Prospectus

PROSPECTUS
2017

Centre for Applied Molecular Biology U
University of the Punjab, Lahore.

U



Our Mission

Bhkaanancvnaouoednrdywacpheidtrnnlglaevoiaaedrsaigsdcsoteleihscfiqnnugrntuotveuetceutnsn,aidiutcucrnsetwiulekisrioidcvncsinihnrliasaglutlitteatcsohnoeisnihcoofeaaduidnnnnclsewaeriadidrtesamoepwetohrdpcrpyencernplormridwowioenasnocatvilhfsagtpercieutehasdimrhwcrsvgleeaeheeathnasrntprkhiecycttonignreenorifneeoisgoih.tswnwiobAiriimbcugeulswicpaaeihrtlsladluoieuedhftreglsradoykttatbeleraiulditnnwlniltsrosmeiotgeatndsarioseirdtessfkhs, e”leowe.moxficoisnnemdkalaooilttneimreongadncl,e

Centre for Applied Molecular Biology (CAMB)

Contents

1. Quaid-i-Azam Muhammad Ali Jinnah 1 Cancer Genomics & Therapeutics 24 8. Examination (Course Work) 39
44
2. Dr. Allama Muhammad Iqbal 2 10. Academic Programs 26 9. Grading System

3. Message from the Vice Chancellor 3 M.Phil Program 27 10. Re-Sit Examination 46

4. Message from Dean Faculty of Life Sciences 4 Ph.D Program 28 11. Re-Admission on Medical / 46
Emergency Grounds

5. Message from the Director 5 11. Extracurricular Activities at CAMB 29 12. Withdrawals / Additions of Courses 46

6. Teaching / Scientific Staff 7 Sports 29 13. Submission of Results 46

7. An Overview 9 Study Tours 29 14. Credit Transfer 47

Establishment of CAMB 9 Character Building Society 29 15. Comprehensive Examination 47

Facilities at CAMB 9 Jounral Club 29 16. Research Proposal / Synopsis 48

Activities at CAMB 10 12. Symposia / Exhibitions / Workshop 30 17. Thesis Examination 49

8. Objectives of CAMB 11 13. Students Affairs Committees 31 18. Appointment of Examiners 51

9. Research Activities at CAMB 12 14. Co-Curriculuar Activites 32 19. Appointment of Supervisor for M.phil 53

Forensic DNA Typing 13 15. Admission Regulations 33 20. Freezing of Semester 53

Molecular Diagnostics 15 1. Advertisement 33 21. General Recommendations 53

Molecular Virology 16 2. Eligibility 2
33 Criteria for awarding MS/M.Phil Degree 56

Genetic Diseases & Genomics Group 17 3. Procedure for Application, 33 Criteria for awarding PhD Degree 2
Admission and Registration 57

DNA Core Facility 19 4. Incentive / Facilities for Non-Phd 36 2
University Teachers / Officers Guidelines for Preparation of Synopsis 58

Plant Molecular Biology 20 5. Incentives provided to M.phil / 37 Guidelines for Thesis Format 2
Phd Supervisor 59

Proteomics 21 6. Programme of Studies 37

Molecular Genetics 23 7. Cancellation of Admission / 38
Registration

Centre for Applied Molecular Biology (CAMB)

Quaid-i-Azam Muhammad Ali Jinnah

U

U

“Get out of tranquility and step in the practical life. Dedicate your faculties to seek
improvement in every field to make the condition of the people. It is only then we
can be strong enough to counter threats to our nation and defeat our enemies”

(Message to Bohar Students of Karachi, 13 Jan 1941).

Centre for Applied Molecular Biology (CAMB) 1

Dr. Allama Muhammad Iqbal

U

U

Centre for Applied Molecular Biology (CAMB) 2

Message from the Vice Chancellor

U

U

Prof. Dr. Zaffar
Mueen Nasar

Centre for Applied Molecular Biology (CAMB), since its establishment, is committed to conduct
goal oriented research in the field of health and agriculture. It is one of the leading centre of the
University of the Punjab, which is playing a distinctive role in the advancement of the field of
Molecular Biology and Forensic Sciences in the country. The researchers at CAMB remain
committed to the mission of showing continuous progress and excel in their specialized area of
research. The centre is widely praised and renowned due its unwavering commitment to provide
invaluable services including diagnosis of infectious diseases, forensic DNA analysis in crime
investigations and DNA sequencing facilities to the community. Besides basic and applied research
activities, the centre is also offering M. Phil and Ph.D programs in Molecular Biology and Forensic
sciences. I am sure that the hard work of dedicated scientists will leave a significant impact on
the health, agricultural and crime investigations in Pakistan.

Centre for Applied Molecular Biology (CAMB) 3

Message from Dean Faculty of Life Sciences

U

U

Prof. Dr. Muhammad
Naeem Khan

Centre for Applied Molecular Biology (CAMB) is one of the prestigious institution in the country
involved in research and teaching in the area of Molecular Biology. CAMB is equipped with state of
the art R & D facilities like DNA sequencing, forensic and diagnostic facilities to the nation. The
services and efforts of the faculty/scientists at CAMB towards quality research have been
appreciated both nationally and internationally at various platforms. The scientific data
originating from CAMB are a valuable asset not only for the overall progress of the University but
for the nation as a whole.
CAMB is offering MPhil and PhD programs in Molecular Biology and Forensic Science in order to
provide the nation with a team of highly motivated and dedicated scientists in various fields of
life sciences. I am confident that the students will benefit from the rich academic environment at
CAMB and will contribute remarkably towards the national progress and prosperity.

Centre for Applied Molecular Biology (CAMB) 4

Message from the Director

U

U

Dr. Nadeem Sheikh

Centre for Applied Molecular Biology (CAMB) welcomes you with great pride. We are glad that you
have chosen to join CAMB, University of the Punjab Lahore, Pakistan for your further studies.
CAMB is a prestigious institute to inoculate the intellect, professional and social development in
the students through education, commitment and pride with an exit as outstanding researchers,
scientists, intellectuals to lead the community while serving nationally and internationally. At our
Centre, we have state-of-the-art laboratory facilities, highly skilled, qualified and experienced
scientists in the country. Centre's contributions towards Molecular Biology and Forensic Sciences
has widely been lauded nationally and internationally.
CAMB has provided the platform to establish the first Forensic Agency of Pakistan. We are
providing Core DNA services across the country as well different Universities abroad. For more
than 20 years, CAMB is doing capacity building of the youngsters who are willing to opt Research
and Development as their career by training them in different areas of Molecular Biology and
Forensic science. Our major beneficiaries include law enforcement agencies, general public and
students from different Universities nationwide.

Centre for Applied Molecular Biology (CAMB) 5

CAMB scientists succeeded in their field of expertise and bagged many awards since its inception.
We visualize providing a pleased and enthusiastic atmosphere where our students can feel secure,
cherished and can flourish to have a vibrant career. With best wishes, we look forward to be a part
of your success stories as you journey towards a vibrant career in the area of Molecular Biology
and Forensic Sciences with the aim to play our part making you a good human being for the
community.

Centre for Applied Molecular Biology (CAMB) 6

Teaching / Scientific Staff

Dr. Nadeem Sheikh Dr. M. Farooq Sabar Dr. Aleena Sumrin

Associate Professor Assistant Professor Assistant Professor
Ph.D (Gottingën) Ph.D (PU) Ph.D (PU)

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Molecular Biology, Molecular Entomology Asthma Genetics, DNA Core Facility Molecular Biology & Proteomics

& Molecular Taxonomy

Dr. Haleema Sadia Dr. Amjad Ali Mr. Manzoor Hussain

Assistant Professor Assistant Professor Senior Research Officer
Ph.D (UVAS) Ph.D (UOM) M.Phil (PU)

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Molecular Oncology Molecular Virology & Forensic DNA Typing &
Health Biotechnology Molecular Genetics

Mr. Zafar Saleem Ms. Rukhsana Perveen Mr. Muhammad Bilal

Research Officer Research Officer Research Officer
M.Phil (PU) M.Phil (PU) M.Phil (PU)

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Plant Molecular & Biotechnology Forensic DNA Typing & Molecular Biology & Proteomics
Population Genetics

Centre for Applied Molecular Biology (CAMB) 7

Mr. Hamid Bashir Mr. M. Adnan Shan Mr. M. Akram

Research Officer Research Officer Research Officer
M.Phil (PU) M.Phil (PU) M.Sc

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Molecular Biology & Proteomics Forensic DNA Typing & Asthma Genetics & DNA Core Facility
Population Genetics

Mr. M. Shahzad Ms. Sadia Manzoor Mr. M. Usman Ghani

Research Officer Research Officer Research Officer
M.Phil (PU) M.Phil M.Phil

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Forensic DNA Typing & Molecular Diagnostics Asthma Genetics & DNA Core Facility
Population Genetics

Ms. Ghulam Zahra Ms. Saima Younas Ms. Farhana Ehsan

Research Officer Research Officer Asst. Research Officer
M.Phil M.Phil (PU) M.Phil

Specialization/Study Area Specialization/Study Area Specialization/Study Area
Plant Molecular & Biotechnology Molecular Diagnostics Molecular Diagnostics

Centre for Applied Molecular Biology (CAMB) 8

An Overview

Establishment of CAMB

In April 1987, the Federal Ministry of Science & Technology (MoST) approved the establishment of
Centre for Applied Molecular Biology (CAMB), located back to back with the laboratory blocks of
National Centre of Excellence in Molecular Biology. In March 2015, Prime Minister of Pakistan has
approved the transfer of CAMB to University of the Punjab and MoST handed over the
administrative control of CAMB to University of the Punjab, Lahore on June 30, 2015.

Facilities at CAMB

The twin laboratories Complex is spread over 60 acres of land, the covered area include
laboratory blocks, teaching blocks, hostels, conference rooms, lecture rooms, library, computer
section, support facility unit (for washing, autoclaving, media preparation etc.), an animal
house, an insectary, six plant growth rooms, storage place for research materials, directors
offices, administration and accounts sections etc. The CAMB's laboratory block includes Forensic
DNA Typing, Molecular Diagnostics of Infectious Diseases, Molecular Genetics, Human Genetic
Diseases, Proteomics, Molecular Virology, DNA Core Facility, Plant Molecular Biology and Cancer
Genomics & Therapectutics.

Centre for Applied Molecular Biology (CAMB) 9

Activities at CAMB

a The Centre is highly engaged to carry out the goal oriented research in the field of Molecular
Biology since its inception. CAMB, as a renowned scientific research entity encourages the
osmosis of research from laboratory to different sectors of the society. It strives to provide a
suitable environment and encourages researchers to work on collaborative research projects to
advance knowledge, to propose solutions to some of the major issues of today and to develop new
technologies for the future. A cadre of highly skilled scientists and students are working on
different imperative issues in health and agriculture.

b In academics, CAMB offers B.S, M. Phil and Ph.D degree programs in Molecular Biology and
Forensic Science. The contents of these programs have been designed keeping in view the student
background, the current developments in the field and our specific requirements. The curriculum
contents will absolutely help in producing next generation pioneers and well-trained
professionals who will be instrumental in establishing and developing this crucial science and
technology in Pakistan.

c In addition to the goal oriented research and academic programs, CAMB is also providing reliable,
accurate, rapid and more economical analytical services in the following domains:

Forensic DNA analysis services are being provided to the law enforcement agencies & Courts in
rape, murder, sodomy, dead body identification, bomb blast, robbery / theft and paternity
cases.

PCR based diagnostics services for most prevalent infectious diseases are being provided to the
general public at high economical rates

DNA sequencing and genotyping services are being provided to the researchers of different
R&D organizations and Universities throughout the country.

Centre for Applied Molecular Biology (CAMB) 10

Objectives of CAMB

The Centre is functioning with following main objectives:

To undertake goal oriented research on specific

1 problems related to the economic needs of the country
for agriculture, health and industry.

Teaching and training to create a cadre of manpower

2 specifically trained in applied molecular biology,
recombinant DNA technology and forensic science.

Production of critical laboratory materials needed on

3 day-to-day basis in Molecular Biology research.

Conduct symposia, seminar in the frontiers of Molecular

4 Biological research related to national and regional
problems.

Centre for Applied Molecular Biology (CAMB) 11

Research Activities at CAMB

Forensic DNA Typing 12
Molecular Diagnostics

Molecular Virology
Genetic Diseases & Genomics Group

DNA Core Facility
Plant Molecular Biology

Proteomics
Molecular Genetics
Cancer Genomics & Therapeutics

Centre for Applied Molecular Biology (CAMB)

Forensic DNA Typing

Incorporation of DNA typing into crime investigation and parentage testing has proved to be of
tremendous importance in forensics. Analysis of human DNA has shown that every individual has
unique DNA except the identical twins. Obviously, therefore, the DNA profile provides an
excellent means to identify a criminal from a group of suspects. However, the utility of this
modern DNA technology critically depends on the methods of the procurement of biological clues
from the crime scene, from the body of victim and offender, its packaging and transport to the
DNA laboratory.

In order to cope with changing needs of crime investigation, Centre for Applied Molecular Biology
(CAMB), established the first state of the art DNA analysis laboratory of Pakistan in 2002. The
laboratory is well equipped and has a cadre of specifically trained forensic scientists (trained
from USA). The laboratory is providing services for DNA analysis in criminal & paternity cases to
the Law enforcement agencies & Courts. Forensic DNA analysis services had been provided in
more than 3500 cases including rape, murder, sodomy, dead body identification, bomb blasts,
robbery, and paternity cases.

Centre for Applied Molecular Biology (CAMB) 13

To ensure that the techniques of DNA Typing are most usefully applied, CAMB has made
tremendous efforts to train crime investigating officers, and medico-legal doctors to properly
procure the biological evidence material for DNA testing. Many officers and officials from police,
military police, I.S.I and I.B had been trained in procuring biological evidence from the
crimescene. The laboratory has also conducted training workshops for medico-legal doctors and
two introductory mini workshops on “DNA for Justice” have also been conducted for Judiciary and
lawyers.

Forensic DNA typing group is actively engaged in research and development. The group is involved
in the study of autosomal STRs, mini STRs, X-STRs, Y -STRs, mitochondrial DNA, and SNPs. Several
M. Phil and Ph.D students have completed their research work on these STRs and SNPs studies.
Research work of this group has been published in peer reviewed impact factor journals of
national and international repute.

Moreover, Forensic DNA laboratory group has also taken an initiative to work on Animal DNA typing
and has successfully obtained the institutional membership of International Society of Animal
Genetics (ISAG) in 2012. Animal meat detection through advanced molecular methods and
establishment of in-house STR multiplex system(s) for the parentage verification of horses; are
the two major upcoming tasks for the laboratory in R&D.

Centre for Applied Molecular Biology (CAMB) 14

Molecular Diagnostics

Hepatitis is an inflammation of the liver characterized by the presence of inflammatory cells in
the tissue of the organ. The condition can be self-limiting (healing on its own) or can progress to
fibrosis (scarring) and cirrhosis. Hepatitis may occur with limited or no symptoms, but often leads
to jaundice, anorexia (poor appetite) and malaise. Hepatitis is acute when it lasts less than six
months and chronic when it persists longer. There are five viruses that commonly infect the liver,
named using letters of the alphabet—A to E.

Molecular Diagnostic Laboratory of CAMB was establish in 2001 with the state of art laboratory
facilities to provide prompt, accurate, reliable and economical diagnostic services to the general
public for the most prevalent infectious diseases. The mission of this laboratory is to strive to
provide quality diagnostic Services with reliability and authenticity at affordable price.
Presently, PCR-Based Molecular Diagnosis tests including HCV-Qualitative, HCV-Quantitative,
HCV- Genotyping, HBV-Qualitative, HBV-Quantitative are being offered. The researchers at MDL
are also involved in HCV genotyping through Real-time PCR and development of different
diagnostics methods/protocols for infectious diseases like Dengue, HBV, HCV, Zika etc. Moreover,
research is underway to find out correlation between various HCV genotypes with the viral loads
in patients infected with HCV.

Centre for Applied Molecular Biology (CAMB) 15

Molecular Virology

Viral diseases continue to pose a serious threat to human health and are a major challenge to
public health and prosperity across the globe. The traditional focus of our group has been wide
spectrum of viruses but currently our efforts are concentrated principally on Hepatitis B,
Hepatitis C and dengue, being the three major and most devastating diseases in the region. In
regard to studies on hepatitis, efforts have focused on the diagnosis of all types of hepatitis
viruses, sequence variability study in the genomes of hepatitis B, C and G. Passionate researchers
of molecular virology group are committed to develop a deeper insight into virus-host
interactions, immune response to virus infection, virus pathogenesis, viral epidemiology, gene
expression studies, anti-viral therapeutics and development of diagnostic assays for the
detection of different viral infections. For the first time we have developed in-house diagnostic
assays for detection of HCV infection and currently our group are working to develop in-house
diagnostic assays for the detection of Dengue virus, Human papillomavirus (HPV) and Herpes
simplex virus (HSV). Moreover, we are studying the harmacokinetics of interferon-free regimens
as well as their response in general population of Pakistan because the recent development of
direct acting antiviral (DAA) drugs has revolutionized the area of HCV therapeutics. We have
recently reported the high relapse rate of HCV in DAA treated patients that have not been
reported previously and now we are trying to track the underlying cause of this treatment failure
with DAA. The contribution of Molecular Virology group has been recognized at home and abroad
and research work of this Group has been published many peer reviewed research papers in
International Scientific Journals.

Centre for Applied Molecular Biology (CAMB) 16

Genetic Diseases & Genomics Group

The group is involved in the studies to reveal genetic causes of different hereditary diseases.
Genetic disorders may or may not be heritable. In non-heritable genetic disorders, defects may
be caused by new mutations or changes to the DNA. The defects may be heritable due to germ line
mutations. DNA analysis of samples from the individuals will determine the nature and cause of
the genetic disease. This group is well equipped with the state of the art instrumentation to
perform genetic and genomic analyses of diseases.

Asthma Genetic
Currently Asthma is the focus of this research group. Asthma is a syndromic disease which may be
influenced by environmental factors. It is one of the most common chronic respiratory diseases,
affecting more than 300 million children and adults worldwide. There is 1 death due to asthmatic
complications out of total 250 deaths worldwide. Several environmental factors have been
supposed to be involved in the development of the disease. Although reports suggest that dust
mite allergy is strongly associated with asthma, however, only a small subset of subjects with dust
mite allergy develops asthma. These data support the idea of other (genetic) factors also involved
in the development of asthma. Association of over 100 candidate genes with asthma has
previously been reported.

Centre for Applied Molecular Biology (CAMB) 17

It is one of the less studied diseases in Pakistan. Recently, this group investigated some
chromosomal regions and identified some variants strongly associated with asthma in Pakistani
population. Results have been published in good impact factor International Scientific Journals.

Whole Genome Analysis (WGA) with large cohort size is in the plans to identify the specific genetic
determinants of asthma in different ethnic groups of Pakistani population. This may help in early
diagnosis and true understanding of asthma, better and timely treatment plans to encounter the
human health complications due to this disease.

Centre for Applied Molecular Biology (CAMB) 18

DNA Core Facility

DNA Core Facility is the largest and well equipped laboratory of Pakistan which commercially
provides facility of DNA Sequencing and Genotyping to researchers in the field of Molecular
Biology and Biotechnology. DNA Core Facility, the pride of Centre initiated automated DNA
Sequencing in 1999 on a single capillary DNA Sequencer. Now laboratory is equipped with five DNA
analyzers and one DNA synthesizer from world leading DNA sequencer manufacture company with
a total output of 112 DNA samples analyzed at time.

The main objective of the DNA CORE Facility is to conduct basic research in molecular biology and
to provide high quality DNA analysis services to the researchers in the centre as well as outside the
centre. DNA Core have analysed more than 1.0 Million DNA samples and synthesized 0.5 Million
nucleotides of DNA primers for researchers of almost all the national academic and R&D
organizations. DNA Core Facility has professionally trained many researchers on DNA sequencing,
genotyping and DNA synthesis. This facility has also contributed major part in the research
undertaken by 250 M.Phil. and almost 100 Ph.Ds produced during the last 15 years from
CEMB/CAMB. DNA Core Facility is also involved in research work on the genetics of Asthma in
Pakistani population and has identified some genomic variants associated with the disease. DNA
core facility has also produced a new tri-branched PEGI interferon (HCV drug).

Centre for Applied Molecular Biology (CAMB) 19

Plant Molecular Biology

Plant Molecular Biology Group is the study of the molecular basis of plant life. Plant molecular
biology specially concerned with the process by which the information encoded in the genome of
the experimental plant is demonstrated as structures, processes and behaviors. The plant
biotechnology and molecular biology lab, CAMB University of the Punjab, is involved with R&D
activities ranging from lower plants to flowering plants.

The Plant Molecular Biology Group researchers work on different molecular aspects of Plants.
researchers in Plant Molecular Biology group have an excellent grasp on different field molecular
biology, like Gene cloning, expression of genes in hosts like bacteria, yeast and plants, transgenic
plants, recombinant protein and antigen production for antibody production and enzyme
production from natural and recombinant sources. The group already involved in resistant
sugarcane against mosaic virus (SCMV), bio fertilizers and DNA barcoding of microbes, algae, fungi
and medicinal flowering plants. CAMB Plant Molecular Biology research group happily offers their
services and research facilities to the researchers, universities graduates and industries related
to herbal medicine.

Centre for Applied Molecular Biology (CAMB) 20

Proteomics

Proteins are vital part of living organisms with many functions. Proteomics is a comprehensive
study of the structure and analysis of a specific protein set/s, including information on protein
abundances, their variations and modifications, along with their interacting partners and
networks, in order to understand cellular processes produced by an organism or a cellular system.
At CAMB, the group is working on

i) Enzymes, having industrial (food, textile, pharmaceutical, laundry, paper, etc.) and as well as
research importance. As microbes provide a potential replacement in the absence or in
insufficiency of human enzymes, so they can be easily produced in large quantities in a short
period of time through genetic manipulation/s, covers the part of the main focus of
proteomics/genetic engineering in molecular biology.

ii) Recombinant Proteins/Hormones/Growth Factor/s, which are usually secreted by the cells and
have a specific effect on the interactions and communications between the cells of the immune
system, is also in the process to cover another part of proteomics.

iii) Therapeutic plant peptides/proteins having antibacterial, antiviral, antifungal and
anticancer potential, serve to complement structural barrier against the infection/s, which still
remains uncharted, is an important part of proteomics.

Centre for Applied Molecular Biology (CAMB) 21

So, the Proteomics Group is mainly focusing on screening, isolation, purification,
characterization, bioactive studies and modification/s for their improvement and therapeutics,
respectively, to achieve the above addressed research interests. The group has a wonderful
command and expertise in Micro/Molecular/Cell Biology, by using cloning, vector construction,
expression studies, mutation, purification, Iso electric point (pI) determinations for a protein, In
vitro cell culturing, immuno blotting and simple sequence repeats (SSR) studies/techniques, in
microbes, cells and plants.

SERVICES
Provide testing facility for microbes / fungus, through microscopy, biochemical tests and PCR.

Centre for Applied Molecular Biology (CAMB) 22

Molecular Genetics

DNA serves as a molecular passport that tells us the story of early human's intercontinental
movements. In addition to nuclear genome humans have a second genome the mitochondrial DNA
(mtDNA) that follows a maternal mode of inheritance. Random mutations add up to form familial
signature after every few generations. So a comparison of two samples of mtDNA with respect to
mutations reveals ancestral origin and degree of relationship. The advantage of using mtDNA is
due to presence of 1000–2000 mitochondria per human cells as well as five to ten copies of
mtDNA per mitochondrion that increases the possibility of obtaining some copies of mtDNA for
analysis from such samples. In this regard, human molecular genetics group at CAMB has started a
recent research group focusing on the role of mtDNA in human diseases and searching for ancestry
markers.

Recently, the group has sequenced mitochondrial DNA control region in Makrani and Kalashi
population from Pakistan. These efforts have succeeded the group to provide the haplo-grouping
in Makrani and least admixed population like Kalashi from Pakistan. This data will be a valuable
contribution to build a Pakistani database of entire mtDNA control-region. Future efforts in the
group will be to focus on the mitochondrial diseases (like cardiac diseases) in humans. For this,
the molecular genetics group is collecting samples from other ethnic groups of Pakistan. These
efforts would help to understand the genetic basis and molecular mechanisms of the
mitochondrial diseases.

Centre for Applied Molecular Biology (CAMB) 23

Cancer Genomics & Therapeutics

Cancer is one of the most noxious diseases of the 21st century. Human and animals are suffering
from different types of cancer. Animals, particularly the pet animals have more frequent cancer
as compared to human and they can be used as animal models to study human cancers. Among
the most often occurring types in humans are cancers of the lung, breast, prostate, ovary and
colon. Exogenous factors (Tumor viruses, chemical carcinogens, natural chemicals, herbicides,
etc.) and endogenous factors (inherited genetic defects, Immune system, hormonal factors) are
risk factors. Although a lot of work has been done to find the genes involved in different cancers,
there is still a need to find out the target genes and their mutations involved in any particular
cancer of the specific population.

In this regards “Cancer Genomics and Therpeutics Group” at CAMB is working to find out the
genetic causes of this deadly disease. The major objective of this research group is to identify the
marker genes responsible for cancer pathogenesis and progression using high throughput
methodologies. These novel markers will be used for diagnosis of cancer types and this will be
helpful for early treatment of cancer. Among recent projects, this group is working on animal
cancers in collaboration with University of Cambridge, UK and also working to understand the the
highest numbers of breast cancer patients (women) and unfortunately 60-70% of breastcancer
genetics of breast cancer patients (human) in Pakistan. In South Asia, Pakistan has one of

Centre for Applied Molecular Biology (CAMB) 24

cancer patients are in advanced stage III and IV. This project is funded by the startup research
grant (Higher Education Commission (HEC), Pakistan). In future this group is planning to work on
the drugs/therapeutics which may be affective for treatment of any particular cancer type in
Pakistan and making collaboration with different Universities of Pakistan.

Centre for Applied Molecular Biology (CAMB) 25

Academic Programs

A M. Phil in Molecular Biology and
Forensic Sciences.

Ph.D in Molecular Biology and B
Forensic Sciences.

Centre for Applied Molecular Biology (CAMB) 26

M. Phil Program

A M. Phil in Molecular Biology and
Forensic Sciences.

Eligibility M.Sc/BS (4years) in Molecular Biology, Forensic sciences,
Microbiology, Biological Sciences, Agricultural Sciences,
Duration Biotechnology, Biochemistry, Pharm D., Bioinformatics,
No. of Seats Zoology, Botany, Chemistry, Genetics/Molecular Genetics,
Test Pattern MBBS, BDS, DVM.

2 years

28

GAT based Admission Test (Total Weightage 40%)

Test will include subject based MCQs: 75% & 25% GAT based General Test

Sr. No. Course No. Course of Study Credit Hours

1. MBFS 501 SEMESTER-1 & 2 2
Advance Molecular Biology and
2. MBFS 503 Biotechnology 2
3. MBFS 504 Forensic Process 2+1
4. MBFS 505 Tissue Culture and Techniques 2+1
5. MBFS 506 Crime Scene Management
6. MBFS 510 Bioethics and Dual use of Education 2
7. MBFS 512 Molecular Virology and Bacteriology 2+1
8. MBFS 516 Plant Molecular Biology
9. MBFS 508 Immunology 2
10. MBFS 513 Biological Safety and Risk Management 2
11. MBFS 514 Forensic DNA Typing 2
12. MBFS 517 Molecular Biology Techniques 3+1
13. MBFS 518 Law And Forensic Science 2+1
Paper Writing Skills 3
14. SEMESTER-3 & 4 1
Research and Thesis
8

Centre for Applied Molecular Biology (CAMB) 27

Ph.d Program

Ph.D in Molecular Biology and B
Forensic Sciences.

Eligibility MS/M.Phil in Molecular Biology, Forensic Sciences,
Microbiology, Biological Sciences, Agricultural Sciences,
Duration Biotechnology, Biochemistry, Pharm D., Bioinformatics,
No. of Seats Z o o l o g y, B o t a n y, C h e m i s t r y, G e n e t i c s / M o l e c u l a r
Test Pattern Genetics, MBBS, BDS, DVM.

3-5 years

12

GAT based Admission Test (Total Weightage 40%)

Test will include subject based MCQs: 75% & 25% GAT based General Test

Sr. No. Course No. Course of Study Credit Hours

1. MBFS 701 SEMESTER-1 & 2 3+1
2. MBFS 702 Advances in Plant Molecular Biology 3+1
Advances in Practical Approaches to
3. MBFS 703 Nucleic Acid Sequencing 3+1
Advances & Practical Approaches to
4. MBFS 704 Real Time / Quantitative PCR 3+1
Recent Advances in Forensic
5. MBFS 705 Molecular Biology 3+1
6. MBFS 706 Ethics in Biological Sciences 4
7. MBFS 707 Advances in Bio-Safety
Practical Approaches in Genetic 3+1
8. MBFS 708 Manipulation
Advances in Genetically Modified 3+1
9. MBFS 709 Plants and Pests
10. MBFS 710 Application of Mammalian Cell Culture 3+1
Application of Protein Purification 2
11. MBFS 711 Methodology
Edible Plant Vaccines Production 2
12. SEMESTER-3 onwards
Research Thesis

Centre for Applied Molecular Biology (CAMB) 28

Extracurricular activities at CAMB

Sports

We strongly believe that physical development of students is a pre-
requisite for their mental development. There are good
arrangements of Badminton, Cricket, Table Tennis, Foot ball at the
institute. Sports gala will be organized every year by students and
faculty members. The students will also get the opportunity to
participate in various university level sports tournaments.

Study Tours

Exposure to practical working environment is essential for
broadening the vision of students. Study tours are arranged for the
students as a well-planned activity. These include short as well as
long trips.

Character Building Society

Character is actually comprised of traits and qualities distinguishing
the one person's nature from another. When we talk about character,
actually we use umbrella term which describe the teaching of a child
in a manner that will help them develop variously as moral, civic,
good, mannered, behaved, non-bullying, healthy, critical,
successful, traditional, compliant and socially acceptable beings.

Journal Club

Journal club is a forum which provides students a perfect platform
to share their ideas, projects, novelties and introducing concepts to
stimulate insight, guidance and interest in research. CAMB's Journal
club is also working to launch an international journal which will
accept the research papers, reviews and other short reports
throughout the world. An establishment of scientific society of
CAMBIANs is also going to launch soon. CAMB's faculty members and
students are working hard for the progress of their department.

Centre for Applied Molecular Biology (CAMB) 29

Symposia / Exhibitions / Workshop

¤ CAMB participated in series of Symposia, Exhibitions, and Summits & Workshops and won
different prizes.

¤ Organized seminars on “New Technological tools and applications in biological research” &
“advancements in Molecular Biology” at CAMB.

¤ CAMB scientist addressed the seminar on Forensic DNA Typing and role of judiciary at Liaquat
University of medical health sciences (LUMHS) Jamshoro, Sindh-Pakistan.

¤ CAMB participated in first nation conference on “Emerging Trends in Bioinformatics and
Biosciences” held at Hazara University, Mansehra.

Centre for Applied Molecular Biology (CAMB) 30

Students Affairs Committees

Scholarship Committee

Scholarship Committee aims at reviewing and a warding Scholarships and waiver of fees for
qualifying individuals to provide an opportunity for talented students who are financially
unstable and are incapable of meeting higher education costs.

Student Advisory Committee

Student advisory committee facilitate students through all means, provide them support and
create opportunities to flourish the talent and skills and enhance resources and services to assist
them in working out their plans and goals.

Discipline / Management Committee

The objective of discipline committee is to create disciplined atmosphere by guiding students
about development of intrinsic controls to reduce displays of misbehavior. This committee also
determines if there has been a breach of the Code of Ethical Principles and Rules of Conduct to
recommend the appropriate disposition of the matter thus, imparting ethics and good conduct to
students.

Centre for Applied Molecular Biology (CAMB) 31

Co-Curricular Activities

Centre for Applied Molecular Biology (CAMB) 32

Admission Regulations (D-1871/Acad. Dated: 02-05-2016)

PH.D./ M. PHIL RULES

Regulations relating to Admission, Registration and Examination for MS./M. Phil.,
and Ph.D. Degrees

1. ADVERTISEMENT:
i. Before the advertisement, the faculty of every Department/ Institute/
Centre / College / School should ascertain the number of seats/ programes/
facilities available.
ii. The MS / M.Phil. and Ph.D. programs shall be advertised in the beginning of
each academic session. The advertisement shall normally appear in the
newspapers during June / July as per academic calendar.

2. ELIGIBILITY:

MS/M.Phil,
M.A./ M.Sc./ LL.B./ BS(Hons.) 4 years/ B.Sc.(Hons.) 4 years, B.Sc. (Engineering)/ B.
Pharmacy/ Pharm D/ MBBS/ BDS degree or its equivalent in the relevant subject from
a recognized University (16 years of education; 130 credit hours) as per HEC rules.

Ph.D MS / M.Phil. / LL.M./M.Sc. (Engg/Hons) / MD / MS / MDS or equivalent
i. degree with Ist. Div / CGPA = 3.0 / OPM 70% after acquisition of 18 years
education.
ii. Specific eligibility criteria of different departments will be provided by
Department / Institute / College / Centre before the admission.

3. PROCEDURE FOR APPLICATION, ADMISSION AND REGISTRATION:
i. An applicant seeking admission to M.S./M.Phil., and Ph.D. programes shall
apply on a prescribed form within the due date given in the advertisement
for admission.
ii. The application shall be submitted to the administrative office of the
respective Department/ Institute/Centre/College/School in which the
student wishes to pursue his/her studies.
iii. The Departmental Doctoral Programe Committee (DPC - Chairman, all
Professors & Associate Professors, one senior most Assistant

Centre for Applied Molecular Biology (CAMB) 33

Admission Regulations

Professor/Lecturer, holding Ph.D. degree) shall scrutinize the applications

received for eligibility. In departments where there i s no

Professor/Associate Professor, Doctoral Programe Committee (DPC) will be

constituted by the Vice-Chancellor on the recommendations of the Dean of

the Faculty/Chairperson DPCC. In such cases for the evaluation of synopsis,

2-3 experts will be co-opted.

iv. An applicant shall be judged on the basis of the following criteria for

admission:

a. Academic qualifications*- 40 Marks

b. Publications in HEC approved journals - (1 Mark per publication)-05

Marks

c. Professional experience in relevant field - 05 Marks

(One Mark for each year for job in the relevant field / as per

Departmental preference).

d. Departmental written/entry test (comprehension of the subject, General

aptitude for research) 40 Marks

e. Interview - 10 Marks

v. Out of 40 marks reserved for academic qualifications, 40 marks for the

departmental admission test and 10 for the interview, minimum 50% are the

qualifying marks in each of the category. However, for PhD passing marks in

entry test are 70% as per HEC Policy approved by ASRB, in its meeting held

on 20.01.2016. That means a candidate must obtain at least 20 marks in the

academic qualification (19.1 will be rounded to 20), 20 marks in MPhil

entrance test, 28 marks for PhD entrance test and 5 marks in the interview

separately to be eligible for the admission.

vi. Only those candidates who qualify the departmental written/entry test

[designed by the respective department] will be called for an interview.

The Doctoral Program Committee shall recommend to the Dean of Faculty concerned

/Chairperson DPCC for approval of the names of applicants, who are found eligible.

The selected candidates shall pay their dues within stipulated time, failing which

their admission shall be liable to be cancelled. The DPC/Faculty Council (as the case

Centre for Applied Molecular Biology (CAMB) 34

Admission Regulations

may be) will approve the title/synopsis (Guidelines for the preparation of synopsis are
given in Annex-III). Final approval will be given by the Advanced Studies and Research
Board (ASRB).

* Break up of 40 marks for academic qualifications:

M.S / M.Phil. %age marks 50% 55% 60% 70% ≥80%
4 5 7.5 8.5 10
Course/ Degree 45% 4 5 7.5 8.5 10
Marks 2 4 5 7.5 8.5 10
Matric Marks 2 5
F.A / F.Sc. Marks 2 4 7.5 8.5 10
B.A./ B.Sc 3.0
M.A / MSc Marks 2 2.7 7.5
(Annual System) 6
CGPA 2.5 15 3.4 ≥3.8
M.A / M.Sc. Marks 5 8.5 10
(Semester System)
Marks 10 12 17 20
BS (Hons.) 4 years /
B.Sc (Hons) 4 years
(16 years edu.)

Ph.D %age marks 50% 55% 60% 70% ≥80%
4 5 67 8
Course/ Degree 45% 4 5 67 8
Marks 2 4 5 67 8
Matric Marks 2 5 67 8
F.A / F.Sc. Marks 2
B.A./ B.Sc. 3.0 3.4 ≥3.8
M.A / MSc Marks 2 4 12 14 16
(Annual System) 6 78
BS Hons. 4 years / CGPA 2.5 2.7
B.Sc. Hons Marks 8 10 3.3 3.6 ≥3.8
(16 years Edu.) 6 78
M.A./ M.Sc. Marks 4 5
(Semester System)
3.0 CGPA / 1st
M.S / M. Phil / Marks Div.
LLM (18 years Edu.)
5

vii. Foreign Students:
Efforts be made to attract foreign students around the globe. The University

should advertise both on World-Wide Web and through Embassies, posters etc. The

admission of foreign students should be processed as under:

Centre for Applied Molecular Biology (CAMB) 35

Admission Regulations

a) A foreign candidate should apply through his/her Home Country's
Embassy and Pakistan Mission Abroad office (in case of overseas Pakistani) alongwith
TOEFL or IELTS or equivalent with 5.5 score/band, all educational documents and
passport etc. However, PU ex -graduates will be exempted from TOEFL or IELTS or
equivalent.

b) The concerned department/institute will send a provisional admission
letter to the Registrar and copy to Chairperson DPCC along with HEC proforma of
foreign students for clearance of the vetting agencies before joining the program.

c) The candidate should also pass the entrance test of the concerned
institution/admission on arrival or submit GRE International with admission form.

d) After fulfilling all above requirements, the candidate will be allowed to
attend classes with a valid visa.

Note: Qualification from Institutions other than the University of the Punjab
will be equalized by the Equivalence Committee of the University of the Punjab.
4. INCENTIVE /FACILITIES FOR NON-PHD UNIVERSITY TEACHERS / OFFICERS:

i. For facilitating University's own faculty, workload of a teacher
(appointed on regular basis) enrolled in Ph.D program at PU will be reduced to
half. Provided that those teachers will not take any class in the evening
program on payment basis in PU or other than PU. The period of privileges
regarding PhD studies will be maximum upto two years (relaxation in work load
or study leave).

ii. A University Teacher/Officer enrolled as a Ph.D. candidate in the
University of the Punjab should receive an "honorarium" of Rs. 5000/- P.M. (to
be revised from time to time) subject to his/her satisfactory performance as
determined by the DPC and DPCC.

iii. A University Teacher/Officer after completion and award of PhD
degree be given Rs. 50,000/- as honorarium.

iv. The registration and tuition fee may be waived for University
Teacher/Officer.

Centre for Applied Molecular Biology (CAMB) 36

Admission Regulations

5. INCENTIVES PROVIDED TO M.PHIL / PHD SUPERVISOR:
i. A University teacher holding a Ph.D. degree and supervising Ph.D.
research work will be paid honorarium of Rs. 100,000/- per student at
successful completion of Ph.D degree. In case of more than one
supervisor this amount will equally be divided among all supervisors.
ii. Since Ph.D. research Guidance by Lecturer and Assistant Professor
tantamount to additional workload, it should be compensated by
adjusting in 9 Credit Hour workload (one Credit Hour per student with
maximum of three Credit Hours).

iii. M.Phil. supervisor will be awarded an honorarium of Rs. 7500/- w.e.f.
14-11-2015.

iv. Retired, active and academically sound University Professors in all
faculties may be co-opted for course work and as Supervisor for PhD
program.

6. PROGRAMME OF STUDIES:
i. M.S/M.Phil program will be for four semesters. In first two semesters, 24
credit hours course work and in 3 rd and 4 th semesters 6 credit hours
research work / internship / project (as the case may be) will be carried
out.
ii. The research work submitted for M.Phil. will not be part of PhD thesis.

iii. The minimum and maximum period for completion of M.Phil will be 1.5
to 4 years and in Ph.D. 3 to 8 years as per HEC policy. The period shall
be counted from the date of commencement of classes.

iv. Extension for a specific period in cases of M.Phil after 2 years and in
Ph.D. after 5 years will be granted on full justification, a progress report
by the Supervisor and recommendation by the DDPC only to those
students who maintain their student status and are not absconders.
Finally the extension if fully justified should be 5+2 and in case of
extremely justified cases 5+2+1 and this will end Re -registration practice
of PU.

Centre for Applied Molecular Biology (CAMB) 37

Admission Regulations

v. It shall be mandatory for Supervisor/s to submit detailed progress report
annually of Ph.D. students to the DPCC office/Registrar office.

vi. Candidates from Scientific Research Organizations, after successful
completion of course work, may carry out their experimental work in
laboratories of their parent departments on the recommendations of the
supervisor, approved by the DPC/ Faculty Council, at the time of
approval of the synopsis.

vii. A Ph.D. student shall be required to pass a comprehensive examination
(written) after completing course work, and before undertaking the
synopsis/research work.

viii. A Ph.D. student shall be required to submit synopsis within six month of
completing course work and before commencing the research work.

ix. A Ph.D. student will give a semina r relevant to his/her field of research
at his/her convenience within a year of submission of synopsis to the
department for the approval of various statutory bodies such as
DPCC/Advanced Studies & Research Board.

7. CANCELLATION OF ADMISSION / REGISTRATION:

M.Phil:
M.Phil. admission shall be cancelled by the department on the

recommendations of the DPC and notified by the concerned
Chairman/Director/Principal, if the scholar: -

a. earns adverse progress reports from his supervisor.
b. fails to contact his supervisor or leaves the program
c. does not complete the course work
d. does not meet 75% attendance criteria in theory and Practical separately
e. is found guilty of misconduct.
The aggrieved scholar may file an appeal against cancellation of M.Phil.
admission to the concerned Dean within a period of 15 days. The Dean will give
him/her an opportunity to be heard in person and the case will be sent with the
Comments of Dean through DPCC to the Vice-Chancellor for final Approval/decision.
The final decision will be notified by the Registrar office.

Centre for Applied Molecular Biology (CAMB) 38

Admission Regulations

PhD:
PhD admission shall be cancelled by the Registrar on the recommendations of

the Chairperson/DPC, concerned Dean of the faculty followed by the approval of the
Vice-Chancellor, if the scholar: -

a. earns two consecutive adverse progress reports from his supervisor.
b. fails to contact his supervisor or leaves the program
c. does not complete the course work
d. does not qualify the Comprehensive Examination even in the second

attempt
e. does not meet 75% attendance criteria in theory and Practical separately
f. is found guilty of misconduct.
The aggrieved scholar may file an appeal against cancellation of Ph.D.
registration to the Advanced Studies and Research Board within a period of 30 days.
The Advanced Studies and Research Board will give him an opportunity to be heard in
person. However, the decision of the Advanced Studies and Research Board will be
final and will not be questioned in any court of law.

8. EXAMINATION (Course Work):
Course contents, if revised, shall be approved by the DPC of each department

and by the other relevant bodies. The teacher concerned will be responsible for
determining the details of the course

i. There will be two - three semesters in each year, winter, spring and summer
(optional), of 16-18 weeks each (winter and spring) with a minimum of 14-16
weeks for the course work, summer semester will be of 8-10 weeks. The DPCC
shall regulate the commencement of the semesters. The first semester shall
normally start on second Monday of September each year and terminate by first
week of January. The second semester shall start on the 4th Monday of the
January and its examinations shall be held in 3rd week of May. Summer
semester shall commence in third week of June and end by fourth week of
August. For MS / M.Phil two semesters of course work and one-two semesters
of research / internship (6 credit hours) will be mandatory which normally has
to be completed within two years.

Centre for Applied Molecular Biology (CAMB) 39

Admission Regulations

ii. For Ph.D., from the second Monday of September, the students who have
maintained CGPA = 3.0 in M.S / M.Phil shall undertake additional course work/
Research techniques training (in case of Experimental Sciences) equivalent to
18 credit hours. In case of commencement of research/ internship/ project in
summer semester Ph.D. course work shall start in Spring semester.

iii. There shall be a Comprehensive Examination within one month after
completing the Ph.D. course work

iv. The student will write and submit synopsis for Ph.D. research work within six
months of completing the Ph.D. course work.

v. There shall be two examinations for each course during each semester. These
examinations shall be termed as mid semester (mid-term) and the final term.
The mid semester examination shall be held during 8th week of each semester.
The final examination is to be held at the end of the semester. (Marks: Mid
term 35%, home assignments 25%, Final examination 40%). In addition to these
examinations, the teacher shall give home Assignments, term papers, quizzes
etc. The result of a course will be submitted after one week of examination
and result will be notified after two week of completion of examination. The
DPC shall be responsible for supervising the teaching, examination and their
related matters. The DPC may also review the evaluation of any student/class
if it deems appropriate within one week of submission of result. The result of
semesters as well as comprehensive examinations shall be communicated to
DPCC within two weeks of announcement of result

MS / M.Phil:
A) All courses given in the first year (1st & 2nd semesters) will be designated by
500.
B) All courses given in the second year (3rd & 4th semesters) will be designated by
600.

All courses will be preceded by 2-4 alphabets to be decided by the
Departments / Centres / Institutes / Colleges / School indicating the title of the
degree/ area of specialization.
Courses will be divided into following categories:

Centre for Applied Molecular Biology (CAMB) 40

Admission Regulations

a) Compulsory
b) Core / Minor
c) Major
d) Elective
Each Departments / Centres / Institutes / Colleges / School shall decide its
own compulsory, core/ minor, major and el ective subjects. The courses offered by a
Departments / Centres / Institutes / Colleges / School shall be announced with a
short description of each course along with time, day, class room, name of the
teacher, semester and credit hours.
C) A regular student will normally be required to take workload (for course work)
of six to twelve credit hours in each semester.
D) At the end of the first semester a student must obtain a minimum Grade Point
average (GPA) of 2.50 to be promoted to the second semester. I n order to qualify a
course GP 2.30 required.
E) In case a student is able to obtain GPA of 2.30 or more but less than 2.50 he /
she will be promoted to the second Semester on probation. The candidate, who fails
to secure 2.30 GPA in the first Semester sh all stand automatically dropped from the
rolls.
F) At the end of the second semester, a student must obtain a minimum
Cumulative Grade Point Average (CGPA) of 2.50 and must also pass at least 50% of the
courses offered by him / her in order to be promoted to the third semester. If any of
the preceding two conditions is not complied with by a student then he / she shall be
removed from the rolls of the Departments / Centres / Institutes / Colleges / School.
G) In the 3rd or 3rd and 4th semesters a student will carry out research work /
internship under the supervision of his / her supervisor and submit research thesis /
report / project by the end of 3rd or 4th semester.
H) In the third semester a student will also be required to repeat those courses of
the first semester in which he/she had failed and maintains CGPA of 2.50 failing
which his / her name will be removed from the Departments / Centres / Institutes /
Colleges / School.

Centre for Applied Molecular Biology (CAMB) 41

Admission Regulations

I) In the fourth semester, a student will be required to repeat those cour ses of
the second semester in which he / she had failed and maintains CGPA of 2.50 failing
which his / her name will be removed from the Departments / Centres / Institutes /
Colleges / School.
J) A student, who completes all the courses and has not been required to repeat
any course(s), obtains CGPA of less than 2.50 but not less than 2.30 at the end of the
4th semester, may be allowed to repeat up to two courses (varying 2 -6 credits) in
which he / she had obtained the lowest grades, in order to improve the CGPA so as to
obtain the minimum of 2.50 failing which he / she shall not be awarded degree and
removed form the rolls of the Departments/ Centres/ Institutes/Colleges/ School.
K) A student who had earned 'F' grade in a course in 1st semester may be allowed
to take one additional course during the 2nd /3rd semester with the permission of the
DPC of the Departments / Centres / Institutes / Colleges / School.
L) A student who had earned 'F' grade in a course in 2 nd semester may be allowed
to take one additional course during the 3 rd /4 th semester with the permission of
the DPC of the Departments / Centres / Institutes / Colleges / School.
M) The teacher shall send a copy of the activity record of the courses on
prescribed Proforma to the DPC, Chairman / Director / Principal at the end of each
semester.
N) After two semesters (24 credit hours) of course work, research work/
internship of six credit hours will be carried out in third and fourth semesters. Title of
the thesis / report/ project will be recommended by DPC / Board of Studies routed
through DPCC for the approval of the Vice-Chancellor. Thesis / report shall be
submitted within six weeks after the termination of fourth semester (as the case may
be). In case of genuine reason on the recommendation of the supervisor, DPC, DPCC
Vice Chancellor can give extension up to six months for the submission of thesis/
report/ project. Evaluation of thesis will be by External Examiner . Board of
Examiners for the examination of thesis shall be appointed by the Vice Chancellor out
of the panel recommended by DPC concerned routed through DPCC. Evaluation
normally be completed within six weeks of submission of the theses.
O) Only those students who scored CGPA = 2.5 will be awarded MS/ M.Phil. Degree

Centre for Applied Molecular Biology (CAMB) 42

Admission Regulations

PhD:

A) Candidate has to complete 18 credit hours course work, qualify comprehensive
examination and carry out research for 2-4 years.
B) All courses given in the Ph.D programe will be designated by 700
C) A regular student will normally be required to take workload of eight to fifteen
credit hours in each semester. Eighteen credit hours course work must be completed
within two semesters
D) At the end of the first semester a student must obtain a minimum Grade Point
Average (GPA) of 3.00 to be promoted to the second s emester. In order to qualify a
course GP 2.70 required.
E) In case a student is able to obtain GPA of 2.80 or more but less than 3.00 he /
she will be promoted to the second Semester on probation. The candidate, who fails
to secure 2.80 GPA in the first Se mester, shall stand automatically dropped from the
rolls.
F) At the end of the second semester, a student must obtain a minimum
Cumulative Grade Point Average (CGPA) of 3.00 and must also pass all the courses
offered by him / her in order to be promoted to the third semester for research. If
any of the preceding two conditions is not complied with by a student, then he / she
shall be removed from the rolls of the Departments / Centres / Institutes / Colleges /
School.
G A student, who completes all the courses and has not been required to repeat
any course(s), obtains CGPA of less than 3.00 but not less than 2.80 at the end of the
2 nd semester, may be allowed to repeat one course (varying 2 -4 credits) in which he
/ she had obtained the lowest grades in the next semester, in order to improve the
CGPA so as to obtain the minimum of 3.00 failing which he / she shall not be awarded
degree (or allowed to continue research work) and removed from the rolls of the
Departments / Centres / Institutes / Colleges / School.
H A student who had earned 'F' grade in a course in first semester may be allowed
to take one additional special course in second semester.

Centre for Applied Molecular Biology (CAMB) 43

Admission Regulations

I The teacher shall send a copy of the activity record of the courses on
prescribed proforma to the DPC, Chairman / Director / Principal at the end of each
semester.
No student will take any course unless he has cleared the pre-requisite for it as
determined by the respective Departments / Centres / Institutes / Colleges /
School.
ix A course may range from one credit hour to four credit hours.
x The minimum number of contact hours for course work will be 14 per Semester
for one credit hour course.
xi One credit hour stands for at least one hour class contact per week per
semester. For practical / laboratory work, 3 hours shall be considered equivalent to
one credit hour.
xii Only those students, who have attended not less than 75% of lectures and
practicals separately in each course, shall be eligible for admission to such
examination.
xiii A teacher shall report the names of the students who are absent from the
lectures/practicals continuously for 14 days (consecutive two weeks) to the
Chairman/ Director/ Principal of the Departments/ Institutes / Colleges / Centres /
School concerned who will forward the names of the student/s to the Dean/DPCC to
enable him/her to strike off the names of such student/s. The Dean/DPCC may for
valid reasons readmit such a student/s on the recommendation of DPC.
xiv The scripts of each examination shall be shown to the students concerned by
the teacher and taken back immediately. The Department concerned shall keep such
record for one year.
xv The teacher shall send the final award list to the Chairman /Director /Principal
of the Departments/ Institutes / Colleges / Centres / School who will forward it to
the DPCC, Controller of Examinations for notification and a copy to the respective
Dean.

9. Grading System
Equivalence in numerical grades, letter grades and grade points will be as follows:

Centre for Applied Molecular Biology (CAMB) 44

Admission Regulations

Percent Marks Leter Grade Grade Points
85 & Above A 4.00
80-84 A- 3.70
75-79 3.30
70-74 B+ 3.00
65-69 B 2.70
61-64 B- 2.30
58-60 C+ 2.00
55-57 C 1.70
C-

50-54 D 1.00
Below 50 F 0.00

i) Maximum possible Grade Point Average is 4.00.
ii) Minimum Cumulative Grade Point Average for obtaining 2 year MS/M.Phil
(course work and comprehensive) is 2.50. In order to qualify in the examination of
semester a student must obtain at least GPA 2.50 and in individual subject not less
than 2.30.
iii) If GPA/ CGPA of a student re mains <2.50 (but >2.30) the student shall be given
one chance (only once) to repeat two subjects (2-6 Credit Hours) in order to improve
CGPA in MS/M.Phil. If GPA /CGPA of a student remain <2.50 he/ she shall be dropped
from studies
iv) Minimum Cumulative Grade Point Average for PhD (course work and
comprehensive) is 3.00. (For detail see E and F of PhD).
v) A fraction of mark in a course is to be counted as '1' mark e.g. 64.1 or 64.9 is to
be shown as 65.
vi) Letter Grade and Grade Point for a course will be calculated as given above.
vii) In order to calculate the GPA, multiply Grade Point with the Credit Hours in
each Course to obtain total grade points, add up to cumulative Grade Points and
divide by the total number of Credit Hours to get the GPA for a Semester.

∑ ( GP x Credit Hours) courses of a semester

GPA = -------------------------------------------------------
Total Credit Hours of a semester

Centre for Applied Molecular Biology (CAMB) 45

Admission Regulations

viii) For calculating CGPA, sum total of GPs in a semester earned in different
courses multiplied by respective credit hour of a course and divided by total numbers
of credit hours.

CGPA = ∑ ( GP x Credit Hours) of all courses in a programme
----------------------------------------------------------------
Total Credit Hours of all courses in that P rogramme

10. RE-SIT EXAMINATION:

The students who cannot appear in examination because of genuine excuse /

reason shall be allowed to appear in re-sit examination within one week after the

examination subject to the payment of special examination fee of Rupees 5000/- for

one course. If the number of courses is more than one then a lump sum of Rs.

10,000/- shall paid as special examination fee to the department.

11. RE-ADMISSION ON MEDICAL / EMERGENCY GROUNDS:
A student who discontinues studies on medical/emergency ground will be

allowed to seek readmission in the same semester next year after paying semester
fees. During the period of discontinuation of studies the hostel, medical and transport
facilities shall be withdrawn which are normally available to regular students. If they
fail to appear next year, the admission should be considered cancelled.

12. WITHDRAWALS / ADDITIONS OF COURSES:
The enrolled students may withdraw / add other courses to their programe

within two weeks after commencement of the semester with the permission of the
supervisor/ head of the Departments/ Institutes / Colleges / Centres / School if such
withdrawals / additions do not affect requirements of minimum / maximum course
workload conditions.

13. SUBMISSION OF RESULTS:
The teachers are required to submit result within one week after the

examination so that result shall be declared by the Examination Committee of the
Departments/ Institutes / Colleges / Centres / School within two weeks after
examination. The result will be declared by the DPC and the copies of the results will

Centre for Applied Molecular Biology (CAMB) 46