTEGRATIONS
BoUnty Hunter S-lgnature Ability Tree: Always Get My Mark
I ALWAYS GET MY MARK BASE ABILITYV
[.Q.-‘
‘
SOHtahr<mem~‘4emt,DWOeiIrS[meH9. ;p”cmhp":e;Mc,4.W.k,, -m—Hm‘u1>s"h,I‘rlm’,,i,We‘ mu.c,HieweHatmsLam,htxchr:ecmhcrahLvaInrCa’xhcsotleoalsnectreaasckukJns'IOddWeorIwI mwnhmwicieohncHhNLoPasCkeensonmplLaahrckec;s, aaHnInL'1IeS6wLWbeaenncagop:upmLr0eowbveedbheebgryinmtshaearksG,thsMepe[cantcd'lea2rNacDateerrsrattiteniavycehPeoAsi-nbtitslhi,teiaenmsdammrkyaspkaelogcaeaHt1io.a0n]ErdD'ISiT'vl-awn ar?
I CHANGE SKILL
Ma V , _. Alwa, ys (J‘Lr‘l, AMays GeL My Mark costs 1 Upgrade the difficulty of the May activate Nways (JeL
dLLlVarvg Destiny Point instead of 2. LhGCk once w I'WJ a rival My Mark with Suwival m
NPC insLeacl of a mimon, nmad 01 Sllcclflvvisc.
W M' .
COST 1!] COST 1|]
[Urlctrerdnilirltvqlm ‘KWW‘CGEL‘
J 'W‘P'E‘d 01'
S‘rleewwisn
EUST 1|]
I I HM..— I INEREASE EFFEIZT
REDUCE INCREASE RANGE
DIFFIEULTY Ii the character has a star: Upglarilu the LIHHCLIIW ul' 1m:
Upglmic L‘nc diffiCLHLy 0| me aim) or acuess to inLerchl» (hock twice M) Iind a HUI] min;
chew: once LO begin WHZi'I me lay" Haw she may 010056 NPC (or player Llwenacmr} in,
Seduce U”“. difficulty gr ma] R in £11erde dilterem stand 0! a miniou
:13 r- - < 3| OH 2| mark. ll
9‘9““ [0 afl‘ivnlp a (ha /
NLVJKv-IH planet to be her
(.Av‘y') Gm My Mfi, rl/‘~ rA7)
SiIC does so, she Lravms [0
A erage .1
NHL mark“; world
[EST 15 \ ,,.._._.. —- [DST 15
SIGNATURE ABILITY: Change Skil I: When activating Always Get My Mark,
the CharaCLer m ay make a Survival check instead of a
ALWAYS GET MY MA
Streetwise check
The Bount,y nHodOucnWatrflegrospebonastysieeunsnst secsbaenainnngesdu,ndplueaarriavnilngleglaedhnouknntleaacdk Destiny: To activat 9 Always Get My Mark, the charao
tel" needs spend only 1 Destiny Point instead of 2_
to
. Effect: When activating Always Get My
Bounty Hunter may choose a rival NPC
fOr Ir , a minion NPC. If she does so, upgrade the
,
urfldlfiéfl(.ndg, Increase
BASE ABILITY Mark, the
instead of
difficulty of the check once.
oIl(\no/f1rcaarareml<aP,istnlhaeieoyenBrENoCffuPehnCact.rtya:IcfHtWseuhrhne, etaedntrotemahsecatsyiGvoc,aMhtu’ioSnpoggdsreiasAdcalrweenaLteyhiosmene]dGsiiifnesfistctNeuMPaltCdyy
.Q) yaaOC(NpQFnlPnaEIoCrfinE'ta'fieShioWtefl]irdigEe)hlapEméin»drtdfis-Inprvgtmo‘n‘‘fae—tdnoC‘Sidssot ebm2bkseanpsDSociaIohewhCrnease,rtbpctihnleketmayh,rsteaqPIofrutnokhsCa.iaehnhlleittSasyNir,nhs,aPfeauocCpncrtecmedmerirsaumetstdhomIa}Otsneka,Ieky1Gttsnhh[Moeoceawrh,Hs8cohahoatdamhasIvr,Sirdeees--
fatecrte1r06t9ar]ancgk‘r a[TsQetQ'hEWetIWWCIthshaeeraCchteorserenamchaersk, and 61 new encoun— of the Check twice.
the mar k's aIbpnelsactnraueesrasteashdrelyptoRwloaitctrhnaagtciaeok:nhdyHtophwteehrnedBraioBvmueoyn,utnAyintlydwHiavHuyindLstumeGartelekrtWnhMohawoys/s3eaMcaccreuksrrsecantont:
location.
ICGatiopi0er1ncp)t,huaroMrlWflvneyehsf‘ffioa,6a1rn;cF_3‘gatey{'?kfltU”ha7akat?UhmttwHeCmgdeMCeigtrMhoh[efstwecathehSafifciknesNihlclaatedCritntrh;dhcaeeoLt1ciuad:vk]nkiefetofitesorcAr;ubpaltlaicaylsitfctloovieerwaf, stetaehlmnleoynuAacsslShwptietauatcahgbyk—eees, TgosRMB[ipneoaoeyectnkudenseManu.ddltcdrayoeie@ufrwakrHDsidnnhfiusyri:gefnofiAWtmstcesvhuuruheebtclehrmdtacayriuse1gat:etyeaeecTddhcnhus(t'eei1aQp,vcpngaskttQdrkhetaitiednlo)dlingecicisnnhahAcsttepeehrtlcewotnreukadeacrdudyteuocsibsfoefiaeatfGocngcsHduditeneiyvlatstr.eayirMondtTweuosyhsiu(fAetQhiMtcnlhwoGgQaemtaMhrysQkpecsc,lhime)cGet,tanhaac—eeekyrt
UPGRADES
Cha nge skl.": When activating Always Get My Mark,
tje (V.,fr , Underworld]
may make a Knowledge (
1erk1i3rf1£ter
c 4 “stead OI a Streetwise check.
HUNTERS FOR HIRE w
NO DISINTEGRATIONS
NARRATIVE ABILITIES
any signature abilities [such as the Bounty Ability, other PCs mighteven have time to pursue
i tasks of their own in transit; the GM might want
I "Hunter’s Always Get My Mark) have primarily to offer'them the chance to restock 511991765. r651;
narrative-effects. allowing the character to instantly.
gain access to something the group would not nor- or make a check or two of their own.
mally have. These abilities are powerful tools that
allow the players and GM to work together to tell a Further, sometimes a particular NPC might sim-
more collaborative, cinematic story. However, they ply not be a suitable target for Always Get My
can also pose a chalienge to the GM as the charac- Mark. While the GM should be open—minded
about letting PCs use their signature: abilities,
ter circumvents sections of the planned narrative. going directly to a certain NPC might throw off
the pace of the story too greatly. In such a case.
BecauSe of these potential challenges, when a the CM should consider suggesting an alternative
player wishes to use a signature ability with a nar- mark to the player—this target should lead to the
rative effect, that player must first consult with the one the player originally wanted to seek or give
GM. Together, the player and GM decide on the her some advantage in the coming confronta-
effect the ability should have, fitting it into the nar- UOH bgtween the two. thus giving the player the
rative of the game. However, as with all things, the. agency to-push the story for‘v‘vard without causing
GM is the final arbiter as to the effect ofrhe’a'bility. excessive disruptibn. From a narrative standpoint,
the character might even believe they are seeking
\ Always Get My Mark can be particularly chal- their intended mark but end up finding someone
else who is useful—though the GM should gener-
lenging in this regard, because it allows the PCs ally yvarn the player in advance of aCtually role-
to “cut" from one scene to anOther. However, in playlng‘the scene in which this occurs, and give
the story, the characters do not just teleport from some hints to the player why this result is still
place to place—they spend the time traveling, helpful to the character‘s overarching pursuit.
setting up, and doing the legwork of investigaticn.
For partitul‘arly long trips using this Signature
“H ‘ A ‘v'
A
Bounty Hunter Signature Ability Tree: Unmatched Devastation
InIlullmIV-WIVOHI‘H‘Hr'ili‘m‘k,LIIULIIILIIIIL’IHI Illme‘rzpmul')Dvm‘lml’ningw‘MmH-Hgm;1.}{[1.‘.WH|,Mnml
(“Himmw mm: m ‘m | MI ".‘JHII wrung m mmh'w rgth}: 1hr: rivn‘me Im |mlmmml [me mm. 'Iiuuwmirsn
0"” mum:W‘I 6‘, 1m“ M‘hiflrl
'W'k Isl lHIi‘ W ; Hm
'. MI in: MI H mm we IIWJHliHlHIEWMFIHL‘I hut-mm2:1hz.::u,t\,/Hser1Iiwinmm
MW \ Wm M
m,{Ht-Nu mm! iw m W n m: .ww ,\ u
[EST 30
I REMIJVE SETBACK ‘
PVIIUIIH aw! lHI'HI H mum H ISU Irw, m Ilmn mu; LHH wm‘wW‘mm HL’HHIH], 5|
Ii‘HrJI rrqml In mm, in HnniuL r‘HUK HJH‘H Hn IWW! ‘1, 'l‘; pm wt HHHHH hwi
-,
Uta/LILMIMI, HJIIIUV“
III' rm ,r; NLIIHI'M UWJ'“ 1w. iIthInfwiwl l)(!\./LI‘;L'|HUH. mu . 5H chm L mm» an urn!
am wpml w I71|H~." IH lfvrmrz‘xu
Wm: ’ml may HT [INHIWJMJ Dru/.1 “win”, 'icLlnfn L mwmltz.
Ilww :1 WI Hum
I REMEIVE SETBAEK I IMPREIVE MEIBILITY " I INCREASE NUMBER '~
[JIMUHII Hlvh mu ll mminéfl V‘J‘m-n HHHHé‘, :1 'UHHJZH J new: mrlwmwimyuum‘w Ptrflrnm aultliliunn‘ (ww‘mt
Liw’ml 41ml UI Llnmrlltiwi
’HV‘M", (rpm Iw rm}, \H I"imim , my! HI \ mmmnilul DI: WIIML MM .) Wain mm(:hrv‘u‘c; m IIJH‘M m
Wu H Nwmim ”WV l'l’ [Dr whim} “mum/1 m gmwlm [ill Mvwo mm IHHL‘TW.‘ Numim Imam ha
WW II m r In, A HI NJ IWJ W L|\H i-tm mv Ml III: M [EST 15
1M) Ir! WWW! MI:
SIGNATURE ABILITY: UPGRADES
UNMATCHED
DEVASTATION Draw and Fire: Before performing each combat.
Check with Umnatchcd Devastation, LI'IC character
(film)Many 1:81!WHLS Hill 31; soon 13a BOLII'W HLH'LE‘I shows may holster a \rVEE‘IIJOH and draw a dil’l‘erem weapon
U,p bum 1m! Irgrhal. |y ()[JCH fire tny/{mg men‘ as an incidemal,
(n 1‘" E‘ at Wil mil 9 e1 gunfight ratl en [ham a {ootrace Improve Mobility: Before performmg CLlld' mmMIMI
C MW: 5 IILII n; [OHS check with Umnatched DevasLaHon, 1,110 cl mmml
A VeLma Boun y H InLer usually may suffer 2 strum L0 perform the Moven’ mauve ‘
[0| diHmCIt aim Hon an d Ulr Icl|.(th em incidemal [this does not mum IOWHM H10 I'1I_|ml'>ra"
WCE‘I'JOIM;
of maneuvers a character cam perform in 0119 mm, , '
D‘3V*1'5131Lif>l allows [H.l') Ullayclclm to unleash«them all described in Maneuver Limitations on Lyme 1200 of
0er'3‘ in1:1 sin glc destrm Live salvo o[ overwhelming the EDGE OF THE EMPIRE Core Rulebook].
[mum g heme the
reilvil[01cc Ar y ImgpLg who were not Increase Number: The clwaractel may pcrlorm (mo
My impan [I EHO HkGW W ““39 C‘L acldiuor al :rm‘lbat cl‘ eck using, a non aaLar ml ip/vol’ iclu
B0‘ My Hm i: Lli-issmllt weapom 11:0 almzudy used thiztoun (MOI (2 ch In M“ 1m
{j di wchyr—ngumlw H W 3’6 "H C'I'W Numbm Lx|_)g|ada pmd aged. The (liflicully ml each
illCh a combal. check is ix'lr:1”r3;1<;e(j by l for each sucrmsml
comma. C|"|er;k me chal'arglcr' has pcri'awnuzd this tum.
BASE ABILITY
Remove Setback: When making \ comtml (I'lcr‘k
0 mg DH" 3mm ';*~;31r>n aw)! pummme cjcor'Ildl'aI
he Ias part of Um’natchod DevasLaLiol‘I, the (:h: 121m
”AW(1 cllauarLer | nay SPGW1d ) De_\ stiny (‘
'31”: Ler removes for each Rmnove Setback upglade
H:IJGI fonn our: addiLmn a! (,mnbat Lzheck egal 3-. n 4 pmci‘uascd.
illSame L rgol a; H (:ident al Target Priority: The r;|"|:;|r;-,1ct_(21 ”my clump-'0 a new
legal Larget for each 031111331. Chuck n‘lz'ldc as pint of
m” m tilt“l1l.1‘T31I'fah)m"De.EM(dHROiIfCIfi'iW,Hc’0TuICSlatHLyICI0IU‘H!‘S';lSh5MH|iSIImmt c'lloiHpHm’VmifmLI‘Hllcim‘ihlpmm\klM. Qi6;HW1Dm1O“‘aI Ic‘(ha:.uifilKlwaellfLdllr”m_m1le04: (J "z
IJHH'IaILlwed Devastalyirm.
”WIN M?! 11:13 {ml :HI'C adv wsofl llIiS [HI v
:"
HUNTERS FOR HIRE
NO DISINTEGRATIONS
$5
i‘l’m Sta {ting to understand why you've got ‘so
manaywt btohouiu.sldn'stvioeerstsohonof ttyhfioinrusgrt,'haaenradedy:goiYvuoe!un?‘relwfyanoronutinvwgeesryreIégtoéé0rxfij’
—Dr. Aphra‘, to Han Solo
I
., choose to run. While no single‘implerhent ua . ‘
- tees succesg, a
tool for the JOb '
arehwd0laauerr?dn;seympfOii?erls:t2hetae9ms5r5s6the.ClelVivyheeasclllaoeasn‘gedgaeamIsnns‘gatoernaerolltughssreoeirra,ltitsf,eq,uobafuarotnrpidteosst.aroecvTgleehures-- bounty . armed with tfie 912;; '
hunter
has th‘evgreatest chance of Vitfdry' .
Come the m, hlJnters need the right tools. ItttvoBohhatOoeeThliuslhemserair,istbgyialihnetcnetthHdembgaureespevnautsetenrcethrstorciycflua,ploPlled1arrslena.bsejdyetuehevsntareahttsnsteCa'rtasehthswr‘awoeeoermiaaraerecosdtstfaieitlpnyoerregg’nfscesatitebahswsrele.vloyatehTrrakehsc,truehmlhoioatusaehsléntmduehtnoléi‘ftntWuonokifrtgosst-ahahr;
2:515:5S-0O“.HfEodr'htuhneterhsunintvei‘essqt‘vubiitapacml ketosnot—mitsewesouafcpecovenessrsy:,
Pr
and
bOUnty th ey claim in ‘their shitdhea, tangidvethtohseemwhaon ‘
‘armo gear, and even starship
F.
Over those who choose to
'
'
N - , N5 t‘ sAwminohewaeaeeltisxvhlulpe-eree,erqrsoiueirtifmpaorpearde‘qdaiduflfilihrhcesnuusoltntertatetsrasrdropgcafaaennttgchedkhrrieasoaanputdossvlseaepardanireindsotyyofan’awocesiqfrsthuicgbiOsnnriomutoiunoestnenishtrt.£-- '
nesses or. evidence.
EW WEAPO
hummus
' ‘FftoIena' fimgrrtgeOd/She'OpIfteUIfoe,:nw:artte5nnee,ntrrysaWt risccsmhaoeeeannn-ta-haktdSrleeaoUroycFwftne.sepseilt,oeehrvemdoo'Vqerueuedttnir.arfteu‘keFl'oirunwfdrgieniatfhaftndeiepmyor.roemwibndnnoosatruteiaisaOn,ptdIypt‘1h,r. eob, arneceahecedhss-,
,
V
.
GUNS 'BLAZING W}: .
no Dmmmmn:
ENERGY WEAPONS "SUBDUER-9" RIOT BUM"ER
lbshoaTmmivtnurthuehaoodnenkesutceetregvasssrvambspeelo:uaftntautumeitvrnbhnferogleaotoary,lfmoisvmsfhtaweeujuat,ohrhgbnjbaieootct“lneegrohtidrmtoodtsyyoi,a.mjsobdraokboMl”elaf..tsxhsajvtSototanreoboueryrsifmgmethcseehreaenelfptnqeyrhrornureeegmovifrsyaetpetlrauhbowtrsaeuhfteftibenceoaolturpepevtlpoaaaerintrrrnobgs[ss0gtoeaobnthLphufoaetowuosuvdwnhenfetboaettryeoar,tr Although jusl; as heavy and unwieldy €13 many
"PRECISION-X" MARKSMAN RIFLE “3”” er'i:cedsatblehoutnnluateeltthlnsrsaraSt-cteElaestoUr)rerw"sneafltvtemlivareba‘derolnplegaardtoyimseobnctlunaosuoin,agmislvllteirmnkeitsoeoroooelttrynaneesLbwntwemolthaoo,iidasrrd‘tatennbhoestclyeraaeslnatsrfhdeotsteJeehatraidsre.nccekgaWirreneICJbsfdfUautmeuoIplc'cykOpatiyiripHvLnléOiSetflbm’a'ng[llhaetTmflhesshp?etsaeoeL)}9dw.aC?0l'geflJVkh'Scahreuitw0roe,b»-t
fsecppCifomarttrrosarecoopcddtdtdurtkhreouuerew‘sccoginaiseeerfggsiadvtsuhnepAanewseosricsxqeanmseetisuns.nnoeossetOrsuh,p,ycoegneTauhecbih“p3giPuaeahottloratibfezciteicoblknthisditymeeselewip=eorpif5incavflin,rioeenstXmimsryta”y,alweonscsrneaeyooeanrfti’foepemefhsyo’rrg,eaontihnhsmrsngediossoltwyhsnatheprhmhemwoaicgarvshdothieaenmlsmtymtahpbtacaioahenonnoenveu—dtnayy.- ettehhraqa’esesGnucidigwppveeieoivslpnlwte‘ihnlnoeWteghyrirtferh'hulesiteltlheesrmoewscooeawwapbapnsvpeitaiohaouwbmpumiiwolsstihntalhiyesoivcrnsopiho,arrlyht;emsafbtoeranhelmrnadeapysebutfseolptleIairrmgestha.iLmpootcee0nae1tSfljh'kOatieenarletpatCpChmlletW'Oeeflawr”mgrsW,1fCgmfe‘igasrastettiniuvo?d0ern)-,5‘'
tmaenay.rmNoervyerotfhealneygsh, utnhteeyr
alive and avoid incidental are a welcome n to
who prefers to addlgorgets
harm to oLheFS take La
sSbecfaitbctnLhuhahxnoylLgolaalIatlTcuIeWr’sn]telth5nrtin;thindxeehflttdiLoy[egtatereahrspmm.nanPotph’pocdsoarrTuhieeontrgLsthnhadchcodgheeotimaiieues,osnfpnpcritbaeousibtsnewotyerfswnlofswyapertecsXrtasariechycaretpcbtreeianstnooxeobtrlgwnthhg'lsreocoa’IeeratneaotsfnslrsoolCcxreutlttbeyrrcuphnshgedbiriantancethasuirennessesisnnsgtoeaseluegiet,morgdthstsshicvth]leeibeeiy,neyenttuwtcorgtaatbalilihi,ninmlnmlrtaaotgthmsmagesntigeetrntoaagdgirescskimrbtmeehieirrlontauaosaamgngssmrngmb;eaestoglsei}sibivdf1enaoeesmmpsimumdf.r,tOtosaesaeaWguaAiaeainngleedldtdttlltyarTibvealpi[ippuwhvoagsilndniennol-fr.l OTHER RANGED WEAP0N5
lqocthMBehounaaelaamsvm;vnseieoktntyoeslngayrlehsytiwhenutsnesuinhdduisthareerevoewrafelsuasatlfitryherrim.wanaer.Wvytaefiengatehsoyhpatefotp,yntaionoOsdcnoavfsolisannWbntshctLOtachaooVtuegfmrErbe‘eigpgeNslatl,‘et1aleaaLtflreDxG"dbUyIaiI’h,g.l. nUaga0yLfl,''ne,"whddbre“lwQxe9yLf_Iarlt’'oflal?a'PLm”rlVyay,eWeyeesjHcaov“a0tepbo“r‘‘t
..
FIRECALLER" LIGHT FLAME PR0-IECT0R
“melbr”Mfl)rf~. 3-0r1n,s ‘ naVe
model flame [7f'OJ9CL0rjmong
as much fear
and revulsmn a <
encountered
. ,. 3mm,
them €19
TABLE 2—1:RANEED WEAPUNS INSplr‘ed almost
Name ' ed}th, ose who have
Energy Weapons flL~///Rarity
" Ranged .9 3 LU”?
‘
Premion vX” VJ
Ma_ r.ksman
[HHWJ ‘
Rifle
“Sl.sbduer-9” Ranged 1,500 ‘ a PierCC 1. Sum sewing,
Riot Blaster (Heavy) ‘
Dther Ranged Weapons HJ ‘ .. -9 3,
5 Cun'lbelsom
0 Short BIasL 6,
‘J
5m”- Stun Damage
“Firecaller”
Ligm Flame ,
Projector
Ranged
(Light)
/ ‘
;(V ‘(2' » l ,‘ ’/ u v, 1-1; 2‘ Burn 7
Final/LI” V
(R) 1.2.00
Lil-HLWW‘T' 2:391) y, Vicious 5
Re: I get] 7J r
{Light}
J M‘JdiUm
Nova Design 2 450
“Impact" 0
Repulsor Ranged 7 5 Emnrn'r: '3
Cannon [Heavy] J .
“'*/ KBMnoScLkd3O7 ’VCV.OHHvL.UP'’I5’A5MJH‘?IEI,
5 Medium
Slowrlih’mg I
’r)
1 1,000
0 GUNS BLAZING
NO DISINTEGRA'HONS
k /“Firecaller” Light Flame Projector
EWgithgpS'fiaéhhiesi'dIEJgr‘Iag laanctdaicnidngfaowmveelol—runsbmeeihnnigsttotImhryaonroefthcdeoisnEicnmeterpngireread, addition to the grapnel—I'Iarpoon lauml'w's pa 7].
Il‘n‘ a CI‘IaraLtmfnf;
as a weapon, as an action, (Light) chueck My
blhtles an Average (Q Q) Ranged
make to an object: within medimir)
aOnusthNoemwe;j'tmifigghhtt?llalflvleeApladnLnlflel dplathfleestearydregaodvfgurlmwneean{ts secure the grappling hook action, he may reel m mel
On success, as an
range.
cord, pulling himself to the objeCL (or, if the Objeft is
have [aktvfirlytYl-f?s?t?ep on Lhelr qwn, As such, Flr’ecallers Lmsecured and lighter than he is, pulling it La him} A
to crlrmnals, bounty hunters,
have [FGH‘Iendj character may use the grappling hook to pLIli another
Wl’NJusflappeal reputation
and ‘ihOse towards such a character aloft with him; if he does, he must make an
_) ale drawn
for the Firecallers’ m famy lies m its uncom» Average (Q Q) Athletics check to avoid losing igis
grip on either his partner or the launchen
VELEZLZTJSFOH acc-elerlte’derivauvc abandoned by
the comfuelxpa‘n‘ as too . for
unstable NOVA DESIGN "IMPACT"
REPULSOR CANNON
aSUnstae“ntcienentbhdureeamidinf;vyoa0'gr—ek-5m:LWaIncre3cohrmhelpidpg‘dlahberllyyeygdflhflaletgomrhsmLtheaembtlypepelrccahatelumrfueiecalasnl dussufeiotd)r;
rostDheureescsuhuplstgieaetaesdlaotNxhiunyoet,vsxaiud'ctbehpDiequeluossfioiptgyran«rscotApaifcenrurmcn‘eiloaaspml.rtuyslPsvowraroraelrdmriaaeup:nlcyoLtered'lscoelfbmemysaodrlaopoIgLgrcfoliyfgoadnrcaurrirVrpIrtjLriaodhcnwarrt“;;
jWiiflinnteebdOaflurpadreonmexnrgp-zeJ-d1iLg0W‘lePIWLereepCraay‘yms/LLfeeO.utImél.’sIIrl.SrioejodmsuaA‘gyndhlgethaevaoarosrusmmugtashoatlirAlnebgasalnopcwdwrhaobypuabrncolokdat,fsseetcthovtifeevvrenoecrmlt'whLgielemst'mhaeerl[vImscataeosvl
Specializing in unusual armaments as an EilLCl'HaLiVP
mm“ t1”(W9, e harm on novwexposed Mesh. gpHotorrfoaondvspiitsLeuaairnsclbyil,odninri"fbsgeurrruitaioopttrthtaiiobosrIgnpadesLsitLisoeLafnrhrbssoe,lmin[woLgherncaecapfafwoerI'lmIecyOLasIa’pIo-nocvnylnrelesythaaactlhlaetasiowLvanseeraeaiafpscofrolanoecfinpuaguTsJbLeha"ladép;i
the weapons remain focused on their Largets,
GRAPNEL-HARPOON LAUNCHER aAwaiahtIsneslsuseOadSsanamflaiosotfpgeuficrmsoerbcicasonelhautatnso,ecltwcltiksyvatlauuhoaseslonp{mmrleoygteoorirewnvovecs1tgeealgo’spsuanum,,ebni5ptonl'conoamo0ui;ruefinw1dlo;rcymstinisuthohyjarwnoarasbbcoshrlbglasoerelih.kmannlyLsdvaItpptweeeuioetnrneriastcspsnhteriituagoahhfllentboaieaashtlarrvtei:splwehsafooahttwsaolanbcilsloodecldeoeewltoasu,aicpppinntnsoaeohttegfy.srnectdLp‘,ynaiIobn/eepmobtcbbh9rtuusiunrrepamiitfnnlsmleonlIeogyyt:r:
Egg???dug-95' EMA MtEdI’pOlrUaogunhnLsc‘ hdOefl’vrsmasomUtmoo(fllsthPefhobar arcrlaliCmnocb‘einInagsntedoarL‘dalirfapt-rigqn——g of its lirmtations.
A” uqon,AqgttiEnhhUulngeetnahfiIgsr’mCiTrdaciWlée3{ég§ra:-aahm9igr(-)ppS5I1,rISlh'WL1OUOp?-3lldfl'Kfi5eegTl—nle’uNtflmaVste‘IstenC'wcm,gL‘eg‘eIlb‘Iseaé’wHystgmSaggOerbddlyfisp‘ogtpamuhbofsonygnt.mrtaeyItngnchHtosihoetbm;uhnva-neeI-bcnltseakecn,tarlawsmtpbhhUltmoeou§rs€dree,dmIeaovg’gIonIeyOlfrn’agLt\pho/Vr“‘WllLtaIjldkeiflwnege.l
rFEIVTOLIg|"| grapnellls Po'wrev’fgl
magma}- of a
I’TICQ'Iamsm
”heGebWOne‘gUenumGag~t'ryheanH1y1JJfMl'W'wIGflE‘fFhh?'S{WcWtCEOChLlflHKajLYSn’IIHcdSeCl‘lsISaCrOfleofOnsglu‘etphtmteeinrohgr'Lueaap'r'al”g,iiemdtaspnmod11r:ftutaehlnnlu‘stsluyn,darqeLnfyhse[‘
GUNS ELAZING a
IO DISINTEGRATION!
TABLE 2—2: MIERD-RUCKETS
'M'iErETéEEkets’ ifigféfi 8 4 Short ‘ i ifSpecial
AnLiAr‘mor : 1
53:55): ‘ ‘ 7)00 ‘ Breach 1.
1 ‘ 5i
Wigs / 2 Short “
Explosive Egg“; 1 Limited Ammo}
(i 2 Short‘ '-
Flechette Rar'ged Blast: 6,
[Heavy] 6‘ Z» Short 1 1 150 4 LimiLcd Ammo 1
Incendiary
10 23 3mm ’ 3 BlasLb,Vicious i),
Ion 5 Lirmted Ammo [
HI)‘
‘
1(
r Blast: 6, Burn 2,
‘ 1 17Jr
1 1 J Limited Ammo 1
100 ; Ion,5ur|der,
(J
3 LiImLmAmn'1r,) |
M iCrO'RUCKQL 3‘ 7 Medium
‘ Launcher Pt'sLo!
ESE? ‘ O\A
MICRO-ROCKETS EXPLOSIVE
Many bounty hunters invest in launchers to fire min— The mOSL common varieLy of micro—rockets have Slm"
iature missiles with specialized warheads. These are pie, high-explosive warheads that provide the m'axl—
often referred to as “micro-rockets" as a category, mum amount of force possible for the miniaturized
though some also call them “wrist-mounted rockets” weapons, While other warheads may be more Wired
to specific kinds of LargeLs, most hunters find an
based on one common launcher placement. Wrist- explosive rocket rarely fails Lo make an lmpreSSiO”
mounted rockeLs pack an incredibly powerful punch
for their size, and are made with a variety of war- FLECHETTE
heads available to suit any target. Some hunter's go
even further with these weapons, installing specialized The warheads of flechette rockets detonate JUSE
modifications rocket by rocket, in order to maximize before impact, releasing a cloud of razor~edged metal
their performance. The cost of such operations is Sig» Shards to lacerate the target, or anyone unfortunate
nificant, but most hunter's find that the effects of the enough to be nearby, They lack the penetration of an
rockets more than make up for the investment. explosive change, much less a dedicated emu-armor
warhead, but the flechetms inflict devastating wounds
ANTI-ARMOR nevertheless. BounLy hunters who hunt huge beasts
or predators sometimes favor Mechelle rockets, as
When faced with heavily protected targets, or even they can disable such creatures over several volleys.
light vehicles, warheads with shaped explosive charges
allow a bounty hunter [0 make short work of norm ally INCENDIARY
impressive defenses. While micro—rockets of any vari—
ety are insufficient to deal with truly harder1ed targets Incendiary warheads are loaded wiLh flammablef
such as military walkers or Speeder tanks, anti—armor Chemlcai mixtureS that offer the devastatirlg Effects?
charges are more than a flame projector at in a mir1iaLuri/_ed package, Ruth—
war droids or combat up to the task of dealing with less bounty hunters have used incendiary rockets to
swoo ps, let alone an armored literally srrloke their targets out of their hiding placeSI
soldier or bodyguard
USING MIERD-RDEKETS
n enerally, micro-rockets are fired using a spe- rocket without any sort of launcher or mounting
he uses the Mechanics skill for the combat check
wtr5reiog2omcg.rckse,ieeadIt)tnlh.izoteoaIaufdrgmalhaploauicnnurnhcnocahhctmr,haWoiwcnauitgtienthhrmtosionuyaiucgstttrttreoeiasm-amrknto,tpyacotscksfsuheoclomtthrosteicnaonfiasgrftnetfifihnoreabingneegmmrpsjiiucscarry[g0ryoso~»e-r instead of Ranged (Heavy), and the difficulty Of
the check is upgraded once.
Micro—rockets can only be modified with the CUS‘
tom attachments specifically designed for them.