Remarkable Inns & Their Drinks

WHaellalotfhWy oEnsdtaebrlsi,shhommenettso the royal ndi2g0ht WoreatltwhyoEasttaablilsohwmecnltasss inn once in
their life, and remember the feeling of
and grand, and those looking to run w1 akinNignovbuitlpeemyooenun fpaorrertsaeonmwdetsodtrrrienackwosg.nbiezedy.ou and
iRnicthoatnhdeexlootcicaelsthaibglihshmroelnltesrasr,e hmaovreeliakehlyigh
tcohoafnfecr eunduosuinalgsesrovictehsearned.drinks. They are H2ere abYroeevueasrraoegmepsr.eoveidxeadmwipthlefrseeocfohmomwonyou
c3an usAehligohwlowrdeaaskltshy:our opinion on honor in
home to royal or elite heroes. Surely nothing is
battle.
Stooomouetlaenxdaismh fpolreFsizozlfenhoozwzle’ysoHuallcoafnWuonsdeers,
Whomeaelttohthaerreo:yal and grand. Heroes looking to •4 TThheeleamdeeras lofytohue toowrdnewraendt two ahisresypooui-
led. Fotorqtuheell anpeexatsa2n4t’shreovuorlts. , the GM can
run into local high rollers have a high chance of c5all foYrouaadre2w0erllorlels.teIdf,ysoleueprinogllonana boedd d
numbcehrarymoeud vwoitmh aitl.ev•i tatioBnespdelbl.ugs or
•d oing soQinuethsattsesptaabylismhmorenet.than average •
v6ermiYnour’ureininvyioteudrtorbeescto.mTehaepeGrmManceannt
Entrance is prohibited unless meeting call fomr eamdbe2r0ofrtohlel.taIvferyno, uanrdohlalvaenyoourdd
aafEonllcllhooeawwrnitcneaegdignsaoumdgnegrlpeeylsastuyisopwncosiot:nhdWespe•a eltchiaEulsniintnrgavtnihtecaetion numbnearmyeoeutchweadkinetoutphefwrealql.uently, gai-

• ♦♦  QueAstsrpoayymalucfhammorielythiasn aloveorakgieng for n7ing aAlleocvaellbloafckesxmhitahutrsiteisotno .wi•n yLouorufdavor
hired protection • A wealthy aristocrat noisesbythofrfoeruingghaoguiltdetdhweenapigonhotffcrhoomice.
is♦♦lo Eontkrainncge ifsoprrohdibisitcedreuenltesas sHsearosess imneaettaion i8ndoorYocuaatrteleinvmiteadkteo yUoluurialno’os sMeansoler,etpo .
• certaRinicdhrescshcoadreacters with valuable You lotwsoienofeofeanrn.ed dsipneelwl isthlottheobresatttthaecrkeaalmt ahas
it♦e♦ m Enstrantcteragrcatnttehd ioenvlyebsy sapnecdialbianvnitdatiitosn • disadvantage for 8 hours. • Poor
h9ygienAebargeosfu3ltheeadltihnpoytoiounsciosngtifrtaedcttoinygoua.
A♦♦tr Aardoeyarl fdaemaillyiins glooiknineg xfocrlhuirseidvperomtecatigoni- d1i0seasAeb•a th thAatlhoewallsyyopuilogf railml illissisloproekpainregd
cal weapons visits the inn • A bard for a pinalyaodurinrootmo .aid in a holy quest
•1 1 eAYnlolhyuaonuacrerdeeq. uliipkmeleynttios rbepeariroebd boremd i•n orlAy
k♦n♦ oC  whasraactesras lwaicthiovaulusabsleecitreemts aatbtroaucttthaievloescal poor barmaid is looking for heroes to
nobalnedmbaanndits• s1e2ttle aTarheedasiinsanpwuparytoefvriwodmeisttyhhoeuhcweroritwhfdap. trhiveatre •d iningA
A wealth of political local beggar asks for some coin •
T13he inaYnroeukagse,aesipnuceahrccapesslusentaoddeosrtghyreooruwunidstetorfaopirnbaiiyndgdtehne
in♦♦tr Aigtruadeeradneadlining ifnoerxmcluasitvieomnagisicaal vwaeailpaobnsle • taxes rtooomths,eolrasnecdrelot lridbraLrioesd. ging & Ser-
Freqviusitesnthtevininsits to a wealthy tavern
v1i4ces EYovuearrye iimnpnloarenddtotajovinerantrapvreolivngidgerosup
s♦ta♦ r Atbsaerdakrnnoiwnsga syaolaucioaus“sencraemt inev”olvainrgoaulnocdal basic loof dnogbiinligty,twohaochcaovemnmomoaddiactdewpelalisn-gs
townnobPleoor Wealth Effects In contrast sing trthaevseizleerosf haonudsesm. erchants. Other,
to wealthy taverns, poor inns repre-
s♦e♦na Atvwtahielaaelbtlhoeotfhpeorliteicnaldinotrfiguthe aendspinefocrtmrautimon.is m15ore Reaxrqeuanisdietxeopticlafocoedss aarreedreelinveorewdntoeydou
Either because they are favored, or for fabanudloyuousr (paarntdy, ferxeepoefncshiavrgee). servi-
n♦o♦ oF  rtehqueerntpvliasictsetotaowsetaaltyhywtaavesrnasvtaaritlsaebarlnei,ng c1e6s, raYnougrirnogomfrisomchaarmneidna-gahinosutseevilmfoarc-es,
eveyroyuaad“nvaemnet”uarroeurndistobwonund to spend a gical iatnedmis rgeuparadierd sbhy otwpoamnedrcelunaxruiersy.
g1u7 est Trhoeommasyotrosesnkdys abpouursnedfilsletdabwlitehsgfeomrs
magictaolthmanokuynotusf.orTvhisoitsinegwhihsotovwins.ited
F1i8zzleYnoouzr zoplein’isonniesvwearntseedeomn htoow btoedqeaulite
the sawpmoitpehu…ltahteCioionm.mpomveorinsheSdearnvdicheosmAeltestshe
vo1ef9freyrlte“ArSalalisrvl”ote,wolebreov“rrKesnirnaaydnsdeLisomprtodaop”brlalveniisldblhaeogmfdefreesfroncyarotlultcyhfaroeenue
night iatenmds aforstihme penletirpetlyaotef yooufrfsotoaydi.nItnhe
additiionnn.to providing in their visitors’

b2a0sic nYoeuemdasy, emmoplsoty itnhentkaveeerpn’esrhsiraelrienggslad
to helpanad nmderkceinnadrileys faorrraadnisgceouantceadrprriiaceg. e

ride to a neighboring town or sum-

50

L & SmInononkdeaegmpieenrsssgkennogwertthoeedrleovlcivaiclerceoasmnmotue.ni- dPirticterails, tUonfcionmdmtohneSierrvwicaesy into ta-

Ety and surrounding lands well, often v2egrpns and (Purinva)tienMteeentdinegdRoeoamrss. Bards
enjoying cwlaasrsm.pbveaarssryiseciilnnlaogntdtigaroniannvdgestltaeowvrseaircatncnhopdmrloomvcioaddleaste ta2onspdincfroiremrs tdTrhoeraceanudlmsolapectnoiatnpslgsu/Talrabarnosuncteriwbtihnsegoluattelsotud,
working t1i5dgipngs. Lawman helps defend those

merchants. The finer the accused of breaking the law
Below are somineno, tfhtehmeorme roesntowconemd mitson
services oftenfaabvualoiluasb—laenadnexdptehnseiivre—pri- R2e5gsppected HTeraulisntgeSeerOvifcteesn the inn-
sceersv:ices are. Ranging from an in-house magical keeper serves as a trustee, keeping
t1hgep/dsaayvingshGiuoraefrddlfeordocmSatlatbhmleesitno-weTnww, owo riglkul eastrradsns,,d
item repair shop to sky bound stables for magical translate awnadtcwh ornityeouler titteemrss. for tho-

Cmooumntms; olunxuSreyrkvniocwessnPorbiocuenCdaormiesminotnhese s3egpw/hdoaycanS’ptecrieaal Sdtaabnleds -wPreirtfeec,t oforr htheolspe
settle a disrpiduinteg ibnectawrrieaegne oar wloanrdtinagntod
iLnonds.ging 1cp/night Private Room 3cp/
peasants. Mhooldresoomfettehningthelasenenntoirte,lyt.he
night Stables 1cp/day Guarded Stables
3Atctph/edvaeyryCleoaastc, heve/rCy aesrtraibaligshemReindt eca3ncopffeprer
mtraivleelePrsoasbteadl f/orMtheesnsiegnhtgaenrd 2acspimppleermmeaill. e i5ngnpk/edeapy er Lkonckoewd s/ Goufatrdheed lSotocraagl ec-omThiengs
UInnatdrdaitiinonedto Hpriorveidliinnggba1ssipc npeeedrsd, mayosTt rain- awnhdengoaisnkgesyildonobcnutkukroeetb.dee,kplcoenarnsUoghtwinoinrlcgdososnst.,mtohchemkaoernomelnypedkSaedeyosrotevorciafcroeer st
iendnkHeeipreerlsinwgill3ksinpdlpyearrrmanigleeaCcaormriamgeornide T5hgpo/smeilleookCionvgertfoMresaselnitgtelre-mSeondres aser-
ttIootedamenlieviRgerhebaponaroiintregs. tI1onswnpknepoerpeserursmitkmenmoonw a messenger vice, trainemdeshsairgeeltionagnsyoonre wsiimthipnlryeamcho. re
the local
luxury, miTgrhatinbedeHinirelluincgk- aIftycoeurjutastinnetead-
Hceonomjomyminuegnbiwtayasarmend&rseulLartroioonunngsdwsinittgahlyathneLdswowowrekellir,noglfetcevlanesls. v3esrpn/msi.leYousrommeinfodddiesr ytootuhre tleiammi,tthaiss itshtheey
heroes might not have acquired their
say in Fizzbleetnteorzozplteio’ns. Hall of Wonders,

otCawovmnermhnoosnmaSreeebraavnsiceeexysceet.llIenntsuhcohmceasbeass,e to a1n0gdp/idta’ys cerStpaecinialiysttHruireelifnogr-sTohmesee exotic

inns. mercenaries can be trained in the
arcane, or proficient with the most
Baedlvowenarteusroimnge ogf rthoeumposs.tOcofmtemno,ntsheerviicnens -
okfeteenpaevraiilsabmle aonrdetthheiarnprhiceasp: py to strike a powerful weapons.

deal for long-stay and safekeeping of U2n5gcpommonPriSveatrevDicinenserR-oWyahlenLyoodugwianngt

iPterimces. ThisCmomamkeons Sietreviacsesier for adven- to rent the whole inn out for an

2gp / nightocEcaxsoiotni,coLr ofodr gaimnegeting.

t1ucpr/enrisghtto scCooumrmaonneLoadrgbiynggoblin-in- 8Rgepsp/ecntigedhtTLrauwstmeean helps defend
fested cavern, and fall back to their
h3ocpm/neigbhtase PtorivraetestRoocomk and rest. those accused of breaking the law
1cp/day Stables HInneklpeespetros dofetefnenacdt atshaotsreusatecec. uThseeydmoafnage
abthnredesawakvriiitnnegglsetottfhelreoscflaoalrwmthi.no1se5ewgworphkoeHrcsae,natnrlaoinnt,sgolartSeheerlp-
I3ncpa/mddilietion,Coparcohp/rCiaertroiargse Roifdeinns are vseitctelesdAispsuoterscbeertewsesenwloirldlscaonmd peeatsoanhtes.al
yThoeui,nnakneyeptherinkngowfrsoomf thae lpoacaplecormciuntg,s taonda
e2xctpr/memileely kCnouorwierle/dMgeesasebnlgeerabout the mgoianngsgbleutdhlainmdlbes! tVhiasrpireisvilGegueawridthedtheSutatm-ost

l1oscpa/dlalyands UanntdrailnaetdeHstirerluinmg ors, offe- dbilsecsretTiown.o guards, hired from the town,
r3isnpg/dapylentySotofraogpeportunities to tho-
se seeking quests or work for hire. will stand watch on your items. 1gp/
P1osps/titaelm& MeCsosmamgoinngIteTmaRkeipnagirsa central

oUpflnateccneomidnmoutohbneleSldoercavaslicpceoossmt mstuonp,itiyn, taverns
varying

dTheogsreeloeosk.inAgmforyarilaitdtleomfomreessersvaicgee, straiisned
dhierelilivnegrseodr stiompdlyismtaonretludxeusrty,inmaigthiot nbesi,nbluyck
mat ceesrstaeinn gtaevresrnos.nAshtohresyesbayaicnkFiozrzletnieodzzlteo’s

tHhalel olfeWg oonfdearsp, i“gTehoe non.lAy llilmsiotarttiosnoisf otnael’ks ,

fimroagminapteiotnt”y. Tghoississiptruteofovrosloamteileexosteiccrinents as

iwnefllo. rmation travels down well-known

trade routes and long-forgotten ban-

51

Price Rare Services Description
varies
Aidan's Spellbook and Aidan has trained many apprentice mages in the art of
Transcription Vault transcribing spells. She has also established extra dimensional
storage facilities to hold copies of spellbooks. Spellbook
varies Totin’s A&W Polishing Transcription is 15 g/ spell level + 20 gold for book materials.

5gp/ Kami’s Bathhouse This young entrepreneur opened a service to clean and polish
hour adventurer’s gear.

5gp/mile Fox Mail This refreshing hot spring is said to be heated by the fire of a
dragon’s breath and provides mystical healing properties. You
10gp/ Torrick Shaw Tours regain half your total HP for every hour spent in the spring.
hour
A special mailing service between neighboring towns. Need to
3gp Virgil’s Valet deliver news quickly? Just fox it!

varies Ritual Priest Torrick Shaw designed these luxury carts to be pulled by
Painter servants carrying nobles and adventurers, providing a private
tour of the city, complete with history and local lore.
varies Auctioneer
The valet picks up your mount or carts and has them stored,
varies Currency Exchange sheltered and fed while you’re away.

Offer ritual spell service.

Get your armor, weapons, and other gear painted. Also available
for those who fancy an artistic rendition of their heroic feats.

Talk up items as an NPC and convince Heroes to bid against
each other.

Offer the heroes a way to exchange currency of any kind

Exotic Services

Some establishments offer exceedingly rare and exotic services. Affordable only to those with bulging
purses, these remarkable services are not easily found elsewhere. Several of these services are not
necessarily expensive, but simply unique to one particular tavern in the world.

HdaoymSepbeacsiael&StLaobnlegs stPaeyrfect for tho- Pneoesdtaslo&mMe feosdsdagerintgo the team, this is

Asedvreindtuinregrsiwnhcoaarrerieaagrley ionrthweiar ncatrienegr mtoight the better option. 3sp per mile Pri-
nhootlhdavseoamcqeutirheidnaghoemlseebaesnetyierte. lIyn.su3chgpcas/es, TvhaeteheDaritnonf ethreIlfocyaol cuomwmaunntittyo, tarveenrntstohfeten
tdaaveyrnLsoacrke eande/xcGeluleanrtdcehodicCe hofersets/idSetnocrea. - wdohuboleleasinponstosutotpsf,oirn avanryoincgcadesgiorenes,. oArmfyorriad
IgnenkTehepeerisnanrekheaepppeyrtohsotrlidkse athdeealofnorlylonkgeeyr oaf mmeesesatginesga.re2d0eglivperoedneto odfisftaEnxt odetsictinSaetiro-ns
sttoayas aloncdksteodra,gceaosftiteirmosn. T, hcihs amramkeesdit edaosioerr bvyicmeesssWenhgeerns oenvheonrstehbaeckboersvtiaisconuoriteren-
ffoorradyvoeuntrubreerslotonsgcionugr as.n5eagrpby/godbaliyn-Cinofvesetretd opiugegohn,s.sAollmsoertus nofiqtaulke, fersomtapbeltitsyhgmosesinp ttso
cMaveesrns,ernetguernrinSgentodtsheair mhoemsesbaagseettooreasntoycko- vooflfaetirlesseercrveitciensfosrmoaetixoon ttirca,vetlhdeowy nawreellr-are
anned wreistt.hin reach. 5gp per mile Speci- kannodwnfatrraidne rboeuttews eanednl.onOgf-tfeonrgootntelnybaanffdoitr-
dtraaiblsl,efitnoditnhgothseeirwwiatyhinbtoutlagvienrngs panudrses,
aIlnisatddHitiiroen,liinnngkeTehpeerssearme oefrtecnefnirasrt iteoshecaarn mtat(nuihendnweie)dnitssngheaasteil.ronrneuedgdmeadtniomaeoiarnterkfsdeoa. raBbmtsaloreitdlhmysseeafalnrookdvcueaiclncrstiedheosrfesetoilhrrsfeefaegledwaurtpeehossspetotur-slear

tbhee tlartaesint reudmionrs,tmheakainrgcathneem, aosrolpidroliafiiscoinenfotr

twhoitshe stehekeinmg qousetstpsoowr weorrfkuflorwheiraep. ons.

10gp day Trained Hireling If you just

52

W & Tansotcoonmercfekosrstaarbilley aersxpapeoinsnssiiibvnele,g.bOutthseirms palrye Buspp/ayhtoouutrrlmVeiormguinla’tssoVrtacelaerrttsTs haendvahleats picks
them

Huniquemtoaoknineciggahpnltaybhresetkfmioicluluenadldaasirnnpdtteaatcvrvieaearinnrl ensed, xlifonpiogekhtrithnei-egrs Rsatwoareyd. ,5schpeLltaewferoteiumrdneddaaniannddHvtaefveneeltrupdnrssew.rtsHhocaiadvlneienofygfeotpneuundt’bree

world, those accuseddoowfnbtrheeaskwionrgd atnhdeplraefwer.ri1n0g
ence indeed. for work and the latest gossip. g Book seller sRoemnetpaeabceoaonkd oqufiefto,rsoampeea-re
riod of time. 5wicl/lindgatyo sRhiatrueathl eCiraksntoewrlOedfg-e
Those who are looking for fer ritual speltlhsroeurgvhicterai5nigngpteorthsopseeltlheley-
Service DescrsippetciiaolnistPwroirckefoMr heirrleinhaav’esa vdeeelmPwaoinrttheyr. Get your armor, weapons,
Spellbook angdooTdrcahnasncceriopftfiinodninVgawuilllting and other gear painted, or do you
Manderalbilne afolhkaast tthrealioncaeldinmn.aFnroymaspimpprleentice fBaefnriceyndainpgosurcthraaivteotefraynocuarn hheelproyiocurspellafy?er1s
ogb/tiatienmspegceianl eknraowl l5edgge/,sausipteocifalawrmeapoornPorrig-et
mtasakgs esuscihnasthsceouarrintgoaflotrcaalnssmcurgigblienr’gs dsepne, lls ctreaipnienrg vinethhiecmleosvtasroiuegshtA-auftcetricoonmebeart sTkailllsk.
uSopmietwemill spaasss oannthnepircknaonwdledggeetinplraetyuernrsfotro
atosdwaneglelrohuassanodpceonveerdt ompearantiyonsst,otrhaergee’s fnao- ssotmaretcobiind; ionthgerasgaareincosntteenatcinhsoimthpleyrhDavMing
stwdohiamsencetsprcetlooatmiyhopeeanarnrsyCthaiuneriwrrreseattunyorrcnitey,oss.EoemxxeccohhnaaenntoggteealOckuftofrerarennd -
cshiloirttiaegse otof pheoopllde lcoookpiinegstoohfimre aadgveesntsupreerlsl.-

books in an extra dimensional pocket. cAyt t,heeiGthMe’srdbisectrewtieone,nassa,gn,opptoiornealleruclter, um
BGeonoekralslyt,ohriaghgeer risisk15asgsi/gmnmoennttshwSilpl ceolmlbmoaonkd oyoruecvouelnd mbeaktewiteiennterkeisntigngdaonmd sm.eDaneinpgefnulds
Thirgahnerspcrriciepst.iWonhiliesa1n5ungt/rasinpeedllhilreevlinegl c+an20 foonr hciguhrerre-nlecveyl characters to acquire new
PgbpperaooiresllaesdidtnsetohftfotihoAnrrdkogbehulogmYivhooiesktruhsanemamfcgeralesoytstwseteahdrrgreioeada,ulsnegstshdr.ceoTheeretotnsritnotaigrfnnenJt’ahpusuearzlAehuhinn&go,ehlWyur
orepqueinreesdspaecsiaelrisvtitcaeletnot. clean and polish
adventurer’s gear. 5 sp/weapon 2 g/

suit Kami’s Bathhouse This refres- combat skills through battle masters. Instead
hHiinregdhToastkspring is said tRoiskbe heaPrtiecde
bSyetttlheea mfirineorodfisapudtreagon’sLobwreath2a5gnpd Fofosoimdp&ly gDerttiinngkstheAnfetwerskaillhs awrhdendlaevyesling
uwpo, trhke oherrownheeedns tborfuirisstesdeekknouutcakvleetserafnrom
pLroocavtiedmeismsiyngstpiecrasolnhealinLgowproper50tigeps. icnohuins etxlepserstibseaatntldegsetnheiemd/hreer stot,trtaainvehrimn.s
oRefafcehrincgotmhefroerqtuiinregd XdPriinnkthsisacnadse,fiosojudsttoone
OEvsceorrt1ahcaoruavrarnecover up tLoowhalf y7o5ugpr osforoetqhuieretmheentps.aAilntesrnaantidveelys, cthaepGeMhcaarndrsuhleip.
tAhfattegretatinggrtuheelainidgoftareBkatttlhe rmoaustgehr etffheectiwveillyd,
tEostcaolrthapr.ic5h ngo/bhleour Fox MNoariml Aal sp10e0cgipal erevdeuncesththee sreiqmuipreldesXtPpbyinotneo-fthairlde, cbuatn taste

mGaatihleirnrgarseesrpvelilce betweenNonrmeiagl hb15o0rgipng ldiekmeanthdsethfienheesrot tmo sapgenicdasligdnrifaicuagnthttim, feiilnling
tcoowmnposn.eNntesefodr taomgageet news somewhere
quick? Just fox it! 1 sp/mile Tor’rick tornaien’insghoef athret Bwatittlhe maawstearr. m glow. A plat-
SRheacowverTaoluosrtstrTeaosru’rreick ShNaowrmdael sig25n0egpd
bIunfiillttrtahteetshee elnuexmuiersy’ cartsHtioghbe pu35ll0egdp by ter of steaming hot cabbage stew fills
sbearsvtiaonntasndtostecaal rprlaynsnobles and adventu-

rAesrssasaslinikatee athreokuinngd the citHyig. hProvi5d0i0ngpg a the gut and warms the limbs, though

pSrlaivy aatdirzaegdontour of the arHeigah, com2p00le0tgep finer cooking is available if one is wil-

with history and lore of the area. 5 ling to lay down some more coin.

At the very least, even the most squa-
lid taverns can provide at least a loaf
of (moldy) bread, a pint of beer and
salted pork or stew. Most taverns
rely on local produce, in particular
what the farmlands can provide. Daily
meals consist of pork, chicken and
other livestock, combined with vege-
tables such as cabbages and potatoes.

Other ingredients that are readily

53

F & Davoaiolabdle includre:inks sPyrikcenollsC.oVmymoolnetDtiesh5escp A hot, fragrant
T• Seeds / Wheat • Bread • b1ospuquet Coafbbhaegrebstsewand flowers. Masks
Cheese • Maaivnledkrfn•os Foodifsftheors(codoomethpfeoerbntaintdtgsledoprainninkss Ly3oospuorsescteeanPotbrkfoowirliet3hdrhwooaisuttherdsc.aopSpaelseatsaTlepala3ncpts.
location) A3sqpuick fCihxicfkoern sbreeaassticakndnoensiso.nsLavender
and escape the drudgery of I4nscpense R2ocaspteMd beelelfowwitehdvewgeittahblwesarm
m4siplk, anFdisah hStienwt of lavender. Twilight
a hard day’s work. After a T5espa 8cp PFarrotrmidgtehPeiemoonlight fields of
Alyi, this brilliant-white tea leaves
grueling trek through the wild,
ySocuarrceiftryes&hePdr.eGsearivninshgoFrot ordest. Cop-
Common DrinekvesnAalseim(mpleupgi)nt4ocfpaleAclaen
t(agsatellloikne)th2esfpineMst emaadgic(aml durgau)g5htc,pfilMlinegaodne’s per’d Mint 2cp A metallic mint tea
b(gelalyllwointh)c2aglmpinGgrwoagrm(mth.uAgp)la2ttcepr oWf sitneaem6incgp tAhvaaitlabwilaitrymvasrietshgerebaetllylybyarnegdiocna, lamndsdtehpeends
hWotincaeb(bpaigtecshteewr)fi3llsspthWe giuntean(dfiwnaermbsotthtele) ohnetahretw. ealth of the inn. The most common inns
l8imgpbs,DtwhoaurgvhefinneSrtcoouoktin(mg isuagv)ai4lacbpleKifaohneveis
rely on a supply from local farms. If the region is
w(ciullipn)g 2tocpparTt ewaith(cmuopr)e c2ocinp.
nFeaamr aobuosdyAolfewsaMtero(osena, Blalkoes, spoonmd, rAivleers)2the
The most squalid taverns can provide a paltry isnpn MrelaiedseonfrthoemskMill oofolnocfallofwisheerrmthean.t only
bKloeespsinogmfosodunprdeseerrvmedoios nallwigayhsta challenge,
sCuopmpermofo(nmoDldisy)hberseaBd oanwdlaopfinstoouf aple1. cIfpyou’re
lBueckayn, spalotetdtafigshe o1rccpabBbargeeasdteawnmdiglhetftaols-o be often resulting in copious amounts of salt to
oDlcaCvianvpeaabeirtpbblshysatbleogem2acemskecgsa,ep3ealncsnsouBsdpcm.torMpebnCeoiwosanhtisasedtittd1cotsoaakewfpvsneie.ptndrOPhonrtovcskbher,herrgkrceeeehliytaenwiacssgobkitnreleteenhalsdpo,nisclearuaandnoclttdhapstoresotanohttrsdhiea-ue3tdrccaerp.e
coonmsm3osnplyRavoaailsatbeledinbceluedfe wseietdhs, vwehgeaett, abrbelaeds, pBrloalocnkgthitsolrinfesApalen. 5SocmpeHfoeoadvs yarae lseerbverdewfreesdh,
c4hsepesFe,imshilkSatnedwfis4hs(pdePpeanrdtirnigdogneloPciaetio5ns)p. sinuchbaasrrtheelsfissheearmleedn’ws diatihlybcalatcchk. Gtahmoermnetartee
Tea The best teas, are often the most tshaapt .isGaucqsuhirwedotrhtrhouAghlehu6nctpingFoieftreyn,dcemheansdts-
nhiughtecroplroicrees,dduaeletoiintsfusmsealdlerwyiietlhd.bTlhaecrkabreer-
Cpuenorimfqemuceot.nwSDohmiicshehetissea&w-hlDeyarvwineeskhstaakvee years to rWiheiste. wSouodnssowwlobredar,Afoler e8xcamppLlei,gihs dtisapnadtchreed-
brought hafrftiirhnEncoedxhadwos.btithtrlistcoiaAunwpsglrgaehtoyetda8osudlnccoeltewpiokanitnPenhfdrerfaoesusmofisslmevwetreehdrriefefprwtsdulnaisittobttsuwehyanryrsweremoilsfisvoclteueadhn.rsefctWleavfo,ieonwoarrsnylefdti-ortss
cusoumallpyloenxlyfalvaaviolarbsle, tiottgheetwseailttshyf,luanvloesrs from
yPoruicea goCoodmsmeolnecDtriionnksof teas to enjoy. dyouusakregrinoavetrofpriucaitl sre.giDonw. Saormveesdisshceosfafreatso
aindcrdeidnibglyfsrturaintgteothaalteosnblyuatfeswechraevetleyveardtamstie-d
T4acpke theATlew(miuligg) ht Tea from the haun- trheemth, eleatvaisntgeo.neGt’oowtohnrdaekr kifiiht w1a0scnp’t jFuestr-
ted fields of Alyi. A lot of debate goes amnoetnhetreddrutrnokallrbd’lsotoalde,…tastes like rusted
i2nstpo whaAtleg(igvaellsont)he leaves their bril- iron Illman’s Respite 12cp This hoppy,
l5iacpnt-whMiteeadc(omluogr), some say it’s the
ytMherotorfaleatTvyohorausnodmJiudesntd’tBrikennekroswooytohuehs atdh,easnodre
b2ognp es ofMtehaed (dgeaallodn)that have fed the
tOhneeowf tohrelodldseesteamndsmthosattdilvietrtsleebberviegrahgtees r.
p2lcapnts beGnroega(tmhugth) e ground, and others
in the world, beer plays an important role in
s6acyp the mWoinoen(gklaissss) es them of a night.
E3istpher wWayin,ei(tp’itschreerf)reshing and it feels dMaiolyrelifTe.hWahnethJuersitt’Bs felaevrorOednewiothf tthheebaorkl-of
like sleep when you drink one. Other abWddeeiWaevtsrheetirirstdiesstwrehoieo,fnotdbedkrnesisneufkeirnnrosnpaf,tlfclheayhyterooiislcwldeahrofiennorrrkbli,bdmosorotaphwnboyyedreovrtuetarnphnngreoetavgnmirgddoseo,oslelsadt.
t8egaps, havWeinree(mfineedbioatltlqe)ualities, like minucdhanileyedleidfea.lteWrnhaetitvhe.eBreeirt’iss afllsaovforerqeudently
t4hcep Sea TDewaa,rvpeenrSfteocutt (ftaonrktahrdo)se green uwsietdhmtehdiecibnaalrlyk, doufe atoWthhe iatlceowhooloindfsusfeedrwni,th
sLoyorthililnghheerrbbso. Irt ealvsoenprowviydveserantherigvignsg,sbouerecre
s2aciplors wKhaohvhe (acvupe)n’t got their sea legs ocfotmaxeisncionmew. ide variety and is consu-
mIneadddbiytiobnotoththyeonuumnegroaunsdnaomledd. bWeearster is
ju2cspt yet!TSeoa (wcuhp)y don’t you have a doefstcernibeudninsathfeeRteomdarrkianbkle, Isnonsbseecetriopn,rhoevrie-are
gander at our selection. sdeevsertahl aelems duiscchovenreededanedddnocuutmrieenntetdsb.yBQeueilrla

Price Common Dishes on her many travels.

R1capre TeaBAowzluorfesloeuapf Tea 5 cp Blue
sweet tea made of leaves found a top
t1rcepe canoBpeainespoitntageelven territory. Silver

L2ocptus TeBare2adcapndAlesfotoovtehrsing silver tea

f3rcopm a coBrmeamd aonnd cfhleoewseeprlaftoteurnd in gras-

54

is also frequently used as a sliced
le-
medicine, due to the alcohol
infu“sWedhenwtoitilhansdotorotuhblienfgindhs eyer’bdso,wn
andApnrdoyvouidr heesadd’sahielayvyafmromustheemcreownnt
as wWelhlenasbroaketnhfrisitvsicnang’tsmoaukerciteright
of taxAnidnycoou mlie eawEaxkeotthircouFghoothdesnight
As diverAsheopapsy dtohsee ocfoalleowrisll oheflp
the ManTdeon rdarilnkPsedaowcon cakll ,isiwseltlhe
mélanYgoeu foinfddyoiusrhberestharenndindthreininkns
foundWahecrreoysous stphilleyowurobrloldod. aFnrdogmin
GnoYaorutuknsokw (thae swloorlwd clayn’rtogaetsytoeudhere
boar’s Fhoer aindthyeoloudgeeaytouwdihsaoplpeeaarnd
klaeregpe,thbTehluaOtte,usjtussasrqkttteushd)iindwok-irtohlfiBaekvupeeilrnbyct rbtoaefulaeaalte”u(are

eaten alive, with just a dash of

Price Famous Ale Description
2cp Trusty Swords Simple, mild ale is cheap and sits well on the stomach after a long
march. It’s recipy is rumored to contain potatos and onions.
5cp Blackthorn Ale Heavy ale brewed in barrels sealed with black thorn tree sap.

6cp Gushworth Ale Fiery, chestnut colored ale infused with blackberries.
8cp Sunsword Ale Light and refreshing ale infused with wildflowers that tastes like
a brilliant sunrise.
8cp Wolfhowl Ale Preferred by elves for its complex flavors, it gets its flavor from
dusk grove fruits. Dwarves scoff at adding fruit to ales but secretly
2sp G’othrakkih admire the taste.
1sp Nighttime Breeze Fermented troll blood, tastes like rusted iron.
A mix of black currants and honey that keeps this dark drink a
2sp Meek Moss Ale tavern classic.
A coveted ale from the cave dwellers beneath the Shivering Lake;
3sp Travelers’ Bliss it’s said that they ferment moss and algae for a year, providing a
5sp Goblin Snuff unusually strong beverage.
This hoppy, yet flavorsome drink soothes the sore throat you
1gp Moon Blossom Ale didn’t know you had, making the world a little brighter.

2gp Hill Giant’s Gut Some argue whether this is an ale or a broth; as its boiled goblin
Punch in the belly of a boar - this drink is both filling and a great way to
start you’re murderous, drunken rampage of the village!
Made from the Moonflower plant; its rare blossoms only appear
under the full moon.
A rare drink from the desert wastes of Voroshi; where only few
adventurers return from the monsters that ravage the lands.

55

O Dmsigounnastt)ul, reaevnedridyshri.esTghhioenvoafirtiseenhtyheianssdirtsinokwsn Whitewoods
& DhisupnodsrseridbiltnyypekvesesnofgrBeeaetrer(a, lwe)it,hWoivneer, a owl bear,
shot and
ASpirits and Lsiqduivoerrsse.aMs tahne cyolaonrs aofdtvheen- brought
down from
turer painfulMlyanrdeomrael mpeabceorcsk iiststhfeimrsétlange the snowy
gulp of Hagsohfodtis,hoers atnhdedirnindkessfocurnibdaabcrloess
bouquet of Gtnhoe mwoerldM. Ferloimdigenuora.rtuSscka(ra- mountains
city & presersvloinwgly frooaosdtedAbvoaairl’asbhielaidtyyou to find its
way onto
varies greatlyeatpwehrorleeganiodnkeaepntdhewtuesaklst)hor the silver
platters of
bouflbtbhuea i(na lna.rgTe,hbelume soqsutidc-loikme mcreoanturienenasten the very
rich. Game
raleivlye),oenvearysruegpiopnlyhafsriotsmowloncsaiglnfaaturrme dsi,sh. meat that
is acquired
sAenrevviennggrmeateearlvsaroieftypoexrikst,scwhitihckbeevne,rapgoest,a- through
hunting
twoitehso,vleoraovneshuonfdbrerdetaydpeasnofdalvees,gweitnaebs,les. often de-
mands
sCpeirrittas,ianndremgaigoincasl dnreauagrhats.large body of higher
prices, due
Mwaantyearn(asdevae,ntluarkere,pariinvfeulrlsy)reomfetmenberrselhyis to its smal-
foirnstfgisulhp,ocf rhaagbshaont,dorotthheeirndceasctrcihbable ler yield and
boofufqiuseht eofrmGneomn.e mKeeliedpieiunr,gmfeonotadlly hard work.
tprraevesleinrgvbeadckfotorthloatnrgemerarpkeabrlieods Fruits and exotic
misoamlewnta. ySsomae cmhaaklelefinndgien,g,otfatsetinng,
ranedsudoltciunmgenitninhg ethaevwiloyrlds’aslmteodst
mremeaartksabalenddrifnikssha,ntdodipsrhoesloinntogtheir
ilitfse’sliwfeorskp. aDnis.coSvoermwehaptrooudtlauncdeisihs

tsaesrtevseQduiflrlaecshhr,onsiuclcehd oanshfeirsmhacnay u-

jgohurtntehysa..t. very day, or the rare

Rare Dish Description Price
4gp
Tunoshi Steak Feathered, bipedal reptiles that roam the desert flats of Kreek, seared 10gp
for 5 minutes over a burning fire. 1gp
20gp
Kalyi’s Polum’s Kayli, a delightful witch, sprinkles a magical sugar on these fruits of 3gp
the Polum tree, giving the consumer the ability to taste color. 35gp
40gp
Grubgot A chocolate covered delirious grub, known to induce hallucinations. 60gp
80gp
Wyveri Boiled for an hour with various spices, these cousins to the dragon will
make you breathe fire. (GM determines how long the effect lasts)

Medusa’s Kiss A delectable soup made of several small snake bodies, mixed with
intoxicating herbs.

Mandoral Peacock This rare bird lays one egg per year, and it is delicious. The yolk has a
creamy, nutty flavor fit for nobles.

Tiandari Plumps A peculiar fruit, it’s soft to the touch, but as you bite into it the taste is
whatever you want it to be. Said to have highly persuasive powers.

Nurnn Gut The entrails of a Nurnn, a gruesome monster found only in the deepest
depths of the ocean. Said to invoke clairvoyant powers when eaten.

Abolium Delerium inducing broth made from Aboleth muckus. Rare are those
familiar with the recipe. Rarer those that dare collect the ingredients.

56

pDreoldiguhcetfiuslsTcaerac&e, Danrdinukssually only accompanied by a shrill giggle-whoop

available to the very rich, unless you sound. 8gp Grandiola A grand bowl of
Tahree bienstatetarsoapreicoaftlenrethgeiomnoswt uhneiqruee.itSoims e tealeavesftlaokaetyienagrs ptoepaerrsfeicnt; fsopr iecxeadmpwlei,nthee. TFwitilifgohrt
Tceoamfrmomotnhleyhaauvnatieldafbielled.s of Alyi. Connoisseurs debateroabyoaulttwyhat gives the leaves their brilliant white
color. Some argue the bones of the dead have fed the plants beneath the ground, others swear the moon

kRiassrees tDhiesmhaetsnTig’hot.sWhhi aStetveearkthFeecaautshee, rtheids ,unique bl1e5ndgplulls the drinker to sleep with its delicious
fblaipvodr.eOl trheepr tteiales shatvhearetmreodaiaml qtuhaleitidese,sseurcht as Illyruian Sea Tea, which is perfect for those green
sfalailtosrsowfhKo rheaveekn’ttaesartneesdgthreeiar tsesaeleagrse. d for 5

minutes over a burning fire. 4gp Ka- Magical Draughts Karkaudus’ De-
lTyei’asNPamoleum’s FruDeitsscriopftitohne Polum tree, fiance STR +2 for an hour, you groPrwice

KAazyurlei,leaafdTeealightfBulluewsiwteceht,tesapmriandekolef sleaaves harvessctaedlefrsomantdreegcaainnoprieessiinstealvnecne to all fi5recp,

homebrewed sugtearrritoorny,. giving you the and melee damage for an hour.

aSbilivleirtyLottoustTaesate cAolsoooutrhsin. g10siglvperGteraufbrogmoat common flower found in shallow waters. 2 cp

AVyhoaleltltue cination iAnhdout,cfirnaggracnht boocuoqluae-t of herbs an1d5fglopweMrso. MnaosskissyoYuor usceanrtefohr a3rhdoeurrs.to s5ecep,

te covered delirious grub 1gp Wyveri gain DEX +6 for 3 hours.

CSoeauTseina s to the dLroaogsoe nte,a tbhoielesdewbitehacsotasstal plants. A quick fix for seasickness. 3cp

tLaasvteendgerreInactebnsoeileMdeflolorweadnwhitohuwrarwmitmhilk, and a h2in0t ogfplavJeonrdie’rs. Scotch You feel more 2 cp
various spices, it’ll make you breathe relaxed and content, gain CHR +4 for
fTirwei.lig2h0tgTpeaMedusFrao’ms tKhiesms oAondlieglhetcfiteald-s of Alyi, t2hihs obruilrlisa.n2t-0wghpiteHteoarlseaeveEslyixour You fee8lcp
ble soup made orfefsreesvheerda. Gl asimn oanlel sshnoartkreest. as healthy as a horse, gain 10 ft mo-
bCoodppieers'd, mMiinxted wAitmheitnaltliocxmicinatttienagthhatewrbarsm. s thevbeemllyeanndt csaplmeesdth3e0hgeaprt.Miasmic Shot4Acp

3gp Mandoral Peacock The egg of the shot of this, and your body will work
rare bird that hatches only one per the putridness out, leaving others to
yEexaorti.cCDrreinakms y anDdesncuritpttyionflavor fit for think you have died. Feign death fPorirce

nGonbagleas. 35gp TiaVnicdioaursilyPelxuomticpwsinAe,pberecwue-d with 2snhakoeuvresn.om50agnpd sQpi’coesr.i’s Wonder Upo3ngp

lTiaorokfirnu’Diat, it’s sofFtortloontghjeoutronueycsha,crboussttahes desertd. Ornine ksiipnqguetnhcihsesytohuirsht afovrehotuhres. ability4ogfp
yHoiupstbairte into it tThaesttyaaslet,ehiasndwchraaftteedvferorm locallytesoleurpcoedr,tfarteieornanfgoe,rg1luhteonu-frr.ee(,Distance5gp
you want it to beh.an3dp0igckped, organic hops. Curiouslvyaorvieerpsribceedt.ween 10/30ft) 200gp Fora-

M’othma Mullgra From the cavernous villages deep bleen’esatFhitxheNeearetdh, athdisrdinrinkktios sgoeugthytou ba8tgtple
after for its insult-inspiring mélangreeaofdeya?rthTyhfilsaviosrsy. our ale! Gain STR +2

EFxizoztleincoDzzrlien’sks MAelgiodldieenurfizGzinnog mcideerlit-hat sparks tCheOmNos+t2wo7n0dgerpfuBl (itthtoaugTh hofetesntale sten8cghp
qSupaorrkpwopitphertantalwizoienfugllytaidsiotetico) fidienasvwenith-each sipo,factchoimspdanriiendkbysma sehlrlilsl gligkgelec-awthouorpine, but
tion 2gp Tookins’oDunad.For long journeys you get Darkvision for 5 hours. 100gp

aMcreloidsiseutrhe deserGt.noOmneelisquiporswtiitlhlsthtehtiarnsttalizing tBalsatezoifnignvBenltoioond. Red tinted ale brew2e5dgp
for hours 3gp Hipstar Locally sourced, in a barrel made with the bones of a

free range, well-treated, unmodified red dragon. Grants resistance to fire

ale with handpicked organic hops 4gp damage for 24 hours. 150gp Frost-
M’othma Mullgra From the cavernous gale Icey clear ale brewed in a barrel

villages deep beneath the earth, this made with the bones of a white dra-

drink is sought after for its insult in- gon. Grants resistance to cold damage
spiring melange for 24 hours. 150gp Witch’s Lull This

mystical emerald glowing recovers a

5gp Fizzlenozzle’s Sparkpopper A single low level spell. (DM’s choice)
golden fizzing cider that sparks the 300gp Godesses’ Tears This silve-

most wonderful (though often woe- ry ale allows the immediate recovery

fully idiotic) ideas with each sip, of some lost HP. 150gp Dreamroot

57

Magical Draughts

Exceptional patrons require exceptional drinks. Swirling with potent arcane
energy, these drafts provide a welcomed relief from a long day’s
work as well as a wide range of powers. The effects of these mind-
boggling drinks often vary. (A Miasmic Shot, for example, is drained
from corpse husks to mask your scent with that of the dead.) Each
delectable pint is carefully concocted and aged to perfection,
imbued with preternatural properties that make it a useful
commodity to an adventurer. Several have become bar staples; an
instant favorite among guests far and wide. With unique flavors
from the farthest flung reaches, nothing can best these draughts.

Magical Draught Description Price
Karkaudus’ 15gp
Defiance You gain a +2 bonus to your Strength score, and you have resistance to
Monosis Spirit fire, bludgeoning, piercing, and slashing damage for 1 hour.
Jori’s Scotch
Yearlings Elixr You are harder to see. You gain the benefits of a blur spell for 1d4+1 20 gp
Miasmic Shot hours.
Qori's Wonder
Forale's Fix You feel more relaxed and content. You have advantage or your 20gp
Charisma checks for 1 hour.
Mangkoon Brew
Blazing Blood You feel as healthy as a yearling. You speed increases by 10 ft. for 1 30gp
Frostgale hour.
Witch's Lull
Godesses’ Tears A shot of this, and leaves others thinking you have died. Feign death 50gp
Dreamroot Tonic for 2 hours.
Eldritch Bane
Chromakul Upon drinking this you gain the ability to teleport at a range of 30 feet 200gp
for 1 hour.
U’thma Koki
Need a drink to get you battle ready? This is your ale! You gain a +2 70gp
bonus to your Strength and Constitution scores for 1 hour.

The stale stench of this drink smells like Aboleth muckus, but you 100gp
gain darkvision 60 ft. for 2d4 hours. 150gp
150gp
Red tinted ale brewed in a barrel with the bones of a red dragon. You 300gp
gain resistance to fire damage for 24 hours. 150gp
50gp
Icy clear ale brewed in a barrel with the bones of a white dragon. You 1000gp
gain resistance to cold damage for 24 hours. 1500gp

When drinking this mystical emerald glowing brew, you recover a 2500gp
single spell slot of 5th level or lower (GM’s choice).

This silvery ale allows the immediate recovery of all your lost hit
points.

The greenish liquid has been used to awaken those who are asleep
through magical means.

This dark swirling concoction induces haunting nightmares.

This drink swirls with the colors of chromatic dragons. It is said
to harness the breath of dragons. You gain the breath weapon of a
dragonborn for 1 hour (determine your draconic ancestry randomly).

You can see between the lines of reality. You can see into the Ethereal
Plane for 1 hour.

58

G & GTusoenadimctoTehasewgakreeenntihsahomsleiqbwulihdionhaagrse been CTroamdme ofonrGgaomodess and services Worth
asleep
Fetch an item (within village) 3gp
Wthrough magical means. 50gp Eld- SGoalmvee a probleDmesc(rmiptiinonor) 3gp Trade
lSoiwx svidaeldudeiceitemPut5fgivpe dTirceadineaCcuapttalned(rHollor-
irnitdcuhcBesanheauDnatrikhotnhfegsentwhwnyeooiimrurgll’dahivn,netyygmvoitusacaivwotreeneirdlnslcjsuuo1nsac0tcdtrgaeioropfssenstwand se, Cow, Pig) t3h0emgpouStoalftveer aagpoordobshlaekme.
Chromakul Thitshedyrairnekhosmweirtolsviwsitiotrhs ftrhoem (Major) 50gpWFheotecvherahnasittheemhig(hOeusttssciodres
colors of chromevaetriycwdarlakgofolnifse;. sIotmise lsikaeid village) 70gp wins.
to harness the abnreelavtehn woifned,raangdosnoms.e Yliokeu
tghaeihnaradc,cbeitstesr tsohoatsroafnKdilolamsjarbBrreeawt.hOnweeth-ing Cards Playing card games come in
eavpeoryno.n(eDenMjo’yss icshaogiocoed)g1a0m0e0. WgphoUd’otehsnm’ta
mKoinkdiloYsionug acfaenw csoepepebres tawndegeonldtphieecelisnfoersa many forms. Always popular
foefwrheoaulristyof. e5n0te%rtacinhmaennct?e of being able
FCohrestshe honesAtgfaomlke faormthoenaggeys.oHuo,ntehyiosur
to see into another Plane of existence would suffices.tBrautetgiIc wproowne’sts.see no bar-
G15am00esgapnd gambling offer a fantastic way to blow odbCfarhirbenicockknewtreshasarstroihomer yRetcoetroudiamurdoolridepnbplsvgoaonceikoern?nyntCtwaifhnnoeetryhilorliausjnugdseaeispmfctekaeort?lofabca.e
HNeinreeHaorlees somAenmanocrieentsguaimtaeb, bleutma geotohdods
off some steam and unwind. Perhaps you need for those whoonsee.e– nTroy ctoobmeaptrtohemtaivseer,nbinut
be warned, yothuisbqeutitcekranldeafuvnegtahmee.wit-
aPwayaymtoenpatssTthhee rtiemaerbeetnwueemn eguraorudsshwifatsy, sor nAersmsWesredstelead, oWranntotonteesattyoaulrl mifuyscoleus owr ant
nineewd ahsipcehedyyowuaycoafndopuabylinfgoyroyuroeuarrnginogosd. s to succeed. reaffirm your strength? Pull up
Tdpmaalihtcacaeceyts;yeihenopegthghtsabaemetorvhaseiersenidnacsntva,vrosnbala.vebideaSleueaeostlbiimaofmlbufeopel,rslt,eaoo,twsebmuoeosamhienunodgllceddoao.rmntnhtlayaalteeayplyspyeeoicvtlauyoerfvned
a chair and a worthy opponent!

“bTehewrei’lslainvegiletdomtyrsaticdisemttho athtemol’iggahmtbyle;fainstearry Subject to DEX check Showing him a
pnreomckisleaycoeu cyooulud ’bree10wpoeuanrdihnegavaierrowuitnh dsacykos ur
nofegcolkd ofnoyre’abcacoku. Oprlyeouocfoupldinhtasve. aAslwtheeot mugaihd , Dtriicsktr, aycotuinkgeeOpphpoisnaentttesn&tioCnhaesatyionug
i‘rfouannd yionunr akreme,pwehrilsht baesingaspo adrrutnikctuhlaat ryopurcaon-na
bseleetmhe ctahrdast‘fonree eyed’ seyseso. lIfvyionug’r,e aasnludckyyoaus a’rdeead steal the item you need (within reach)
arabcboitulipkelemyhsuelnf, ydoruemdigghot blde bploioedcyeinsg yseh’ worritsts on IYnoguamsenseoafkchdaoncwe,nnoitnevtehreyodneeapldayosfbyntihgeht
osofmtehpaootrmpunigtehr’tsyjawfi,ntaekiengxaplleyne’sciavnefraomlethyeobuar truolesst. eTaavlearnns ihtaevme a ystoruonng edreadw. oFnapkeionpgle
aloofkiginhgtt,oypolauy, cesapnecliualrlyeththosee itnhantkdeone’pt merind
w‘foarenyto,utshcoeotntocthheannecxte.”s are you can work achweaatyingfrtoominctrehaesebtaheri.r Icfhahnicseskaetywsinanriengo. nIn
hfaicst, psoemrseoanre,nsontoaritocuhslythcuenmni.nRg,ehqauviinrginspgent
something out. yyeoaurs hmaavsteertinhgiethveeasrttoofodlesc,eyptoioun.attempt
tUosupalilcykthtehire‘tlroicckks .ofStuhbe jteracdte’torelCyHonRhcighheck
~ Jai Rickard, Blacksmith from The Quiet Isles. CHhaanrisdmina,gBlauflfe, totreDrextotertihtye(GinMn’skcehoeipcee).r,
yInovuersteelyll, Hheirmoesthmeayloalcsoalatmtemayptocrh/ebaatirnogntheir
wreaqy utoevsitcstohryi.s presence. You call him

o♦u♦ tD  mistoraccktining ganaopvpoonicenet woifthhtihseastreicrsvant
or maid. A member of your party or
y♦o♦uD  resmealfndaetvteermyonpetpslatyowpithetrhseuparidzeemhoinmey.on
Thrtehae ttaebnleinsogyoourcatnrgyrianbgit atnodirnuntimidate

h♦i♦m PlYacoeua waatttcehmer bpethitnod aunsoeppfoankenet tghoatld pie-
ces.diSscurebtejelycstigtnoalsShTisRcacrdhseck You attack

th♦♦e Riing nthkeereespuletsrb.yYuosiungma laoandaedgdeieto knock
the innkeeper out so hard they don’t
re♦♦caD  lrlinaknaypothtioinntgo.gIafiniatniesdgae loovecrky,ouarnd
theoipnpnonkeentesper is away, you break the

c♦h♦aB inrib. eIann aopdpoinsepnltatoydoelfibsertarteelnygmtahke, myiostuakes
crusanhd alosceup, to intimidate the inn-

keeper If there is a guard you subdue

59

The possibilities are as endless as they are Extraordinary Games
devious. Swindlers never cease to amaze
at inventing new ways to cheat. Distracted Cards, dice and drinking games
characters might find their purses quite a little bit are commonplace in taverns,
lighter at the end of the evening. but some games are only found
in certain places, played by
d20 Cheating Attempts locals and passed on through
the generations. A few are even
1 A pair of loaded dice. One always lands on dangerous and illicit; those participating risk a
20, the other on 1. run-in with the local law, unless they paid the
innkeeper to look the other way.
2 Slipping cards up your sleeve to replace it
with another. Trollbones

3 A discreetly placed watcher signals your Usually played on a carved wooden playing board
opponents' cards to you. divided into eight triangular sections, Trollbones
is a simple, yet addictive game that requires only
4 Use a spell one or more opponents to 4 small twigs or bones to play. Any number of
befuddle them. contestant can participate, making it suitable
for groups. Although some believe otherwise
5 Bribe an opponent to make deliberate (especially after a few pints), Trollbones requires
mistakes and lose. almost no skill and is largely luck-based.

6 Use cleverly marked cards. The playing board: Trollbones is played on

7 Slip a mild poison into the drink of one or a square board, commonly made of wood and
more opponents. divided in eight triangular sections. Six sections
have a number carved into them, one section a
8 Charm the dealer of the game to play in sun, and one section a moon. Rabbit or chicken
your favor. bones are the common player pieces. Carved ivory
or twigs are adequate substitutes. Whatever is
9 Grab an extra coin or two whenever you used, all contestants play with the same set for
legitimately take money from the bank. the entire game.

10 Accidentally drop a card on the floor.
Replace it with another as you pick it up.

11 Play with fake coinage.

12 Slide dice instead of rolling them.

13 Cause a fight. While everyone is
distracted, you walk away with the prize
money.

14 An enchanted pet bird flies around the
room spotting opponents cards, tweeting
them out in joyful tones.

15 Pray to your god to boost your luck.

16 A trained rat walks around, bringing back
clues, or nudges your opponent's pawns.

17 Intimidate your opponent to make him
doubt a result or challenge the outcome.

18 Use a spell or charm to stealthily change
to color of pawns.

19 Feign illness. As you slam into the table
and drop to the floor, covertly grabbing
some prize money with you.

20 Make deliberate misplays. When called
out, you pretend to misunderstand the
rules.

60

The rules: Players take 3 turns, one at a time, The rules: A coin toss decides who starts as

moving clockwise around the board. Each turn is the attacking player. The other defends. On his
made up of 3 throws in which players take their turn, the attacking player roles a d4 to score a
4 “bones” and let them drop onto the playing
board from a hand-height. Players hold the hit against one of the pieces of wall (or mountain
bones at least 6” above the board and drop them, range) damaging it and taking points off it
attempting to land the ends onto the marked equal to the scored result. A score of 4 or higher
spaces. The results are added up for the total removes that piece of wall, allowing pawns to
score that turn. For example: a bone has one end start moving through. The attacking player may
touching the number 1, the other touching the choose which part of the wall it hits, as long as
number 4, making a score of 5. Both ends of the he has a pawn directly in front of it. On his turn,
bone must rest on a number or specific symbol the defending player makes the same roll, but can
in order to score points. If one of the ends lands use the score to repair a piece of the wall. Once
on a moon symbol and the other on a number, a breach in the wall has been made, each player
the score of that throw is doubled. If one of the can choose (on their turn) to move one pawn to
ends lands on a sun symbol, the throw results in a the other side of the board, by rolling the die. The
score of zero regardless of the other bones’ result, result determines how many squares the pawn
suggesting the sun has turned the troll bones into may move. A move is only allowed when a pawn
stone. ends on an empty square. If it does and passes an
opponent’s pawn this way, it kills the pawn in the
Winning: Each player has 3 throws per turn, process. Diagonal moves are allowed.

before continuing to the next player. When all Winning: The winner is determined by whoever
turns have finished, scores are totaled. The player
with the highest score wins. has the most pawns on the last square line of the
opponent’s board, minus any casualties. The game
Different variations on the game exist, and each ends when there are no more pawns are on the
group uses different ways to wager and ante, such board, or all remaining pawns have reached the
as letting the prize pot grow over many rounds, last row of the opponent’s side.
culminating in a grand “take-it-all” last round.

The Wall

This game is played on a rectangular gaming
board, using wooden, colored pawns and a set of
4-sided dice. One player attempts to break down
the wall and rush his pawns to the other side,
while the other player attempts to defend and
rebuild the wall.

The playing board: The game is played on a

board divided in two halves, each made up of 18
squares with a row of 6 squares running across
the middle. Six four-sided dice rest on this
middle row, which is usually colored or etched
to represent a wall or mountain range dividing
the two sides. Each player has 12 pawns (colored
stones or marbles are also used) to represent their
soldiers or miners deployed on their side of the
wall, leaving the last row of squares on each side
empty at the start of the game.

61

The King’s Court

Composed of twelve hinged sections bedecked
with ornate imagery, a large wheel has a hidden
king’s court underneath it. Spin it, and lift up
the wedge where the arrow lands - reveal the
king and win 50gp, but lose 50gp if you discover
the jester. Any other member of royalty wins
the player 5gp. Popular in royal circles, many sit
gathered around the brightly painted roulette
wheel, betting heavily.

Golden Mermaid

A self-proclaimed pirate with a false eye patch
convinces you and your party to find the tankard
with the golden mermaid at its bottom out of the
thirty tankards before you. To do so, you must
finish off each full flagon. Whoever finds the
mermaid first can pick a prize from the pirate’s
chest. The chest appears to be full of antique
treasures and shiny gems, though you can’t be
certain whether they are of any real worth...

Runestones

In a shadowy corner lit by a single flickering
candle, a shrouded Vistana sits alone. The
innkeeper tells you that this is Vienna. She
recently set up shop, and for the bargain price
of 10gp you can have a five-minute conversation
with her. As you reach her table, she asks for your
name and gestures you to place your coins onto a
silver plate. You are instantly overwhelmed by her
perfume: incense and myrrh. She pulls out a velvet
bag of charmed runestones and shakes them in a
cup. She instructs you to think of a question that
can be answered with a “yes” or “no”. After you
tell her you have thought of the question, she will
empty the stones onto the table, and tell you if
they indicate “yes” or “no”.

62

Songs & Tales Incorporate songs and tales into your campaign:

Mythical songs and tales of ♦♦  The bard or another hero in your party can
distant lands are the only perform to gain the innkeeper’s favor
encounter common folk have
with the fantastical. News ♦♦ P  erformances that please the crowd, make the
from neighboring lands or a innkeeper share more valuable information
new royal decree arrives to
common ears on the flowery words of traveling ♦♦ U  se tales to goad other adventurers into helping
troubadours. Beyond simply reporting the your adventuring party.
latest tidings, songs and tales provide jolly
entertainment, or political satire. Those who can ♦♦ a  bard sings a particularly good rendition of one
spin a great tale or pluck the heartstrings with a of the songs, the local king’s vassal takes notice.
ballad are welcome guests in taverns.
♦♦  Telling a thrilling story might gain the attention
Those looking to unravel arcane mysteries can of certain characters you want to lure out
often find pieces of truth in song and tale. Clues
to ancient treasures are often weaved into the old ♦♦ S  inging a certain song or reciting a rhyme could
words; the cursed faith of the fallen warrior or the open up a portal or secret door within the inn.
power of a magical artifact is revealed in lyrical
detail. Listen closely. There is no telling what you ♦♦ S  ome tales contain hidden clues of secret
might uncover. treasure; talking about it attracts those who more

“The shadowed hills, they speak to us Quilla’s Favored Songs & Tales
With voices light like emerald dust.
They tell of tales and heroes gone; During her travels around the world, Quilla
Wars lost and battles won. Bladesong annotated the music of each village,
They yearn to see the sun again, people, or kingdom she discovered in a small,
To free their souls and die as men. leather-bound journal. Although a warrior at
And so they wait for the day heart, Quilla inherited a deep love for lyrical
Where they arise from their clay.” expression from her Elven father. She discovered
these jolly chanties served a higher purpose than
~ The Shadowed Hills ~ to entertain. Many contained morsels of truth,
ancient song of unknown origin ancient wisdom for those who would hear it.

The following pages contain several songs and
tales Quilla found to contain a deeper meaning.
To discover what exactly, one would have to delve
into its mysteries, or seek out Quilla herself...

63

N The Ghost Of Hileard Hall PThe Siege On Krykk Castle

A voice echoes through the walls, In the darkest ages, before man and beast,
Tis’ the ghost of Hileard Hall. there was once a king, who knew no defeat.
Many men have tried to flee, For every battle he won, his domain grew larger.
But when it comes, an’ catches ye’ For every man that he killed, his heart was hardened.
Not a soul can escape, He soon grew tired of his kingdom’s expanse.
Not a life will be saved, With treacherous greed he demanded more land.
O, beware the ghost!
Dreaded wraith of eternal woe. All manner of ruin and pain and horror
Were inflicted on those below his honour.
N It Comes For All Peasants, lords and other kings,
bowed for him like underlings.
Pouring water falls and falls, Mankind screamed and desperately sung
over houses, rich and poor. for the aid of Elves, before they came undone.
Winds blow fierce and raw,
through thieves and priests The Council answered and acted in haste,
to men of law. for Cilathion the Righteous would not
Fires burn hot as hell, stand for such hate.
killing those who dare to help. With armies strong he fought the king back
There’s no danger like Mother Earth to his dreadful Krykk Castle, atop mountains black
pulling her children back to the dirt. And with his swift action and mighty stride
Cilathion began his siege to restore man’s pride.
N The Weeping River
For seven days and nights, the Elves did all they could
Bow to no man he had said But still unharmed, the silent Krykk stood
Told ‘em he won’t move So the Council made way in returning law to the land,
And when the lord ordered his head condemned the king to starve for his cruelty to man.
The man had slain the room Abandoned and accursed, Krykk Castle stands unlit
And to his home he did retreat haunted by an evil king still paying for his sins.
Armies at his tail
All they knew was to chase him down PThe Gems of Yakuzi
Not the trap that he had veiled
Betwixt the river they all drowned Abandoned by his family at a tender age, Cilathion
And forever the water would weep was raised by a woman who worked in a tavern across
Betwixt the river that made no sound the Daemon Gulch, far away from where he wanted
Save the echoes of soldier’s screams to be. The young elf was tasked with scrubbing the
inn from floorboards to ceiling planks. Many a night
N The Oarless Boat he would often clean the blood spilt from dwarven
brawls, swab the ale soaked into the floors, and empty
A fiery boat, a pyre afloat the overflowing latrines. For this grueling work, he
The only way to go. barely made a silver coin. His meals were meager and
A bow in hand, to kill a man, the boy was thin and weak, and the drunken patrons
The only things I own. would tease and taunt his small stature. Nevertheless,
Gold and jewels and nothing to lose he pressed on, laboring night and day, wishing for a
Tis’ the life that I will choose. life that offered more. Mercenaries and the like, from
An oarless boat, a pyre afloat, all walks of life stopped at the tavern. Battle-weary
This is the way I will go. dwarves, treasure-hunting orcs, and lone Dragonborn,
cloaked and silent, passed through and shared their
64

stories. These tales of the world outside, searching As he entered, the guard had been woken and instead
the depths of cavernous mines for gold and dueling of an empty room it was full of men, and The Great
enemies in foreign kingdoms, held Cilathion in rapture. Yakuzi himself. He began to speak, loud and grisly.
The paths they lead called out to him, and he yearned “There’s the adventurous young elf, in all his
for his chance to make his name known. mischievous flair, Godfrei, seize that which does not
belong to him.”
One night, as the customers began to leave and the The guard snatched his keys, the Gem, and the gold in
tables were cleared, he heard a group, whispering to his pocket, and hit the elf for good measure. Cilathion
each other with a knowing gleam in their eyes. After bent over coughing, and The Great Yakuzi began again,
brandishing their loot and downing tankard after with his loud chthonic voice.
tankard, they spoke of a coveted gem with a guard of
some sort. Cilathion leaned close, hoping their drunken “We will take your Mother and show you how it feels
mouths slurred more secret spoils, but all he heard was: to have something stolen, boy.”
“The Gem of Yakuzi”. ‘The Great Yakuzi, as he is called, Before stomping out, he leaned into his face, breathing
was a well-known traveler who left his swashbuckling his stinking breath.
style behind to lead a more domestic life. He invested “I’m doing you a kindness boy, you need to learn”,
in the trips out into the wilderness, and kept the best He said, smirking slightly. “Actions have their
of the spoils. Cilanthion realised, the guard must of consequences”
been one of Yakuzi’s, for he began telling of his vault, The Great Yakuzi then left, leaving the boy alone in the
rumored to hold grand swords encrusted with flawless inn.
diamonds and goblets rimmed in sapphire, but none,
apparently, could be compared to the mystic Gem. The Cilathion found himself the object of ridicule, for he
precious stone had the power to grant the wish to those was again working back at the Tavern and penniless,
pure of heart. That was all Cilathion needed to hear - but he was now without the kind woman who took him
he knew he needed the Gem. in. He sought to get that Gem now; not just for fortune,
but to right his wrong. He decided he wouldn’t need
All night he tried lifting the key off the guard, to no the cover of night and that he would face this foe in the
avail. A turn in fate, however had granted him fortune, bare naked light. He went to leave the Tavern and he
for the guard collapsed in a drunken stupor, and was stopped by a group of travellers, the same from
with no one about he knew this was the moment. He the very night he tried to steal the Gem, they must of
snatched the key, and he hurriedly done the rest of his wanted the room before Cilanthion even knew.
work. He made his way over across the village whilst
his mother slept, and as he approached the door he “We shall help you”, said the dragonborn, “Together
entered and closed with such dexterity it was though we will save your mother.”
he were nothing but a mouse. Inside, he couldn’t Cilathion, now armed and ready ran to The Great
believe his eyes. A massive room, spread out vast, with Yakuzi’s treasure room. As they approached, the now
bountiful gold almost ocean-like, littered here and heavily guarded area began to attack them - but
there with crates of gems and rubies and all manner Cilathion’s new friends distracted them, and told him:
of treasure. But one stuck out amongst the golden sea. “Go, run to the room!”
A pink Gem. He ran to it and grabbed it and all in one
moment shouted, “I want to be rich!” But was met with There, awaiting him was the Yakuzi, as though he
silence. Cilathion was perplexed, for the quiet Gem only expected him, and locked in a cage next to him was his
twinkled in reply. He had so readily accepted fortune. Mother.
Disappointed, Cilathion headed back with gold and
gem in hand. “Boy, I’m glad you came to see the finest treasure of
all.” Cilathion was silent, walking slowly toward him.

“Don’t I frighten you boy?”
He need not reply, for these fiendish taunts did not
work, and just at this moment, the dragonborn had
broken the door in, brandishing his staff and casting
fire to the room.

65

“What insolence brought you all here? Is it folly? Or is The townspeople had always feared the depths of the
it a desire for death?” woods, for stories had echoed through the ages of a
Cilathion broke his silence. deep lurking horror that slumbered within. The forest
was not theirs. Their ancestral tales told of The Faceless
“Neither, it is righteousness you rotten toad.” Men of Wyt, to whom the forest truly belonged. The
The Great Yakuzi, with his heaving mass ran now in more superstitious elders of Dhulmin tried warning
full charge, swinging his scimitars at Cilathion. The King Dirinisus’ men of this occultist movement, they
dragonborn, knocked Cilathion away from the fight explained the utter abhorrence of their order, their
and out of harm’s way with a gust of air, and continued monstrous experimentations on man and all kind, their
fighting. He began shouting at Cilathion: absence of morality and complete indifference in the
face of death; this did not worry or stall the men, and
“This is not your quarrel, a man like you will be they continued on relentlessly. Until a guard, roaming
needed some day.” the edge of the wood one night was snatched by what
He waved his hands, unlocking his Mother’s chains. could have been the shadows themselves. The men

“Go”, he shouted. “Go!” said that all they seen was the bone-white of a mask,
floating in that dreaded darkness.
Cilathion ran and grabbed his mother and the
Gem and with honour in his heart, he told More of the men began raiding the woods, trying
the Gem: “Take me and my Mother, so that to ignite the enchanted trees and destroy this
we can fight another day.” shrine of death and horror. They wished this
With a flash of light, they were gone. menace gone. They, however, encountered
no resistance. It was though these beings
PThe Faceless Men of Wyt could melt into the very dark that
encompassed the wood. They alluded the
In the dense, sickening forests, past the attacks, and for a moment all was still.
ever silent Krykk, a small village once Until the encampment left to defend
laid nestled between the trees, known by the Krykk, that was when Dhulmin
the villagers as Dhulmin Dhulmin. It was suffered. The Faceless Men of Wyt,
a quaint, quiet place that began to profit floated across the barren wood like
from the exploits King Darinisus, for his wraiths - they approached swift and
constant warring required a constant weightless, like a blighted breeze blowing
supply of lumber. toward Dhulmin. There were no sounds,
except a singular scream, cutting through the
The woodcutters of Dhulmin continued to
cut away at the darkening timberland, shining more deafening silence. Even the stars turned from this
and more light on it’s mysterious countryside. To their monstrous night.
horror, the workers began finding dark, evil things in
the newly fresh ground. Strange objects of ill-intent When daylight broke, so did the attack, and those
and lost arcane properties. First in their discoveries who were left came out now to the sound of galloping
were mauled critters, cut in curious, unnatural ways. horses. Cilathion and his Council had arrived. The
As more land became bare, the unmistakable rank town of Dhulmin told them all, and in disbelief they
of death hung over all. Hunters came back from wandered out across the dead fields to the edge of the
their treks empty handed, livestock disappeared, the forest. Cilathion entered into that distressing darkness
sighting of even a fly became a rarity. Nights passed a brave soul, and only moments later, came cowering
and soon even the bigger, more benign beasts were into the light. He ordered the removal and destruction
found, maimed and covered in strange markings. The of that dreaded forest, and the town of Dhulmin could
townsfolk took this as an omen, a warning from the rest once more, knowing this strange dark threat was
horrors within this uncharted forest to keep away, lost in hellfire, in the hope it never rises again.
but King Darinisus’ men demanded more wood; so
onwards they went.

66

Duels & Bar Fights d20 Bar fight triggers
1
When arguments get heated or 2 A man's backpack goes missing and
a game ends badly, bar fights 3 immediately blames you.
flare up, plunging a tavern 4
into chaos. When bottles start A delirious patron believes he’s a dog and
whizzing through the air, 5 tries to gnaw on your leg.
most innkeepers are unfazed, 6
having seen more brawls than most innkeepers 7 You're mistaken for someone else; a
are unfazed. It’s just another night at the bar. If 8 tiefling is convinced you stole his wife.
things begin spiraling out of control, they step
in an attempt to break up the dispute, calling on 9 A small group harasses a young boy and
a few guards or broad-shouldered regulars to begins to push him around. You decide to
remove the troublemakers. 10 aid the boy.

Most patrons come to taverns to listen to the 11 A person at the table next to you loudly
latest gossip, or to enjoy a bard’s humorous songs 12 insults your race.
ridiculing the king. Others, revel in the prospect 13
of a good fight, and are simply out to start one, 14 You meet the gaze of another and they
arguing you need no reason at all. When your 15 immediately draw their weapon.
hero’s visit a tavern they may find it doesn’t take 16
much to get caught in the middle of a quarrel. Seeing that you are an adventurer, a man
17 challenges you to a duel.
“There’s bound to be a fight, don’t mistake that, 18
the best way to prepare is to pick up the signs. I’ve 19 A patron reveals a charmed sacrificial
always found, keeping a weary eye over at the lads 20 blade. He exclaims, “You are needed!” as
playing cards is good. One bad hand, an you’ll see ‘em he charges at you.
unsheathing their blades and daggers and its just a
heap of mess. Those blasted sorcerer’s you gotta’ watch Four men at the table next to you begin
as well, they got raw energy you see, swirling in their to brawl. You notice their packs are left
tummies like bad ale, they gotta’ spew it up some unattended.
time - and when they do you wanna’ watch yourself,
otherwise you’ll be the next charred steak on the menu A pungent odor fills the room. If you
tonight laddie...” comment on it in any way, a half-orc
punches you in the chest.
~ Eyron Doon, bounty hunter from the Celiousi Plains
You accidentally break a precious vase,
enraging the innkeeper.

A mage is angered by your presence, and
a magic battle ensues.

You speak too loud (no matter how quiet
you are) and everyone scowls at you.

Every time you take a drink, a mad dwarf
yells profanities and throws plates at you.

A beggar curses you if you do not give
him coin.

You are threatened by a sorcerer if you
look in a particular direction toward the
back. (GM discretion)

You fail to pay respect to the shrine in the
corner, causing a riot.

A wealthy noble mocks you

The barkeep’s hound snarls and barks at
you, causing the bar staff to interrogate.

Angry drunks attempt to rob you.

For more ideas, check the Unfortunate Events table
in the Security chapter.

67

Creating Epic Brawls d50 50 events for your bar fight

The most important aspect of creating a 1 A ship’s anchor comes crashing down
memorable bar fight is establishing the underlying from the wall.
motives behind the NPC’s actions. The brawl
itself (while exciting) is not the main event, but 2 Your adversary runs across tables to
rather a natural crossroads in the story. Rescuing escape.
a barmaid from a disgruntled lover threatening
to set the tavern ablaze creates high stakes and 3 An intimidating scoundrel pins your sleeve
emotion. Lawful characters find themselves to the table with a dagger.
morally obliged to take on quests involving the
restoration of honor or saving the realm from cult 4 The fishnets from the ceiling come
activity. Should a wayfarer become an obstacle, he undone, entangling you.
or she will need to be properly humbled.
5 A censer topples over. Billowing smoke
NPC motivations can include: obscures sight in the candlelit room.

♦♦ R  evenge 6 You get pushed into stacks of pottery, and
lose your footing.
♦♦ S  ettling a dispute
7 A window shatters, sending shards of
♦♦  Win back a lover glass through the air.

♦♦  Bully / Intimidate 8 A rogue takes a servant hostage, holding a
dagger against her neck.
♦♦  Wrong an injustice
9 One of the servants grabs you from
♦♦  Distract behind, in an attempt to restrain you.

You can use the events in the previous table 10 The innkeeper sends his dogs in to attack
to serve as inspiration to create a trigger and
narrative. Orchestrate the event with a d50 roll, or 11 A plate of fruit gets thrown at you, apples
randomly select actions for your NPC’s to perform roll around causing unsteady footing.
from the following table.
12 An aggravated regular throws a chair at
you.

13 A caravan trader smashes his chair, and
then threatens you with a shattered
wooden stake.

14 You enraged the cook by insulting
her food. She bursts from the kitchen
throwing pots and utensils at you.

15 A barrel of fish topples over onto your
opponent.

16 Your adversary challenges you to a dance
off

17 A disgruntled town guard swings the
cauldron from the fireplace your way.

18 The dwarf you beat at cards rips the tusks
from the boar trophy and threatens to
mount your head on the wall.

19 Bed linen gets drenched in oil and set
ablaze.

68

20 You spill beer over an artisans drawing. 44 Your adversary cuts loose a stack of kegs,
He grabs a sailboat model from the sending them rolling.
windowsill and throws it at you.
45 The innkeeper slams the face of a
21 You slip on spilled ale, and land in the troublemaker against the bar.
bosom of an irritated barmaid.
46 Your attacker jumps up from behind the
22 Your opponent lunges forward to bite you. bar, throwing knives.
23 War hounds are released on you.
24 A crowd cheers and closes in around you. 47 Livestock run amok through the crowd.
25 The other throws a flaming bottle in your
48 The opposition pushes haystacks down on
direction. top of you from upstairs.
26 Rowdy patrons place bets on you and your
49 Your adversary sets fire to a large tapestry
opponent. hanging from the wall.
27 Drinks are offered to the winner.
28 Your opponent swings for your face while 50 An adversary slides down the staircase
rail.
his friend attempts to hold you back.
30 The music becomes intense and exciting

as your scrimmage begins.
31 Mishearing your words, a local lady is

provoked and throws her drink at you.
32 A drunkard on the streets crashes into

the tavern through the window, onto your
table
33 The innkeeper joins in to defend you,
offering bucklers made from keg lids.
34 Hot honey is poured on you and your
enemies from above.
35 Your foe’s clothing snags on a piece of
furniture. He is momentarily stuck.
36 The floorboards cave in.
37 Guards rush in to quell the fight.
38 Your enemy charges at you with a
mounted stag head.
39 Another guest tries to carry your opponent
out of the inn.
40 The innkeeper throws a handful of gold
coins into the crowd.
41 A bandit swings on a chandelier, trying to
knock you over
42 An adversary yanks a ceremonial shield
and axe from the wall and roars at you.
43 Racks of liquor go up in flames.

69

Section 3

OCrwenatIinngn Your



qCREATING Structure & Location
YOUR OWN
INN To determine what the core of your building is
made of, you can use the following table, or invent
You’ve challenged your heroes to your own.
smite mighty dragons, or restore
honor to the realm. You’ve crafted d10 Structure Location
backstories and monsters, guilds 1 Logs Forest
and maps to parts unknown. Why 2 Straw City
not create your own tavern – the 3 Waddle & Daub Hovel
heart and soul of the adventurer’s journey? 4 Snow/Ice Mountain
5 Clay & Brick Riverside
Your players will love discovering interesting new 6 Lime Mortar Desert
places, and if done right, they’ll want to return 7 Basalt Island
to these locations again and again. This section 8 Granite Harbor
covers everything you need to create your own 9 Glass Floating
inn, populate it, and bring it to life. You can pick 10 Sandstone Oasis
and choose from the various tables, or roll a
random result.

Once you are done, find a great name for your
newly created inn and drop it into your world for
your players to discover!

72

Unusual Locations d20 Tavern Name Generator
1
Looking to go a little bit more unusual? Roll a 2 The Lonely Mare
result from the table below or handpick a result 3
you like. An extraordinary location will make your 4 The Midnight Raven
tavern more memorable. Not every inn needs to be 5
hanging from a snowy cliff or the back of a giant 6 The Vigilant Knight
turtle, but don’t be shy and infuse a little magic 7
into your tavern creation. 8 The Hidden Maiden
9
10 The Blushing Solstice
11
12 The Queen’s Dagger
13
d20 Unusual Locations 14 The Somber Watchmen
1 Underwater 15
2 On a snowy mountain peak 16 The Toadstool Axe
3 Hanging from a cliffside 17
4 Floating in the sky 18 The Blazing Rose
5 Behind a giant waterfall 19
6 On a remote ice flat 20 The Forked River
7 Amidst a dreary marsh
8 Inside a permanent illusion The Black Ivy
9 Deep within a cavernous city
10 Atop a shambling titan The King’s Stallion
11 Amidst a planar rift
12 In the depths of an undead city The Shining Moon
13 Spanning a rushing river
14 On a barren mountain peak The Harp & Vine
15 Hidden in a misty jungle
16 Suspended between treetops The Waning Crown
17 In the eye of a magical storm
18 Encrusted into a volcano The Horned Roost
19 In the belly of a giant sea drake
20 Floating amidst the clouds The Dragon’s Stag

The Carriage and Fox

The Golden Duke

The Malt Oak

73

Inn Characteristics

d20 Operations Frequented by

1 Regular Inn Common folk

2 Gambler’s Den Thieves, Assassins, Thugs

3 Postal Stop Messengers, Rogues, Adventurers

4 Guilds House Merchants, Tradesmen, Blacksmiths, Weapons Instructors, Sell Swords,
Alchemists

5 Royal High Elven council members, Nobles

6 Seaside Market Fishermen, Shipwrights, Smugglers, Guides, Oarsmen, Crabbers

7 Trader’s Stop Merchants, Shop Owners, Farmers, Alchemists, Armorers,

8 Wizard’s Meeting Sorcerers, Warlocks, Potion makers, Alchemists, Witches, Traders of the
Arcane

9 Smugglers' Hideout Thieves, Smugglers, Rogues, Assassins

10 Bandit Syndicate Paid Thugs, Crime Lords, Mercenaries

11 Druids Convergence Alchemists, Warlocks, Druids, Half-lings, Potion makers, Traders of the
Arcane

12 Rumor Mill Homeless, Information Traders, Tradesmen, Thieves, Rogues

13 Exclusive Tavern Nobles, Opulent Travelers, High Elves

14 Magical Wizards, Sorcerers, Druids, Adventurers

15 Artistic Painters, Bards, Poets, Musicians

16 A Guild Traders, Fighters, Merchants, Thieves, Mages

17 Holy Commune Followers, Priests, Skeptics

18 Covert / Facade Thieves, Assassins, Thugs

19 Charity Donors, Volunteers, Peasants

20 Pilgrim’s Respite Priests, Clerics, Servants, Beggars

74

Decorating Your Inn 100 Memorable Things To
Characterize Your Tavern
Once you have decided your structure and location,
stock your tavern with furniture and one or two By giving your tavern one unique, defining trait, it
unique features. Choose one truly memorable becomes something more than a place to rest for
characteristic, such as a magical mirror that the night. Use the following table to roll or choose
insults visitors as they cross the doorstep. a memorable feature to make your tavern truly
remarkable.

d10 Furniture d100 Memorable Things
1 Common wooden tables & chairs 1
2 Oaken bar with large kegs line the walls 2 A cat at the bar is speaking your
3 Large wrought iron fireplace 3 language.
4 Stone fireplace shaped as a lion’s mouth 4
5 Large tapestries depict magical beasts 5 The beer is tainted with gypsy blood.
6 Refectory tables and benches 6
7 Stained glass windows and potted plants 7 Two gaunt barmaids challenge patrons
8 Carvings of dragon heads on all woodwork 8 in arm wrestling and always win.
9 Bookcases with ancient tomes everywhere 9
10 Low round tables with cushioned stools 10 Squeaky floorboards sound weirdly like
11 small children.
d20 Atmosphere Smell 12
1 Lively Hearth fire 13 The spittoon burps loudly each time it is
2 Clandestine Dank 14 used.
3 Homely Apple pie
4 Unwelcoming Mud 15 Doors open as if by magic, greeting you
5 Holy Incense 16 in welcome or bidding you goodbye.
6 Rural Hay 17
7 Mysterious Herbs The blind orc sitting in the corner never
8 Tense Urine moves.
9 Seafaring Salty Brine
10 Downtrodden Moldy In every room there is the illusion of a
11 Organized Lavender sun and a light breeze.
12 Royal Perfume
13 Boisterous Smoked Fish A large collection of seashells hangs
14 Magical Myrrh from the ceiling.
15 Artistic Paint, Dye
16 Festive Fireworks All the occupants are dead.
17 Volatile Sweaty
18 Unpleasant Rotted Flesh Every wall has a portrait of the
19 Newly built Woodsy innkeeper in various poses.
20 Cursed Sulfur
The tables talk back at you.

The walls are lined with aging cheeses
on wooden racks.

A marble fireplace burns with green
flames that create mesmerizing musical
tones.

Hundreds of cages with chattering birds
hang from the ceiling and walls.

A checkered floor with words engraved
in every ancient language.

An hourglass filled with green smoke.
Once turned, time stands still for an
hour.

75

18 A skull on the mantelpiece cackles and 36 A gigantic, ancient seashell filled with
makes snide remarks. hot water rests in the center of the inn.

19 The remains of past proprietors are 37 Chickens and pigs scuttle around
embalmed and on display in glass indoors, hay strewn about.
cabinets.
38 Dozens of owls rest on little ledges in the
20 Colorful paper lanterns float quietly ceiling. Occasionally, one flutters down
underneath the ceiling. to snatch a bone from one of the tables.

21 A giant dog with one albino eyes gnaws a 39 Flames in the fireplace take the form of
troll bone. your beloved.

22 The spirit of a slain vampire haunts the 40 Hundreds of shriveled heads sit in glass
guestrooms. jars filled with liquid.

23 Old books and manuscripts are used as 41 The fire sometimes speaks in tongues to
kindling. you.

24 The walls are stacked with models of 42 All the glasses scream when they are
sailing ships in all sizes. chinked.

25 A tiny music box on the fireplace mantle 43 There is an illusion in the corner that is
plays enchanting tunes. telling of an epic story, entertaining the
patrons.
26 Dozens of copper statues, depicting
archers, line the cross beams. 44 The cattle are paraded through the
inn, under a spell, which forces them to
27 A large tree grows in the center of the advertise themselves to potential buyers.
tavern, its branches reaching out across
the entire space. 45 There are wails and screams all around,
and no one is wise to it except you.
28 Slowly churning, a giant metal sculpture
in the center of the inn depicts planets 46 At noon, the tables and chairs magically
in orbit. move to the sides of the room; guests
dance to an entrancing, self-playing
29 A scruffy looking parrot sits in an harp.
alcove, but never makes a sound.
47 The inn is constantly moving; you could
30 White ribbons with garlic are tied to the enter in one village, and leave at the
legs of every other table. next.

31 The gold and silver armor of a revered 48 The walls are dyed blood red, and
fallen warrior adorns the wall behind everyone wears tight leather.
the tap.
49 The bar appears upside down, whilst the
32 The walls and ceilings are adorned with seating area and its occupants remain
engraved stone tablets displaying holy upright.
writings.
50 The bar staff are destined to walk
33 A large, worn, embroidered banner backward forever by a wizard they
depicts a fierce battle between horsemen denied entry to.
and an elemental.
51 Everyone is afraid of any word
34 The skeleton of a whale hangs suspended pertaining to drinks, food, or lodgings.
from the ceiling. They use hand gestures instead.

35 Thousands of feather and bone dream 52 You enter to see that there is a singular
catchers adorn the wooden beams of the drink on the table. You must drink the
tavern. exact amount required to gain entrance.

76

53 Everyone expects a round of ale from 73 Beers talk to you, wine spits at you, and
newcomers; if you fail to do this you are the food shouts at you.
attacked.
74 If you enter at night, everyone is wearing
54 If you are dressed in black, you are given their nightgowns.
a free drink.
75 A masquerade ball breaks out every time
55 The inn has shrines dedicated to every someone shouts, "Felix Gamouche".
musical instrument.
76 Miniature guillotines are used to cut the
56 Green ooze leaks from the floorboards. meat.
No one seems to mind.
77 The mirror reflects everything that
57 Every drink is charmed to smile at you happened 5 minutes ago.
while you drink it.
78 A dust storm happens every 20 minutes.
58 A magical music box plays a soft melodic 79 The inside of the tavern appears as if
to fight off evil wraiths.
underwater, fish swimming past as you
59 The male patron seems to flirt with enter.
everyone. 80 An ancient god now owns the lodge. Your
drinks materialize before you, without
60 An old man invites you to drink with anyone taking your order.
him, so that he can tell you to go away. 81 Everything shines like gold.
82 A stream runs through the inn.
61 Each painting beckons you closer, but 83 There are hot baths plotted around the
when you approach it, the innkeeper room and a patron insists you get one.
tells you it's cursed. 84 An ancient order of monks in a bard
quartet entertains the guests.
62 Crows often fly in to get themselves a 85 The food is prepared in another
drink of wine. dimension, possessing otherworldly
qualities.
63 Everyone sits on the floor with their legs 86 During full moon, the ghosts of deceased
crossed. patrons appear, seated in their favorite
spots.
64 You must kiss a long sword upon entry. 87 Twins who swap bodies from time to
time run the tavern.
65 A talking tree is your innkeeper. He 88 There is a cellar that blows a warm air
serves you drinks with long, flexible into the inn.
branches. 89 It's so loud in the inn that you have to
mime what you want.
66 Your innkeeper is actually the king. He 90 A sword called Eclipse hovers about and
likes to work with the locals. whistles.
91 Knights and their horses always try to
67 A board with contracts and jobs always get in, even though they struggle to
has your names on it, detailing your leave.
activities. 92 Ancient spirits float through the tavern
93 Silk covers every inch of the room; it is
68 A phoenix serves everyone's refills. the comfiest inn you know.

69 You must think your orders and 77
conversations because the telepathic
innkeeper hates noise.

70 The seats sigh sadly when you sit upon
them.

71 A talking parrot continually insults your
group.

72 The tavern feels hot to you, but everyone
else is cold.

94 There are cattle in the corner laughing d20 Personality Appearance
and drinking. 1
2 Blunt Rough looking
95 All furniture is painted gold. Hundreds 3
of small stone cherubs dangle from the 4 Ominous Long dark hair
ceiling 5
6 Kindhearted Missing fingers
96 The kindest and friendliest innkeepers 7
you’ve ever met greet you. 8 Enthusiastic Constantly smiling
9
97 To prove you are a man, you must eat a 10 Mysterious Gap tooth
cow's liver raw. 11
12 Sarcastic Missing an arm
98 The innkeeper tells you the same joke 13
every time you visit. 14 Quiet Facial tattoo
15
99 A lady is convinced you are her son in 16 Humorous Rugged features
disguise. 17
18 Short-tempered Facial scarring
100 Your food is alive! Anything served to 19
you by the tavern staff begs to be spared. 20 Easy-going Plumed cap

Creating the Innkeeper & Servants Nervous Peg leg

Once you have established the Greedy Freckled skin
foundation of your unique
tavern, you will want an Skeptic Several braids
equally colorful innkeeper.
Distinctive characters help Generous Doe-eyed
bring your world to life, and
serve a larger purpose beyond simply moving Deadpan Glowing face
the story along. This chapter provides you with
Clueless Thick beard
everything you need to craft your NPC inn
and tavern staff. Witty Wide grin

Appearance & Smug Surprisingly short
Personality
Uptight Several piercings
Use the following tables
to craft the appearance Overbearing Muscular
and personality of your
d20 Clothing
innkeeper, staff, and 1 A revealing, low-cut dress
patrons. Roll a random 2 A full suit of armor, without the helm
result or pick a result 3 Barely clothed
you like. 4 Leather so tight it squeaks with every
move
5 A mages robe covered in runic markings
6 The clothing appears too tight
7 A suit of foliage, flowers braided into their
hair and/or beard
8 Armor made entirely out of bone, with a
skull acting as a helm
9 Filthy rags
10 Gold plated chain mail
11 Linen clothing, dyed red
12 Caked in flour to prevent plague
13 A tunic with draconic inscribing.

78

14 A griffin-skin coat, embroidered with the Deepen Your NPC’s
innkeeper’s coat of arms
Imaginative hooks help create
15 Wearing a symbol of loyalty to the local fantastic characters. For example:
nobility your tavern could have a retired
knight serving drinks, each
16 A hat to cover baldness accompanied with a metaphorical
17 Black robes with a white moon on the saying. Your innkeeper could be a
mentally scarred mage, conjuring endless steins
chest of ale, perpetually disgruntled from failing to
18 White flowing robes and turbans create the perfect brew. Perhaps your innkeeper
19 A dress made of the finest silk with a is harboring a dark secret or hidden agenda.

matching emerald necklace To fully develop your innkeeper, staff, and other
20 Cow-hide overalls NPC’s, you will want to place a “hook” in their
backstory. The more developed the characters,
d10 Exotic Appearances the better the gameplay. Use the table below to
1 Heavyset with bulging eyes, and flaming fashion your own memorable characters.

red curly hair. d20 Life’s motivation
2 Aged, covered in tattoos of nautical 1 Penance for crimes committed
2 Waiting for a loved one to return
creatures. 3 Elevating the brewing of ales to a true art
3 Bald head bearing an ancient tribal
form
symbol. 4 Uniting the city’s divided population
4 Waifish, wearing spectacles fashioned 5 Making customers smile and forget their

from bone and a flowing robe marked troubles
with suns and moons. 6 An endless pursuit of knowledge at any
5 Short and stout, covered in battle scars.
Fingers beset with many jewel-encrusted cost
rings. 7 Avenge his father
6 Missing one hand, replaced with a crude 8 A reformed cultist, determined to eradicate
metal prong. Mouth strangely twisted into
a permanent smile. cult activities
7 Dark, leathery skin covered with a brown 9 Saving a young metallic dragon from
woven tunic. Gentle face with sparkling,
joyful eyes. annihilation
8 Crooked and jittery. Gray hair tied into a 10 Keeping the traditions of the old gods, lest
bun.
9 Long and slender, dressed in leather and they be forgotten
hide clothing adorned with feathers. Face 11 Raise his family out of poverty
covered with a bone mask. 12 Give back to the community that took him
10 Nose like a hawk’s beak, eyes like a
beetle’s, and skin covered in warts. Wears in off the streets
a curious dragon skin pouch tied at the 13 Thwarting evil by creating a network of
waist.
spies throughout the realm
14 Raising a militia to overthrow the mayor
15 Becoming a famous painter

79

16 Greedily sabotaging other innkeepers and 18 The staff are all former bandits, trying to
tavern owners in the city build a new life away from crime.

17 Recreating an ancient ale, said to impart 19 She disappears each day at sundown.
immortality
20 The innkeeper has a considerable bounty
18 Eradicating hunger throughout the on his head.
kingdom
d20 Mannerisms
19 Waiting for his long lost brother to return 1 Slurred speech
20 Writing a book on botanic history 2 Speaks very fast
3 Mispronounces common words
d20 Innkeepers’ secrets 4 Slurps loudly
1 Feeds unfortunate drunken customers to a 5 High-pitched voice (male), deep voice
(female)
giant lizard in the cellar. 6 A little too friendly
2 Muttering to himself, he often curses his 7 Spits when speaking
8 Never finishes a sentence
bad customers. 9 Whistles jolly tunes
3 Has made a pact with a demon he now 10 Giggles in a high pitch often
11 Taps foot when annoyed
regrets. 12 Quick to anger
4 She steals gold to feed her baby dragon. 13 Strokes chin absentmindedly
5 Harbors fugitive bandits in a secret room. 14 Prone to talking over others
6 Worships an ancient evil cult responsible 15 Playful and joking
16 Organized and punctual
for recent sacrificial killings. 17 Polishes a medallion frequently
7 Smuggler's tunnels throughout the town 18 Fiddles with necklace
19 Unintentionally rude and crass
lead to the inn. 20 Theatrical flair
8 Plans to murder a local noble family.
9 Visits a haunted tomb every night after

nightfall.
10 Shares a body with another soul.
11 Cleans a sword every night, whispering, "I

will save you darling".
12 She bears the same tattoos as a notorious

group of assassins, hidden discretely
under her gown.
13 There is no mystery behind the recent
disappearance of his competitor; he was in
on the deal.
14 The innkeeper is holding someone
– or something – hostage under the
floorboards.
15 Gnomes leave mysterious parcels at the
bar for the innkeeper.
16 A spirit possesses the proprietor.
17 The innkeeper catalogues different types
and colors of hair in a lockbox. All have
been taken from guests at the inn.

80

100 Story Hooks For Your Inn 15 A mysterious severed hand is found,
rumored to grant unfathomable powers.
Now that your tavern is ready, the
only thing left is for customers 16 The local lord is seeking an heir to the
to walk in. And before long, throne after the death of his last living
adventurers will arrive looking son.
for a drink, information, or a new
quest to embark upon. To spark the 17 Giants have returned to the Red
imagination, here is a list of 100 story hooks for Mountains again. Villagers are worried
your inn. about the increasing number of
disappearances.
With a little bit of imagination, these can be the
beginning of a whole new legendary tale. One that 18 An ancient wizard’s tower emerges when
bards come to sing about in a hundred years from desert sands shift.
now under a canopy of dripping candles and pipe
smoke… 19 A dragon unexplainably abandoned
its hoard, leaving the surrounding
d100 Story hooks civilizations to war over it.
1
2 A local priest needs help with removing 20 Woodland spirits plea for help after a
3 a restless spirit. circle of runes comes alive with wild
4 magic.
5 A merchant is hiring adventurers to
6 track stolen goods. 21 The entire population falls gravely ill
7 after the river is polluted.
8 A pilgrim is found killed, a white eye
9 painted across his chest. 22 An ancient relic prophesizes the return
10 of a powerful dwarven king.
11 A druid circle is calling for aid; their
12 sacred grove is withering. 23 The local blacksmith is rumored to
13 impart curses on his weapons.
14 A local lord wishes to overthrow a
devious crime syndicate. 24 A glacier melted, revealing an ancient
portal into another plane.
Overnight, a lake appeared at the edge of
a desert town. 25 A note left on an assassinated noble
reads: The bloodline is ending.
A pack of seafaring Gnolls is pillaging a
small port town. 26 A local farmer has entered into a
pact with a witch, guaranteeing the
The innkeeper’s daughter has gone success of his harvest while others
missing at Redfang Ridge. unexplainably suffer.

Rivaling clans of goblins have cut off 27 A mysterious stranger is seeking a buyer
trade to a large city. for his cursed horse.

The paintings of an Elvish artisan are 28 The king’s castle is under siege; he
portals into the Far Realm. desperately calls for aid.

Angry peasants ride out at night to kill 29 A giant kraken is terrorizing the port,
the local lord. sending ships to their doom.

Haunting cries are heard mid-winter at 30 A pilgrim needs an escort to a holy site
the ruins of Muldrahn. and offers to pay with an aura reading.

A gnomish timepiece is stolen, turning 31 Rivaling goblin tribes threaten to flood
back time. a farming region vital to the local
economy.
A bustling city’s waterways are tainted,
placing everyone under a mind- 32 A local bakery is looking to win the
controlling spell. annual pie contest, but a gluttonous
demon threatens to ruin the festivities.

33 A lush forested region is engulfed in
magical fire.

34 A seller of songbirds has tracked down a
magical bird that predicts the future in
song.

81

36 The priests of a shrine are possessed by 56 Smoke rises in the distance, taking the
an ancient awakened evil. form of a dragon.

37 Winter no longer changes to spring, 57 All around you, humanoid shapes appear
sending an entire region into disarray. to be untouched by the rain as they skulk
toward you.
38 A tribe of savage barbarians goes to war
against the civilized world to restore 58 A woman hands you a wanted poster
their rule. with her face on it.

39 Villagers are lured to the center of a 59 The sun turns blood red and everyone
large lake where a small island sits around you starts howling.
shrouded in fog.
60 A hole in the ground opens releasing
40 The local jester died in a grisly accident bizarre, ghoulish creatures.
during the annual fair, but rumors point
to a growing cult movement. 61 A group of fanatics surround your group,
repeating, "They know not of their sin,
41 Villagers who venture too close to the we must show them the way".
edge of the forest is never heard from
again. 62 Ash begins to fall from the sky and a
priest beckons everyone into the church
42 A bookseller unearths an ancient tome, for their daily offering.
unleashing a powerful demon into the
city. 63 The sky tears open, releasing a torrential
downpour of blood.
43 The bell of a long abandoned monastery
tolls again. 64 A kindly woman approaches you with a
clarinet, demanding you play it or face
44 All the dogs in the city gather near an your fate.
old building, howling incessantly.
65 Passing a blacksmith, you hear a sword
45 The harbormaster’s head is on the line call your name.
after a stash of magical weapons is
stolen from port. 66 The earth shakes and villagers scream,
"She returns! She returns for us all!”
46 Villagers accuse your party of stealing a
holy relic from the temple. 67 The village believes you can save their
mayor with a liter of your blood.
47 There are no animals, insects, or
children in the village. 68 A tree branch holds onto you as you pass,
whispering “Save us”.
48 A vividly painted house sits atop a far
hill, and is avoided at all costs. 69 You hear a voice from within the cellar
call your name several moments after a
49 The surrounding woods are home to group of warriors runs screaming for the
strange, locked doors but none of the exit.
townspeople can explain why.
70 A group of wizard apprentices who call
50 Plants begin to fail, as the villagers themselves “The Renegades” demand
worship a strange deity. your assistance.

51 An entire village is in chaos after the 71 As the trees around you begin to wither,
villagers discover they no longer have they beg you to find a creature named
shadows. Rohgin.

52 You find a doll that looks strangely like 72 You awake to a black sky morning and
yourself, but around its neck is a noose. the innkeeper saying, “And so it begins”.

53 Someone hands you a journal that 73 Sprites drop a cage on you and shout,
accounts everything you have done up "Dinner is served!" as they fly away.
until that moment.
74 Inside your drink, you see a shrunken
54 You walk past a puddle, and see a creature shouting for help.
completely different world reflected in
the water. 75 A pack of white wolves drag a wounded
elf priestess into the tavern.
55 A terrified looking peasant girl is
trailing you.

82

76 A cloaked figure enters the city gates, an 95 Stuck to the bottom of your drink is
eerie trail of frost behind him. a note that reads: Meet at the back of
Raskin's, bring the sacrifice.
77 You witness hooded assailants beating a
satyr, telling it to "change back". 96 A crippled half-orc buys you a drink
and asks you to take him on one last
78 A mystical amulet is anonymously adventure.
delivered to your room.
97 A courier hawk delivers a message from
79 An elderly woman hands you a vial, your guild: Your membership has been
instructing you to pour the contents into revoked, effective immediately.
your next drink if you want to survive.
98 Your group has been summoned to the
80 Two identical men are fighting; as you sultan’s hall to receive a request, but
approach each one attempts to convince when you arrive, a troupe of actors is
you the other is the villain. already there, impersonating your party.

81 As it begins to rain inside the tavern, 99 Pirates descend upon the city from their
the innkeeper begs you to persuade the airships, taking a countess hostage
sorcerer to wait another week. before your group can save her.

82 The mayor pleads with you to defeat the 100 Among the horses in the stable is an old
goblins that terrorize the town. mare that tells you the townsfolk are not
what they seem.
83 A known crime syndicate requests a
meeting from you, or else. The Last Round

84 A child begs you to release her mother’s Quilla sits at her favorite spot, near the window looking
spirit from a doll. out over the sea. Waves crash under a moonlit sky,
sending spray high into the night air. The small copper
85 Orc raiders threaten a village, but stop bell hanging from the ceiling behind the bar chimes.
upon seeing you, mistaking you for one Ared turns around and bellows; “last round dear folks,
of the Old Ones. last call!” Wiping the sweat from his brow, he sits down
next to his beloved friend.
86 The Koulassi, a known group of “It’s a mighty sight is it not Quilla? That thunderous
assassins, hire you for a target even they roar makes you feel quite alive”.
cannot kill.
Looking up from her tankard she nods. “Without a
87 Several towns report their children are doubt, Ared. The best sight there is. It’s the reason why
missing after a visit from a traveling I keep coming back here.”
troupe of performers.
Ared grins, a sparkle in his eyes. “You’re hurting my
88 Godfrei's Goods and Services hire you to feelings, love. I always thought you came to see me!”
find two black dragon eggs.
Feet shuffle as drowsy patrons get up to head out into
89 You see a man being ignored by everyone the cold and find their beds. When the last ones have
in the town, and if you acknowledge him stumbled out, Ared closes up behind them.
you will take on his curse.
Another riveting day comes to a close. Who knows
90 A dwarf tells you he lost everything to what the next day brings... Every story comes
The Great Grundhurr, and that you're his to an end and you have reached the end of this
next victim. book. We hope you enjoyed it and like to thank
you for acquiring it. We like to wish you a lot of
91 You have been solicited to exact revenge roleplaying fun and many remarkable adventures!
on the warlock who destroyed the inn.

92 As a thick fog surrounds the town,
you are warned by a voice: "Leave, our
quarrel is not with you".

93 Voliki, a drunken gnome, offers you
100gp to take him into the caverns to
find his children.

94 Snow falls on the land, turning it into
eternal winter.

83

Special Thanks to our Backers

Remarkable Inns & Their Drinks was made possible thanks to the generous support
of our Kickstarter backers around the world. Special credit goes to the following:

Ahmad Y. Doleh Geert Lambrechts Lyon Pound The Lemming
Albert J. Herrera Grant Sherman II Manuel Nuñez-Regueiro Lord El Diablo
Andrew Long Greg Stock Bustos Thomas Lee Bunting
Anna Overby J.Evans Marc Altfuldisch Thomas Marth
Benedikt Simon James A. Velez Marky Pearce Tom Clews
Brendan Townsend Jason Eric Collins Matt McGovern Tom Kerr
Brett Comeau Jason Neff Michael Chandra Tony Doyle
Brian Otten Jeremy Wilson Michel Pikkert Tracy Landrum
Bruno Fabietti Jesse Williams Mitch Wineman Troy ‘Chillero’ Partridge
Chase Hopper John Adrian Basilio Nicholas Harvey Tyler Welsh
Cheesy Bamboozle Jon Stein Paul Rivers Wanda Aasen
Chillinon Kameron Joshua Leshner Petrus Julius Wesley Kreeg
Chris Anderson Joshua Renz Quade Archibeque William Dobbins
Christine Miller Juho Fröjd Rhel ná DecVandé William Z. Cohen
Clint Doyle Juliane Ober Robert Miklos Tudy
Coty Behanna Karamu Phoenix Robert Sanchez
Craig Denham Karen Ervin Ross Ramsay
Daniel Brown Kathelijne Van Salvatore Puma
Daniel Silva Gampelaere Sean Owen
Darrell Woods Kevin Carpenter Sergey Pomerantsev
David A. Nolan Kevin Coleson Steven Monson
David Cole Kostas Tziounis Stieven Cox
David Tanner Kurt Rauer Tanner Delventhal
Edward Da Fonseca Leon C. Glover Ted Schmidt
Fred Savadge Luca Basset

84

The Terms Of The Open Gaming License Version 1.0A Are As as expressly licensed in another, independent Agreement with
Follows: the owner of each element of that Product Identity. You agree not
to indicate compatibility or co-adaptability with any Trademark
Open Game License Version 1.0A or Registered Trademark in conjunction with a work containing
Open Game Content except as expressly licensed in another,
The following text is the property of Wizards of the Coast, Inc. independent Agreement with the owner of such Trademark or
and is Copyright 2000 Wizards of the Coast, Inc (“Wizards”). All Registered Trademark. The use of any Product Identity in Open
Rights Reserved. Game Content does not constitute a challenge to the ownership
of that Product Identity. The owner of any Product Identity used
1. Definitions: (a)”Contributors” means the copyright and/or in Open Game Content shall retain all rights, title and interest in
trademark owners who have contributed Open Game Content; and to that Product Identity.
(b)”Derivative Material” means copyrighted material including
derivative works and translations (including into other computer 8. Identification: If you distribute Open Game Content You
languages), potation, modification, correction, addition, must clearly indicate which portions of the work that you are
extension, upgrade, improvement, compilation, abridgment or distributing are Open Game Content. 9. Updating the License:
other form in which an existing work may be recast, transformed Wizards or its designated Agents may publish updated versions of
or adapted; (c) “Distribute” means to reproduce, license, rent, this License. You may use any authorized version of this License
lease, sell, broadcast, publicly display, transmit or otherwise to copy, modify and distribute any Open Game Content originally
distribute; (d)”Open Game Content” means the game mechanic distributed under any version of this License.
and includes the methods, procedures, processes and routines to
the extent such content does not embody the Product Identity and 10. Copy of this License: You MUST include a copy of this License
is an enhancement over the prior art and any additional content with every copy of the Open Game Content You Distribute.
clearly identified as Open Game Content by the Contributor, and
means any work covered by this License, including translations 11. Use of Contributor Credits: You may not market or advertise
and derivative works under copyright law, but specifically the Open Game Content using the name of any Contributor
excludes Product Identity. (e) “Product Identity” means product unless You have written permission from the Contributor to do
and product line names, logos and identifying marks including so. 12. Inability to Comply: If it is impossible for You to comply
trade dress; artifacts; creatures characters; stories, storylines, with any of the terms of this License with respect to some or
plots, thematic elements, dialogue, incidents, language, artwork, all of the Open Game Content due to statute, judicial order, or
symbols, designs, depictions, likenesses, formats, poses, governmental regulation then You may not Use any Open Game
concepts, themes and graphic, photographic and other visual Material so affected.
or audio representations; names and descriptions of characters,
spells, enchantments, personalities, teams, personas, likenesses 13. Termination: This License will terminate automatically if You
and special abilities; places, locations, environments, creatures, fail to comply with all terms herein and fail to cure such breach
equipment, magical or supernatural abilities or effects, logos, within 30 days of becoming aware of the breach. All sublicenses
symbols, or graphic designs; and any other trademark or registered shall survive the termination of this License.
trademark clearly identified as Product identity by the owner of
the Product Identity, and which specifically excludes the Open 14. Reformation: If any provision of this License is held to be
Game Content; (f) “Trademark” means the logos, names, mark, unenforceable, such provision shall be reformed only to the
sign, motto, designs that are used by a Contributor to identify extent necessary to make it enforceable.
itself or its products or the associated products contributed to
the Open Game License by the Contributor (g) “Use”, “Used” or 15. COPYRIGHT NOTICE Open Game License v 1.0a Copyright
“Using” means to use, Distribute, copy, edit, format, modify, 2000, Wizards of the Coast, LLC. System Reference Document 5.1
translate and otherwise create Derivative Material of Open Copyright 2016, Wizards of the Coast, Inc.; Authors Mike Mearls,
Game Content. (h) “You” Not for resale. Permission granted to Jeremy Crawford, Chris Perkins, Rodney Thompson, Peter Lee,
print or photocopy this document for personal use only. System James Wyatt, Robert J. Schwalb, Bruce R. Cordell, Chris Sims, and
Reference Document 5.1 2 or “Your” means the licensee in terms Steve Townshend, based on original material by E. Gary Gygax
of this agreement. and Dave Arneson.

2. The License: This License applies to any Open Game Content END OF LICENSE
that contains a notice indicating that the Open Game Content
may only be Used under and in terms of this License. You must Product Identity
affix such a notice to any Open Game Content that you Use. No
terms may be added to or subtracted from this License except The Following Items Are Designated Product Identity, As Defined
as described by the License itself. No other terms or conditions In Section 1(E) Of The Open Game License Version 1.0A, And Are
may be applied to any Open Game Content distributed using this Subject To The Conditions Set Forth In Section 7 Of The Ogl, And
License. Are Not Open Content:

3.Offer and Acceptance: By Using the Open Game Content You Illyruian Sea Tea, Thaunted Fields Of Alyi, Karkaudus’ Defiance,
indicate Your acceptance of the terms of this License. Monosis Spirit, Qori’s Wonder, Mangkoon Brew, U’thma Koki,
Mandoral Peacock, Gnoartusk, Tunoshi Steak, Kalyi’s Polum’s,
4. Grant and Consideration: In consideration for agreeing to use Grubgot, Tiandari Plumps, G’othrakkih, Mul’djin, Forests Of
this License, the Contributors grant You a perpetual, worldwide, Ruhn, Fizzlenozzle’s Hall Of Wonders, Ulurian’s Manor, Totin’s
royalty-free, nonexclusive license with the exact terms of this A&W Polishing, Torrick Shaw, The Desert Flats Of Kreek, Tunoshi
License to Use, the Open Game Content. Steak, Mandoral Peacock, The Haunted Fields Of Alyi, M’othma
Mullgra, Killasjar Brew,Krykk Castle, Cilathion The Righteous,
5.Representation of Authority to Contribute: If You are High Priest Of Akhmis, Moongates, Ared Norgin, Abraxas
contributing original material as Open Game Content, You Moonfang, Yadviga, Melomar Broganshire, Bumbly Bubbly,
represent that Your Contributions are Your original creation and/ Fiddlehead And Morel Bread, Fruum Blagsbard, Zaxia Coorvatak,
or You have sufficient rights to grant the rights conveyed by this Kymani Ashante, Bronwynn Elderflower, Brogan Hammerfist,
License. Dimhall, Glum’durr Mountains, Grom’s Aleforge, Gromm
Oakenkracker, Matilda Helenskag, Thurgan’s Red Ale, Laif’s
6.Notice of License Copyright: You must update the COPYRIGHT Golden Ale, Thoros Stonestorm, Romun And Remun Slydan,
NOTICE portion of this License to include the exact text of Dunlinn, Mul’djin, Ruhn, U’thma Koki, Killasjar Brew,The Ghost
the COPYRIGHT NOTICE of any Open Game Content You are Of Hileard Hall, Krykk Castle, Cilathion, Dhulmin, Jauzun, High
copying, modifying or distributing, and You must add the title, Priestess Of Akhmis, Nurnn Gut, Abolium.
the copyright date, and the copyright holder’s name to the
COPYRIGHT NOTICE of any original Open Game Content you All Of The Rest Of The Srd5 Is Open Game Content As Described
Distribute. In Section 1(D) Of The License.

7. Use of Product Identity: You agree not to Use any Product
Identity, including as an indication as to compatibility, except

85

Remarkable Inns & Their Drinks is the definitive guide to taverns, how to
create your own and bring them to life. This richly detailed 88-page tome offers
a wealth of new gameplay options, several exciting ready-made taverns,
interesting NPC’s, rumors, secrets and over a 1.000 random list options.
Turn ordinary tavern visit into a remarkable, exciting roleplaying experiences. Need
some inspiration for bar brawls? Peculiar games of chance? Innkeeper mannerisms?
This book has it all, and more...
What are you waiting for? Step inside!

© 2017 LoreSmyth Publishing
www.loresmyth.com