51THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
COMBINE & HEADER
SALES EVENT!
GET READY FOR HARVEST NOW! FARM WORLD HAS REDUCED NEW & PRE-OWNED HEADERS & COMBINES
ALMOST 45% OFF SELECT UNITS. ALL CASH DEALS!
2009 NEW HOLLAND 2007 NEW HOLLAND 2008 NEW HOLLAND 1985 NEW HOLLAND 2003 NEW HOLLAND
CR9070 CR9070 CR9070 TR96 CR940
# N22455A. 831 HRS. # PN2623A. 1,367 HRS. # PN2766A. 1,653 HRS. # N21067D. 2,942 HRS. # PN2893B. 1,604 HRS.
WAS $229,000 NOW! WAS $177,500 NOW! WAS $172,000 NOW! WAS $9,000 NOW! WAS $94,000 NOW!
$199,000 $159,500 $165,000 $7,000 $85,000
2012 New Holland CR9090 2011 New Holland CR9080 2009 New Holland CR9070 2008 New Holland CR9070
#N22195A. $305,000 #PN3198A. $289,000 #PN3019C. $189,000 #N21872C. $175,000
WAS $364,000 WAS $315,300 WAS $256,000 WAS $189,000
2011 New Holland CR9070 2011 New Holland CR9080 2009 New Holland CR9080 2006 New Holland CR970
#N22197B. $239,000 #PN3199A. $299,000 #PN3105A. $212,000 #HN3133A. $139,000
WAS $296,000 WAS $330,000 WAS $285,000 WAS $160,000
2011 New Holland CR9070 2011 New Holland CR9070 2008 New Holland CR9070 2005 New Holland CR970
#N22200A. $229,000 #PN3202A. $269,000 # HN3179A. $175,000 #HN2643C. $139,000
WAS $286,000 WAS $315,000 WAS $195,000 WAS $156,000
2011 New Holland CR9090Z 2010 New Holland CR9080 2008 New Holland CR9070 2005 John Deere 9760
#HN3374A. $299,000 #PN3112A. $219,000 #HN3180B. $175,000 #N22081B. $137,000
WAS $335,000 WAS $291,500 WAS $195,000 WAS $152,000
2011 New Holland CR9090Z 2010 New Holland CR9070 2008 New Holland CR9070 2003 New Holland CR960
#HN3375A. $299,000 #N22058A. $209,000 #PN3017D. $175,000 #N21830A. $99,000
WAS $335,000 WAS $239,000 WAS $229,000 WAS $109,000
2011 New Holland CR9090Z 2010 New Holland CR9070 2008 New Holland CR9070 1999 New Holland TR99
#HN3376A. $299,000 #N22229A. $229,000 #PN3018D. $175,000 #HN2643D. $55,000
WAS $335,000 WAS $289,000 WAS $229,000 WAS $72,500
2011 New Holland CR9080 2009 New Holland CR9070
#PN3197A. $289,000 #N20343B. $169,000
WAS $320,750 WAS $188,000
2010 1995 2010
HONEY BEE SP36 HONEY BEE HONEY BEE SP40
ONLY 2 LEFT IN SP25 #PH2545
STOCK!
#N21873. ONLY 1 LEFT!
PRICES STARTING AT
WAS $13,500 NOW
$44,900
$10,500 $50,000
2008 2004 NEW 2013
HONEY BEE HONEY BEE HONEY BEE
SP25 SP36 SP36
ONLY 3 IN STOCK!
#W22132A. #W22288A.
NOW
WAS $31,500 WAS $31,000
$71,900
$25,000 $26,000
2012 Honey Bee SP36 2007 New Holland HB3655 2004 New Holland 94C 1997 MacDon 960
ONLY 3 IN STOCK! $
#W22135A. $28,000 #HW3359A. $29,900 #PW2723D. $19,000
62,000#HW3384A. WAS $69,000 WAS $41,900 WAS $34,500 WAS $22,900
2011 MacDon D60 2006 Honey Bee SP36 2002 Agco 700 1996 New Holland 971
ONLY 2 IN STOCK! $
#HW3362A. $36,000 #W22133A. $4,500 #N21873G. $4,500
68,000#PW3259A. WAS $75,500 WAS $40,000 WAS $7,900 WAS $4,900
Hwy. #3, Kinistino 306-864-3667 Hwy. #5, Humboldt Hwy. #2 S., Prince Albert
David H ...............................306-921-7896 306-682-9920 306-922-2525
Jim ......................................306-864-8003
Kelly ....................................306-961-4742 Perry ...................................306-231-3772 Brent ...................................306-232-7810
David J................................306-864-7603 Shane ..................................306-231-5501 Aaron ..................................306-960-7429
Tyler ....................................306-749-7115
SPRAYER DEPT.
Mike ....................................306-921-5070 SPRAYER & GPS DEPT.
Chris ...................................306-960-6519
PRECISION FARMING DEPT.
Brad ....................................306-864-2660
Visit www.farmworld.ca for our full inventory
52 CLASSIFIED ADS THE WESTERN PRODUCER, THURSDAY, AUGUST 7, 2014
JF-STOLL MODEL FCT-900 silage cutter, 2010 CASE/IH 4420, 100’, 650 and 380 2009 JOHN DEERE 4930, 120’, 2600 moni- 2009 DEGELMAN 82’ HARROWS with
like new condition. 780-877-2339 or tires, AutoBoom, AccuBoom, AutoGuid- tor, AutoSteer, AutoBoom, HID lights, 520 Valmar, 5/8” tine, 26” length, new hoses,
780-877-2326, Edberg, AB. ance, WAAS, $249,000. Swift Current, SK. and 380 tires, $215,000. 1-888-788-8007, great shape. Call 306-533-4891, Gray, SK.
888-576-5561, www.redheadequipment.ca Saskatoon, SK. www.redheadequipment.ca 1997 DEGELMAN 7000, 70’ HD harrows,
2006 JD 7400 SP Forage Harvester, 2000
hrs, KP PU head incl, (corn head extra), 2012 CIH FL-4520, HID lighting, rear fen- 2011 JD 4830, 100’, 2 sets tires, 4 crop di- nice shape, $24,500. Call Dave at
$159,500 OBO. 204-573-5734, Brandon, MB ders, mud flaps, 810 tank, 1660 hrs., vider brackets, steering, $250,000. Phone 306-424-7511, Montmartre, SK.
NEW HOLLAND 892 Forage Harvester, in $285,000. 1-888-576-5561, Swift Current, 1-888-365-2681, Estevan, SK. or view EXCELLENT SELECTION OF new NH 70’ 1981 FLEXI-COIL 45’ harrow packers, dia-
good operating condition, shedded, $1000 SK. www.redheadequipment.ca www.redheadequipment.ca P2070 precision drills on 10” and 12” spac- mond harrow, 15” tires, good heavy pack-
OBO. 403-279-4767, Calgary, AB. ing available w/P1060, 430 bu. or P1070, ers, $1500. 306-460-6786, Kindersley, SK.
2011 JD 4930 120’, 1635 hrs, loaded, 2012 JD 4940, five sensor AutoHeight, 5- 580 bu. air carts. In stock, massive Sum-
1540 GEHL FORAGE BLOWER, exc. cond., June 2014 Greenlight, field ready!! Way nozzle bodies, 2630 GPS, two sets NEW ELMER’S SUPER 7, 70’ harrow,
always shedded, $2000. 306-232-4716, $199,800. Financing available. 710/380 tires, crop dividers, $295,000. Call $51,000. Central Alberta Precision Seeding
306-232-7762, Rosthern, SK. 1-800-667-4515, www.combineworld.com 780-678-0808, Ferintosh, AB. Shop at 403-783-8880 or 403-505-9524,
Ponoka, AB.
1994 3630 SPRA-COUPE, 2735 hrs, 400 2010 CIH 4420, 1000 hours, 80 duals, Pro
YOUNG’S EQUIPMENT INC. For all your gal. tank, 60’, low drift nozzles, exc. cond., 6 0 0 , a u t o b o o m , $ 2 9 0 , 0 0 0 . P h o n e mer savings! Very attractive lease pay-
silage equipment needs call Ron toll free $18,000. Call 780-385-1546, Killam, AB. 1-888-576-5561, Swift Current, SK. or ments available OAC. Markusson New
www.redheadequipment.ca
306-565-2405, Regina, SK. Holland of Regina Ltd., 1-800-819-2583 or
NEW HOLLAND 1905 SP Forage Harvester FARM CHEMICAL/ SEED COMPLAINTS 306-781-2828. www.markusson.com 1989 15’ and 12’ MF 360 discers, rolled
c / w P U a n d c o r n h e a d e r, $ 2 5 , 0 0 0 . We also specialize in: Crop insurance ap- blades 3 yrs ago, seeded 320 acres yearly
780-674-2440, 780-305-4106 Barrhead AB peals; Spray drift; Residual herbicide; Cus- 2009 JD 1895 43’ disc drill w/2009 JD on rock-free land, $1000 OBO; 6” Brandt
tom operator issues; Equip. malfunction. 1910 430 bu. cart, duals all round, nice end gate drill fill, hardly used, hyd ram on
Call Back-Track Investigations for assis- cond., $150,000. Can deliver to US border. joint, $400. 306-460-6786, Kindersley, SK.
tance and compensation 1-866-882-4779. 306-476-7248, Fife Lake, SK.
Call 1-888-920-1507
2000 CIH 4260, 90’, new boom tips, no 2010 6550 CART w/X20 monitor, rear
tow hitch, bag lift, excellent, $95,000.
HUGE SELECTION OF new front boom New Aim Command, S3 outback steering, float- Contact Trent 306-540-5275 or Tyler KELLO-BILT DISC PARTS: Blades and
Holland Guardian sprayers and a good se- ers, $69,000. 1-888-788-8007, Saskatoon, 306-533-8834. Located near Regina, SK. bearings. Parts to fit most makes and
lection of used sprayers in stock. Markus- SK. www.redheadequipment.ca models. 1-888-500-2646, Red Deer, AB.
son New Holland of Regina Ltd., Regina, 1997 FLEXI-COIL 5000 57’ w/midrow www.kelloughs.com
SK., phone 1-800-819-2583 or 23.1x26 RIMS for Rogator, brand new, NH3, 3.5” rubber packers, blockage moni-
306-781-2828, www.markusson.com $2000. 306-342-2013, Glaslyn, SK. tor, good cond., tanks available, $15,800. HIGH SPEED DISCS now available at Fla-
1-800-667-4515, www.combineworld.com man. Engineered for strength and
2012 CASE/IH 4430, 120’, Aim Command, 2001 CIH SPX3185, 90’, 750 gal. foamer, durability, the specialized design of the K-
AutoBoom, AccuBoom, 620 tires, Pro 700, 2 sets tires, $143,000. Estevan, SK. WANTED: 5-1/2” RUBBER packers for Line SpeedTiller is in a class of its own for
full GPS, $329,000. 1-888-576-5561, Swift 888-365-2681, www.redheadequipment.ca Flexi-Coil 5000, 9” spacing. Will trade superior soil and residue management. 20’
Current, SK. www.redheadequipment.ca 4-1/2” steel. 403-793-1705, Brooks, AB. 28’ and 30’ models available. See your
ROCK-O-MATIC 546 ROCK picker, good 1995 STEPDECK TROMBONE Tandem Trail- nearest Flaman store or 1-888-435-2626.
condition, $3750. Call 780-210-0800 or er, 48'-65" stretch on 22" rubber, 6" live roll, 1975 INTERNATIONAL 3 ton, high/low 2010 SEED HAWK 6010, S/N #101095
780-636-2892 evenings, Andrew, AB. CVI good until Sept. 30, 2014, $27,500. 4WD, auto. trans., w/1997 AgShield 1000 w/2010 Seed Hawk 600 bu. tank, S/N 2008 22’ WISHEK DISC 862 tandem. Gate
403-485-4703, 403-485-2170, Vulcan, AB. gal. suspended boom AutoRate sprayer, #101137. Big rubber all the way around, harrows w/carbide tips, front blades 26.5”,
$14,000. Call 306-268-4461, Viceroy, SK. $200,000. 306-548-5440, Danbury, SK. rear blades 26”. The disc is in nice condi-
tion, serviced, field ready, $39,000. Lautts
INDIVIDUAL BALE WRAPPER 2010 [email protected] 2013 CIH 4430, 120’, luxury cab, Viper 1995 ROGATOR 854, 200 HP, 90’ booms, MOON HEAVY HAUL pulling air drills/ air Rental, 701-324-2289, Harvey, N.D.
McHale 991 BE, good condition, $19,000 Pro, HID lighting, wide fenders, AFS Accu- new 800 gal. tank, 2 sets of tires, Outback seeders, packer bars, Alberta and Sask. 30
OBO. Call 780-210-0800 or 780-636-2892 ONLINE AUCTION: Flare Machinery Guide ready, $360,000. 1-888-788-8007, GPS, mix tank and pressure washer, low years experience. Call Bob Davidson, NEW 47’ SUMMERS incomparable dia-
evenings, Vilna, AB. Gang Edger for planks. Bids close in BC Saskatoon, SK. www.redheadequipment.ca hrs. Used mainly for banding fields in an Drumheller, AB. 403-823-0746. mond disc for $50,000 less than some
Aug 14. Inquiries: 1-800-263-4193. View aerial spraying operation, $70,000. Waska- competitors 40’ (high speed want to be)
2000 CASE/IH 8750 forage harvester, at: www.mcdougallbay.com DL#319916 2000 ROGATOR 1254, 4500 hrs., 100’ 2009 MORRIS MAXIM II 50’, 10” spacing, disc. Hauser Machinery, 1-888-939-4444,
1000 PTO, shedded, $6500. Minitonas, MB Box 3081, Regina, SK. S4P 3G7 boom, 1200 gal tank, Raven rate control- 8370XL 3 cmpt tank, vg cond, $97,900. Fi- Melville, SK.
waltersequipment.com Ph. 204-525-4521. ler, 3 sets of tires, asking $70,000 OBO. nancing available. Call 1-800-667-4515,
204-792-7274, Cartier, MB. or visit: www.combineworld.com 2013 MODEL 1550 Sunflower tandem disc,
RICHARDTON HI-DUMPS #1200, #750, 50’, 9” spacing, 1/4” blades, 3 bar harrows.
#770; JD 3970 Harvester, $8900; NH 890, da, MB. 204-673-2447 or 204-522-6232. 2004 BOURGAULT 5710, 47’, 3.5” steel 306-231-8060, Englefeld, SK.
$2500; IH 781, $2500; JD 7.5 Hay head, 2012 JD 4830, 100’, SF1, Swath Control packers, series 25, NH3/Dry banders, Ra- 2012 30’ WISHEK DISC 842. Has harrows,
$3000. 1-866-938-8537, Manitoba. Pro, 600/65R38, $298,600. Call South ven Super Cooler w/440 monitor, 4300 front blades are 28.5”, rear blades 29.5”,
Country Equipment, 306-721-5050, Regi- single shoot air tank w/rear hitch, exc. cond., serviced, field ready, $65,000.
JF 1350 SILAGE CUTTER, excellent con- 2007 NEW HOLLAND SF216 pull type na, SK. visit: www.southcountry.ca $65,000. 204-743-2149, Cypress River, MB Lautts Rental, 701-324-2289, Harvey, N.D.
dition, $20,500. Phone 403-588-0958, sprayer, 90’, suspended boom, 1000 gal.
plus rinse tank, $30,000. 1-888-365-2681, 2006 MORRIS 40’ horizontal fold, no-till
Alix, AB. Estevan, SK. www.redheadequipment.ca 2011 CIH 4420, 120’, HID lighting, Aim disc air drill, markers, w/7240 TBT tank, GET THE REAL FACTS about vertical till-
Command, AutoBoom, 3” fill, 650’s and low acres, $67,000 OBO. Will take grain on age. Call for a complete info pkg. and take
2004 IHC 7400 tandem automatic w/new 2009 BRANDT SB4000 90’ sprayer, chem 320’s, $279,000. 1-888-492-8542, Lloyd- trade. 306-693-9847, Moose Jaw, SK. advantage of our 2 for 1 sale. Get a 40’
20’ silage box, $74,900; 2006 Freightliner handler II, 480/80R46, $34,600. Call minster, SK. www.redheadequipment.ca Summers vertical tillage machine, plus a
Columbia with 20’ silage box, 470 Detroit, South Country Equipment, 306-721-5050, 50- SEEDMASTER PACKER tires, rea- 32.5’ high quality Summers field disc for
15 spd, $59,900. Price reduced. K&L Regina, SK. visit: www.southcountry.ca 2005 CIH 4410, 90’, Aim Command, ac- sonable condition. 306-771-2527, Edenw- the same price as the competitors (high
Equipment and Auto. Phone Ladimer at: tive suspension, auto boom, 650 floaters, wold, SK. speed want to be) disc. Call Hauser Ma-
306-795-7779, Ituna, SK. DL #910885. 1980 RENN VERTEC sprayer, 90’, 800 gal. $173,900. 1-888-576-5561, Swift Current, chinery, Melville, SK. 1-888-939-4444.
tank (very good), booms are rough, $500 SK. www.redheadequipment.ca JD 1900/1910 air carts, 350/340/270 bu,
OBO. 306-460-6786, Kindersley, SK. 2009 MILLER SPRAYER, 600 hrs., two sets Good cond., $29,800/$34,800/$16,800. 2009 22’ WISHEK DISC 862 tandem. Gate
650/320 tires, auto-tread adjust, 4-Way Financing available. Call 1-800-667-4515, harrows w/carbide tips, front blades 28”,
2001 FLEXI-COIL S67XL pull type, 90’, nozzle bodies, crop dividers, Raven Viper or visit: www.combineworld.com rear blades 28”. The disc is in nice condi-
1250 gal. tank, auto rate, suspended GPS, AutoHeight, AutoSteer, 365 HP, on tion, serviced, field ready, $41,500. Lautts
board presser washer, $235,000. Ferintosh,
2010 SEED HAWK 5012, 500 tank with Rental, 701-324-2289, Harvey, N.D.
b o o m , $ 1 5 , 9 0 0 . S w i f t C u r r e n t , S K . AB. 780-877-2574, 780-678-0808.
888-576-5561, www.redheadequipment.ca sectional control, liquid kit, 2100 gallon KELLO-BILT OFFSET DISCS. Check out
4650 SPRAY COUPE, 80’, 1500 hrs., shed- tank, blockage monitors and large tires. our new arrivals and pricing discounts.
306-268-4371, Bengough, SK. 2012, 16’, excellent shape, and parts for
2007 NH SF216 pull type, 100’, 1600 gal. ded, full GPS, sectional control, field
tank, chem eductor, $17,500. Lloydmin- ready, nice shape, orig. owner. Stephen,
ster, SK., phone 1-888-492-8542 or web: 306-731-7235, Earl Grey, SK. 2012 SEEDMASTER SXG550, double Kello and Rome dics. Brewster Ag, Earl
www.redheadequipment.ca 2010 CASE/IH 4420, 120’, Viper Pro, HID shoot, $269,000. Call Nelson Motors & Grey, SK. 306-939-4402, 306-731-7235.
2011 NH HIGH clearance sprayer, always lighting, 320 and 650 tires, chem eductor, Equipment, toll free 1-888-508-4406 or MADARA KDB Princess compact high spd
306-868-2022, Avonlea, SK. disc for intensive stubble mixing/cultiva-
shedded, like new condition, very low Turbo foam marker, $275,000. Estevan, SK
2011 JF STOLL 1355 silage cutter, low acres, big tire pkg. option, triple nozzles, 888-365-2681, www.redheadequipment.ca tion, 4-12 meter. Precision Seeding,
acres, ran with a 200 HP tractor, exc. cond., 1350 gal. tank, 100’ booms, Raven Auto-
always shedded, field ready, $55,000 OBO. Boom flotation guidance pkg., asking 1992 SPRA-COUPE 220, 60’ booms, foam 403-783-8880, 403-505-9524, Ponoka, AB.
306-398-7554, Neilburg, SK. $45,000. 306-662-8405, Richmound, SK. markers, 2500 hrs., shedded. Phone WANTED: VALMAR AIR SEEDER trailer MORRIS MAGNUM CP760 cultivator, Mor-
t y p e , i n e x c e l l e n t c o n d i t i o n . C a l l : ris mounted harrows, vg cond. Davidson,
2001 NH 240 forage harvester, very well 306-342-2082, 306-342-2085, Glaslyn, SK. SK. 306-567-7305, 306-567-3076.
maintained, $19,000; RICHARDTON 700
AIRMASTER 3 PTH sprayer, w/hand wand, 1998 WILMAR 8100 sprayer, 3444 hours, WANTED: PEUGEOL MOTOR, diesel 87 780-723-2646, Edson, AB. LIKE NEW BOURGAULT #6800 36’ culti-
hydump silage wagon, $7000. Both units 18’, w/6’ extensions, 110 gal. tank, used high clearance, duals, AWD, 90’, $42,800. HP, for Melroe Spra-Coupe model 3430. vator with or without harrows. Phone Ste-
only once, always shedded, $1500. 1-800-667-4515, www.combineworld.com Phone 403-631-3734. 1990 FLEXI-COIL 800 35’ air seeder with ven 306-338-2927, Wadena, SK.
ready to work. 306-736-7239, Kipling, SK. 306-697-3249, Grenfell, SK. Bourgault 2155 tank, 12” spacing, single
shoot, 14” shovels, Splitter boots, liquid
2007 NH P240 FORAGE HARVESTER 2004 NH SF110 high clearance sprayer
BEHNKE DROP DECK semi style and fert. kit, harrows, $19,500. Call Jordan USED WISHEK DISCS for sale. Previously
w/PU, bought in 2009, $26,000. Call A.E. w/Norac height control, located near Din- pintle hitch sprayer trailers. Air ride, anytime 403-627-9300, Pincher Creek, AB. in our rental fleet. 12’, 14’, 22’ or 26’ start-
ing at $27,995. See the Saskatoon Flaman
Chicoine Farm Equip. Ltd. 306-449-2255, smore, SK. Please call Cliff 306-846-2175 tandem and tridems. Contact SK:
Storthoaks, SK. or email [email protected] for info. 306-398-8000; AB: 403-350-0336. store or call 1-888-435-2626.
NH FORAGE HARVESTER FX58, 355 PU, 1997 FLEXI-COIL 67XLT, wheel boom, NEW 53’ SPRAYER trailers, 80,000 GVWR CASE/IH 5600 CHISEL PLOW, 45’, Degle-
air ride, multi-use trailer w/beavertail, 13’
KP, RI450 corn head, 2109 chopper hrs., 114’, windscreens, autofold, double top deck, 40’ main deck. See your nearest man mounted harrows, walking beams on
Flaman location or call 1-888-435-2626.
all updates, exc. cond., field ready. Call booms, new tires, autorate, foam marker, main frame and main wings, 5-plex fold-
ing, like new reversible spikes, located
403-634-4026, Lethbridge, AB. $8000. 306-648-2418, Gravelbourg, SK.
TRIDEKON CROP SAVER, crop dividers. near Yorkton, SK. Asking $11,500. Call
Reduce trampling losses by 80% to 90%. 780-910-6221, Stony Plain, AB.
2011 JD 4930 120’ sprayer w/ 1635 hours, Call Great West Agro, 306-398-8000, Cut 2011 CASE/IH RMX370 tandem disc, 37’,
June 2014 JD Green Light inspection done. Knife, SK. cushion gang, rear hitch, hyd. leveler.
LOADED!! $199,800. Trades welcome.
Financing available. 1-800-667-4515. Case/IH financing OAC. Trucking avail.
www.combineworld.com
2010 JD 1910 air cart, 3 tank, 430 bushel, Call Stan, 780-674-7826, Mayerthorpe, AB.
The Choice of Mechanized Farmers Worldwide™ double shoot, $67,000 OBO. Phone FARM KING FIELD DISCS ON SALE.
204-793-6760, Hazelridge, MB.
Call 1-888-435-2626. www.flaman.com
Corn Harvest The most exciting development yet! 2013 JD 4830 sprayer, 100’ booms, 1000 SEEDMASTER. CALL NOW to take advan- LQIR#ULWHZD\PIJFRP
Pan™ Mount Flexxifinger’s Corn Harvest gal. SS tank, 290 hours, $248,000 OBO. tage of our summer special pricing! Cen- ZZZULWHZD\PIJFRP
Pans™ on your draper header Power train warranty until 2017. tral Alberta Precision Seeding Shop
Flexxifloat™ to harvest your corn. 204-612-6531, 204-794-4878, Cartier, MB. 403-783-8880, 403-505-9524, Ponoka, AB.
Crop Lifter 0IJ&R/WG
Proven in the field. 2009 JD 4930 SP Sprayer, 120' boom, 746 2006 39’ FLEXI-COIL 5000 HD w/3850
Heavy Duty Flexxifloat™ Series of Lifters spraying hrs., 1973 eng. hrs., shedded and TBT cart, 10” spacing, steel packers, knife $/:$<6029,1*)25:$5'70
Crop Lifter™ work on uneven ground to harvest well cared for, 1250 gal. SS tank, w/ 380 x edge openers, variable rate, excellent
pulse crops and cereal crops 105R20 tires and mud flaps, $175,000. shape! $79,900. Call Jordan anytime, <RX¶OOQHYHU¿QGDEHWWHUVROXWLRQIRUPDQDJLQJ\RXU
Pulse Crop Lifter™ 306-487-7684, Lampman, SK. 403-627-9300, Pincher Creek, AB. VWUDZWKDQD5LWH:D\-XPER+DUURZ
Still a winner. The Heavy Duty [email protected]
with it’s adjustable forward lifting 2013 SEEDMASTER TBX-M90, DS, w/JD 2XUKDUURZVDGMXVWWR\RXU¿HOGFRQGLWLRQVDQG
point, shines in cereal crops and 550 bu. air cart, $369,000. Nelson Motors FRPHLQWKHULJKWVL]HIRU\RXUIDUPLQJRSHUDWLRQ
tall heavy peas. & Equipment, toll free 1-888-508-4406 or 7KH\IROGXSQDUURZHUIRUHDVLHUWUDQVSRUWDQGWKH\
306-868-2022, Avonlea, SK. DUHHDV\WRIROGDQGXQIROG
The Original. The Pulse Crop Lifter™
is the answer for peas, lentils, 1999 FLEXI-COIL 2320 cart, 4-run, TBH,
edible beans when you need to cut c/w all rollers, shedded, exc. cond.,
within 2” of the ground $14,500. 780-608-9455, Edberg, AB.
2010 BOURGAULT 3310, c/w 2011 Bour-
gault 6700 tank w/conveyor. Will separ-
ate. 306-563-6355, 306-563-7610, Canora.
MidCut Unique tapered design. The MidCut
Crop Lifter™ has the length needed to pick up
low lying crop and leave
taller stubble.
THE WESTERN PRODUCER, THURSDAY, AUGUST 7, 2014 CLASSIFIED ADS 53
2009 JOHN DEERE Disc, model 637, 21 " WHY CHOOSE ROTOSHEAR CASE/IH STEIGER built, 4 WD/Quads; 2005 JD 7520 Premier, 1500 hrs., IBT 2012 JD 8335R 3215 hours, 3 point 1997 FORD/NH 9882, 4WD, 23.1x32
discs, tandem, like new, $13,500. Quit farm- Plus other makes and models. Call the trans., LH shifter, 741 JD FEL, rubber 80% hitch, duals, powershift, PTO, sold w/ tires, 5000 hrs., very good shape, $95,000.
ing. Call 306-867-4129, Outlook, SK. The Ultimate Vertical Tractor Man! Trades welcome. We deliver. excellent condition, $98,000 OBO. Pictures warranty. $169,900. Trades welcome. 306-648-7766, Gravelbourg, SK.
[email protected] Gord 403-308-1135, Lethbridge, AB. available. 306-646-7743, Fairlight, SK. Financing available. 1-800-667-4515. 1991 FORD 946, 4950 hrs., tires good,
Crop Cutter 2008 CIH TX485, 2385 hrs., 485 HP, radial www.combineworld.com Outback E-drive, shedded, asking $50,000.
1978 MORRIS ROD weeder, 36’, harrows 520x85x42 triples, PTO, AutoSteer, power- JD 4630, 3 PTH, duals, powershift, runs 403-548-8928, Richmound, SK.
removed, used very little, $500; 1981 Mor- • Always a cut above the rest shift, $210,000. 306-843-7744, Wilkie, SK. well, $15,950. JD 4230, good rubber, 1990 JD 2555 tractor, 65 PTO HP, loader, 8N FORD, VERY Good condition, with culti-
ris 30’ HD cultivator w/dead rod, tine har- • Increases bushels per acre and LIZARD CREEK REPAIR and Tractor. We showing 8650 hrs, $11,250. JD 4430, good 3 PTH, 3781 hrs, $19,500. 204-326-7000, vator, $2500 OBO. Call: 306-783-0013,
rows, several new shovels and hyd. rams, buy 90 and 94 Series Case, 2 WD, FWA rubber, air, $11,250. JD 3130, cab, good Reimer Farm Equip, Hwy. 12 North, Stein- Yorkton, SK.
$1000. 306-460-6786, Kindersley, SK. improves sample for better grade tractors for parts and rebuilding. Also have rubber, add on 3 PTH, $8500. IHC 1086, bach, MB. www.reimerfarmequipment.com
• Reduce build-up on ends of divider rebuilt tractors and parts for sale. cab, good rubber, engine rebuilt, $8750. 2002 VERSATILE 2360, 20.8X42 duals, 12
2012 WISHEK 824NT, heavy trips, 30" 306-784-7841, Herbert, SK. JD 830, running, new grill, $7250. JD 730, 2001 JD 7210, FWD, 3 PTH, 6000 hrs. spd. manual, PTO, trimble guidance. Ask-
blades with very little wear, disc type, board resulting in precious time lost CASE 2290, 6000 hrs., $12,500 OBO; Case choice of 5, some electric, some pup, 7810 JD, FWD. Both with powerquad, LHR, ing $112,000. Call 204-248-2359, or cell
tandem, $72,500. 306-746-7638, Raymore, • Reduce piles in swath (beaver huts) 2390, 6000 hrs., $12,500 OBO; Case 1690 $4750 ea. JD 4020, w/Allied 694 self lev- and JD 740 loaders, grapple forks, joy- 204-723-0359, Notre Dame, MB.
SK. Email: [email protected] w/loader and grapple, 3700 original hrs., elling, quick attach, vg 23.1 tires, $8500. stick, super clean. 780-674-5516, VERSATILE 700, w/LEON dozer, 2600
resulting in less greens in sample and $16,900 OBO. All have CAHR and are in 204-746-2016, 204-746-5345, Morris, MB. 780-305-7152, Barrhead, AB. original hrs., $22,500 OBO. 403-585-1910,
JD 335 DISCER, good tires, vg condition, reduces possible heating in storage good condition with delivery available. Airdrie, AB.
$13,000. Can deliver. Call 204-827-2882, bins, which in turn reduces problems 218-779-1710, Gully, MN. 2012 JD 8335R 3215 hours, 3 PTH, duals, 1995 JD 8970, 400 HP, 5673 hrs., 4 hyd. VERSATILE 835, 4975 hrs., PTO, very good
Glenboro, MB. during harvest 2006 CASE/IH 430, 4 WD, full Auto- powershift, PTO, sold w/warranty remotes, 24 speed, Outback Integrated shape, $28,900 OBO. Call 306-782-2586 or
• High speed cutting action enhances Steer, 2670 hrs, 710x42 duals, exc. cond. $169,900. Financing available. Trades wel- AutoSteer, 20.8x42 triples, no PTO, 306-563-8482, Rama, SK.
NEW 2012 MODEL 11S30 Thurston Blue blade life 306-642-8111, Rockglen, SK. come. 1-800-667-4515. $83,700. Call 204-781-8664, Rosser, MB. 1978 VERSATILE 825, in good operating
Jet folding sub tiller, 21’ wide, SN 015068, W6 IH TRACTOR, starts good, runs good, condition, 8200 hrs., 3 hyds., $10,000 OBO
11 shanks, asking $42,000. Discounted to good tin, $1300 OBO. Call 306-395-2668, 2012 JD 8235R 3800 hours, PTO, 3 PTH, 1993 JOHN DEERE 8570, 6335 hrs. 24 spd, 403-279-4767, Calgary, AB.
sell. Call Don 306-548-5440, Danbury, SK. 306-681-7610, Chaplin, SK. duals, sold w/warranty, $149,900. Financ- 20.8x38, fresh $10,244 Greenlight, diff. 1982 VERSATILE 1150, 20.8x42 Firestone
1981 IHC 1586 tractor, 135 HP, duals, ing available. Call 1-800-667-4515, or vis- lock, stored inside, excellent condition. radial triples, Atom jet, 5 hyds, 9450 hrs
KELLO-BILT 8’ to 20’ offset discs w/24” 184x38, dual hyd., cab, loader w/round it: www.combineworld.com $60,000. 306-648-7654, Gravelbourg, SK. $48,900. Financing available. Call
to 36” notched blades; Kello-Bilt 24’ to 38’ bale fork, est. 10,000 hrs., $12,900. Call 1-800-667-4515, www.combineworld.com
tandem wing discs w/26” and 28” notched Gary at 204-326-7000 Reimer Farm Equip., DID YOU EXPERIENCE crop damage from 2006 JD 8430T, 16 spd. Powershift, 250 1984 VERSATILE 975, 8000 hrs., 360 plus
blades and oil bath bearings. Red Deer, AB. Hwy. 12 North, Steinbach, MB., using Priority, PrePass or Express Pro. HP, 1000 PTO, 3PTH, front weights, 3700 HP, exc. cond., delivery avail., new paint,
www.kelloughs.com 1-888-500-2646. www.reimerfarmequipment.com If so, call Back-Track Investigations hrs., $119,000. 306-948-7223, Biggar, SK. $37,500 OBO. 218-779-1710, Gully, MN.
1-866-882-4779 regarding compensation.
For Further Information Contact 2012 CIH 500HD, powershift, front and 2012 JD 9460R, 4 WD, powershift, 590 GRATTON COULEE AGRI PARTS LTD. Your
rear diff. locks, 5 hyd. outlets, Pro 700 dis- JOHN DEERE 4020, premium condition, hrs., 800/70R38’s, premium cab, leather #1 place to purchase late model combine
VERTICAL TILLAGE, JOKER 37’, 2013, ROTOR-SHEAR@ play, AccuGuide, 372 receiver, 800/70R mechanically and in appearance. Call trim, HID lights, weight package, extended and tractor parts. Used, new and rebuilt.
good shape, $86,500. Corner Equipment, duals, 696 hrs, like new. Factory warranty 403-823-1894, Drumheller, AB. warranty, $219,500 US. Fairfax, MN., www.gcparts.com Toll free 888-327-6767.
204-483-2774, Carroll, MB. FORESTBURG WELDING & until May 2015. Asking $269,000. Almost phone 320-848-8496 or 320-894-6560.
MACHINING anything on trade. Phone 1-877-862-2387, JD 4450, 6880 hrs, 3 PTH, powershift, www.ms-diversified.com LEON 707 FEL off 4440 JD tractor, excel-
WANTED: BIG HEAVY disc, 22’, Rome or 1-877-862-2413, Nipawin, SK. MFWD, $41,500; JD 4450, 6200 hrs, pow- lent, $2500. Killam, AB. 780-376-2426.
Wishek. Must be in perfect shape. Call Merlin Badry, Pres., Box 667, 2011 IH PUMA 195 HP, power boost 230 ershift, 2 WD, duals, new tires, $35,500; LOOKING FOR JD 30, 40, 50 Series trac- JOHN DEERE 640 LOADER, mounts, buck-
204-372-6201 or 204-308-0256. Forestburg, AB HP, MFWD, 1378 hrs, 4 hyds, A/C cab, exc JD 8100, 4800 hrs, powershift, MFWD, 3 tors in good cond. with mechanical issues. et, grapple, very good condition, $7000.
condition, $89,800. Financing available. PTH, $76,500; JD 7800, 6100 hrs, power- Call 306-621-7170, Yorkton, SK. Call 780-398-2554, Waskatenau, AB.
Toll Free: 1-877-582-3637 1-800-667-4515, www.combineworld.com shift, 3 PTH, MFWD, front 3 PTH w/PTO, JD FEL MODEL 146, c/w 5’ bucket, hyd.
1989 CASE/IH 7130, MFWD, 4000 hrs, $65,000. 306-231-3993, Humboldt, SK. 1986 JD 4850 MFWD, powershift, 6000 lines in for hay fork, $2200 OBO. Phone
780-582-3637 FAX: 780-582-3732 20.8x38 duals, 18 spd., 3 hyds., exc. www.versluistrading.com hrs., excellent rubber, mint condition. 780-674-4080, Barrhead, AB.
shape, $50,000. 1985 2-135 White, 5946 306-744-8113, Saltcoats, SK. 1985 W14 CASE wheel loader, feedlot spe-
MADARA HIGH SPEED disc for intensive www.rotoshear.com hrs, duals, exc. shape, $12,500. 2008 JD 9630, 1465 hrs, deluxe comfort, cial, joystick, 3rd valve and bale grapple, 2
stubble mixing/cult., 4-12 meter. Order 306-378-2268, 306-378-7789, Elrose, SK. 520/85R46, diff lock, $281,100. Call South 1983 4240 JD 9000 hrs., new: paint, de- yd. capacity, $4000 WO, $24,900. Can de-
now for fall delivery. Precision Seeding, 2008 IH MAGNUM 335 MFWD, 330 HP, Country Equipment, 306-721-5050, Regi- cals and upholstery, very good condition, liver. Hay Vern 204-729-7297, Brandon MB
403-505-9524, 403-783-8880, Ponoka, AB. 4100 hours, PTO, 3 PTH, duals front AND na, SK. visit: www.southcountry.ca tires- 75%, with 148 loader, bale and pallet LATE MODEL LEON 14’ dozer, hydraulic an-
back, $129,900. 1-800-667-4515, forks, $28,000. 306-795-2800, Ituna, SK. gle, like new condition, half price. Fits all
BOURGAULT FH46-52, 48’ cult., 8” spacing, www.combineworld.com ESTATE SALE OF John Deere tractors at Series II and III Versatile tractors. Call
330 trips, 4-Bar quick change harrows, 1986 4894, 300 HP, 5764 hrs., 20.8x38 Coles Auction. The following tractors will be 2012 JD 9460R, 4 WD, powershift, 590 403-823-1894, Drumheller, AB.
$19,950. 306-782-9507, Willowbrook, SK. duals, 1000 PTO, new int, $40,000. Wilcox, sold at Coles Auction in Rocky Mountain hrs., 800/70R38’s, premium cab, leather CASE #70 Front end loader for sale.
SK. 306-732-4636, [email protected] House, AB, Aug. 23, 2014. John Deere 830, trim, HID lights, weight package, extended Phone 780-945-1641, Redwater, AB.
180 HP AGCO, Powershift, 18 spd., FWA, cab; John Deere 820; John Deere 820, warranty, $219,500 US; 2011 JD 9530,
COMPLETE SHANK ASSEMBLIES: JD 1610, high lift FEL w/grapple, 540/1000 PTO, 2013 CASE STEIGER Model 500, 750 hrs., parts only; John Deere A wide, front axle; 912 hrs., delux cab, Active seat, AutoTrack 2012 CAT MODEL 272D XHP skidsteer, 2
$135; JD 610, black, $180; JD 1600, $90; $18,000 recent work order, $30,000 OBO. 800 duals, $311,000. Call Nelson Motors & John Deere A wide, parts only; John Deere ready, Firestone 800/70R38, weight pkg, spd. high flow hyd., cab, AC, heater, new
Morris 7-series, $135. Phone anytime 306-277-4503, Gronlid, SK. Equipment, toll free 1-888-508-4406 or D; John Deere M. Please call after 7 PM for $189,500 US. Fairfax, MN., 320-848-8496 78” bucket, 370 hours, $45,500.
306-946-7923, Young, SK. 306-868-2022, Avonlea, SK. further info. Good condition. 403-845-9945, or 320-894-6560. www.ms-diversified.com 204-864-2391, 204-981-3636, Cartier, MB.
Rocky Mountain House, AB. Email: JD 148 and/or 58 LOADER, fits 10, 20,
2007 CHALLENGER MT865B, 525 HP, Cat CAT 35, 210 HP, large 1000 PTO, 16 spd. [email protected] 1972 JOHN DEERE 4320, 10,000 hrs., 30, 40, and 50 Series, $3900 OBO.
C18, 3953 hrs., exc. cond., HD tracks- 80%, PS, 4 hyd. outlets, 3PTH, 3400 hrs. Great $7,000. 306-839-4422, Pierceland, SK. 403-823-1894, Morrin, AB.
PTO, big pump, 6 SCVs, GPS ready, tractor for grain cart. Tractor looks like JD 8450, 4650, 4450 and 4440s; parting CRAWLER DOZERS: CAT D8H, high horse
$179,000. 780-206-1234, Barrhead, AB. new. 306-457-2935 after 6 PM. Stoughton. out JD tractors. Will trade for JD tractors 2001 JOHN DEERE 9400 12 speed PS, with V-blade; Cat D7 with hyd. dozer and
2 NEW 5500 Durabuilt rubber tracks needing work. Also, FELs available. Austin, cruise control, triples 20.8 R42 firestone, rake; Cat D4C-40A with dozer; Cat D6-9U
DUETZ/ALLIS 9170, FWA, 7000 hrs., 3 still on pallets, fit Challenger MT800 high MB. 204-871-5170. wheel weights, in frame rear suit case with dozer; Cat D6B with front and rear
PTH, PTO, exc. cond., delivery avail., track, $23,000. 780-928-2538, La Crete AB weights, 4700 hrs., good condition, blades; 4- Cat D2 crawlers. Large stock of
$24,500 OBO. 218-779-1710, Gully, MN. JD 7600, FWA, powershift, w/740 highlift $107,500 OBO. 306-843-7489, Wilkie, SK. new and used parts. Discount prices. Many
1980 JD 4840 powershift, 7730 orig. hrs., loader, 3 PTH, not been used in winter or other units arriving daily. Central Canada’s
9190 DEUTZ, FWA, PTO, 200 HP, shedded, complete motor overhaul at 5500 hrs., around cattle, mint cond. 306-961-6499, 2006 TV145 w/hay header, front end short largest wreckers of Industrial equipment.
3300 hrs., $24,000 OBO. Call large power take-off shaft, 650-65- Prince Albert, SK. loader, grapple forks, hyd. at both ends, 3 Cambrian Equipment Sales, 204-667-2867,
306-675-4848, Leross, SK. R38XM108 Michelin radial duals 95% PTH, 2 new tires, PTO both ends, 3850 hrs, fax: 204-667-2932, Winnipeg, MB.
tread, vg cond. 306-570-2714, Pense, SK. 2012 JD 6140R, only 31 hrs., loader ready, c/w 18’ haybine HS18, vg cond., $75,000.
1974 ALLIS CHALMERS 7030, power direct 2012 JD 6140R MFWA, c/w JD loader many options, loaded, $125,000 OBO. 306-468-2669, Canwood, SK. 2011 CATERPILLAR WHEEL LOADER
and grapple fork, deluxe cab, 3 PTH, 1600 204-794-4878, 204-981-3636, Cartier, MB. IT-38-H, low hr. machine, EROPS, AC, ride
trans., 2 hyds., dual PTO, 3 pt. hitch, 18.4 hrs., always shedded, like new, asking 1999 NEW HOLLAND TV140 bi-directional control, Q/C, 20.5R25 tires c/w 3.5 yard
$75,000. 587-589-0333, Edmonton, AB. WANTED: 4450 MFWD with loader and tractor, 9600 hours, FEL $35,800. Financ- bucket, excellent condition, $145,000. Can
GET THE REAL FACTS about vertical till- rubber, above average condition, $7500. 1992 4560 JD, 160 HP, new tires, 5400 grapple. Willing to travel. 306-839-2073, ing available. Call 1-800-667-4515 or visit: deliver. 204-743-2324, Cypress River, MB.
age, call for a complete info pkg. We have 306-228-3665, 306-228-9383, Unity, SK. hrs., $37,000; 1994 7200 JD, MFWD, 740 Pierceland, SK. www.combineworld.com
loader, grapple, 3 PTH, 90 HP, 10,500 hrs., MF 8460 COMBINE, 2770 hrs., PU header;
new and used Summers vertical tillage $39,000. 306-243-4307, Macrorie, SK. 2009 JOHN DEERE 4895, w/36' Honeybee 1999 NH 8670 Genesis, SuperSteer, 3 PTH, MF 200 swather, 26’, UII pickup reel. Both
1982 JD 8450 PTO, 7100 hrs., rebuilt en- 575 tractor, 451 hdr, double swath, built-in 4950 hrs., $57,000 OBO. 306-563-8482 or stored inside and in good shape.
machines and Summers discs for sale. All gine (400 hrs) 20.8x34 duals, $26,900. GPS, Mandako swath roller, $90,000. 306-782-2586, Douglas, MB. 306-874-5663, Spalding, SK.
Cam-Don Motors 306-237-4212 Perdue SK 403-860-9477, 306-270-7000 Kindersley SK LAND LEVELLERS: NEW 10’, $2250; 12’,
sizes. Call: Machinery Dave, 403-545-2580 1978 JD 8440 4WD, 12’ blade, new NEW HOLLAND PV145, bi-directional, $2450; Used scrapers: 4 yd., $3900; Ash-
20.8x18.4 singles, triple hyds., $20,000. STEVE’S TRACTOR REBUILDER looking 3150 engine hrs., loader, PTO and hyds. on land 4.5 yd., $4500, Crown 6 yd., $5500;
Bow Island, AB. www.summersmfg.com 1986 CASE 3394, FWA, 160 HP, 8500 hrs., Call 403-502-0048, Medicine Hat, AB. for JD tractors to rebuild, Series 20s, 30s, both ends. 780-674-8080, Cherhill, AB. Midland 8 yd., $8000; V-ditcher, $1500.
40s or 50s, or for parts. Will pay top dollar. 1-866-938-8537, Portage la Prairie, MB.
DISCS: Kewanee breaking disc, 13’ and w/895 Allied TSL loader, grapple and joy- Now selling JD parts. 204-466-2927, 2006 NEW HOLLAND TV145, 4 WD, 4490
16’; Towner 21’; IH 490 25’, $7500; JD 15’, stick, $30,000. 306-264-3834, Kincaid, SK. 204-871-5170, Austin, MB. hrs., always shedded, bi-directional drive,
100 to 174 HP, vg cond., $55,000 OBO.
$5000; 22’, $9500; 30’, $10,500; Versatile 1987 CASE/IH 4694, 8,300 hrs, duals, very 2012 JOHN DEERE 9560R, 560 HP, 749 204-328-7133, 204-721-0119, Rivers, MB.
1800 36’, $25,000; Phoenix harrows 42’ good rubber, 1000 PTO, good condition, hrs, JD link, 520/85R46, $402,300. Call [email protected]
and 53’; Disc rippers: DMI 5 shank, $8900; $25,000 OBO. 403-934-3012, Strathmore, South Country Equipment, 306-721-5050,
7 shank, $10,900. Call 1-866-938-8537, AB. [email protected] Regina, SK. www.southcountry.ca 2009 T9060, 4 WD, 535 HP, full Auto-
Portage la Prairie, MB. Steer, 800 duals, 1380 hrs, full weight pkg,
JD 8970, 440 HP, powershift, PTO, 20.8 exc. cond. 306-642-8111, Rockglen, SK.
A GR OW PLOW triples, new eng., 3 hyds., great grain cart
tractor.Can deliver 780-603-7640 Bruce AB 1995 NEW HOLLAND 8970, MFWD power-
COMPACTION PROBLEMS?? EXCESS WATER PROBLEMS?? shift, rubber 85%, 7000 hours, excellent.
2010 7330 JD, MFD, 3300 hrs, 20x20 pow- Call 306-744-8113, Saltcoats, SK.
DEEP TILLAGE EQUIPMENT Demo REG. PRICE SALE PRICE erquad trans, 3 PTH, 20.8x38 tires, w/741
New JD loader and grapple, $110,000. Call A.E. 2012 NH T9.615 4WD, 834 hrs, AutoGuide
7 SHANK/H.D. SPRING Demo $10,626.00 $3,750.00 Chicoine Farm Equip. Ltd. 306-449-2255, WAAS rec, 800/70R38 $292,200. Call
9 SHANK/RIGID Aged $10,043.00 $6,500.00 Storthoaks, SK. South Country Equipment, 306-721-5050,
9 SHANK/HYD. W/COULTERS Used $17,792.00 $9,250.00 Regina, SK. visit: www.southcountry.ca
9 SHANK/HYD. W/COULTERS Used $17,792.00 $12,500.00 JOHN DEERE 4320, excellent condition,
9 SHANK/WET KIT New $19,300.00 $14,500.00 dual PTO, never had FEL. 403-585-1910, 2006 TV145 w/hay header, front end short
13 SHANK/HYD Aged $42,000.00 $33,000.00 Carbon, AB. loader, grapple forks, hyd. at both ends, 3
15 SHANK/HYD New $48,000.00 $39,200.00 PTH, 2 new tires, PTO both ends, 3850 hrs,
15 SHANK/HYD New $47,683.00 $37,800.00 2002 JD 7810, MFD, autoquad with LHR, c/w 18’ haybine HS18, vg cond., $75,000.
17 SHANK/HYD Aged $50,369.00 $43,500.00 has E-range, 3 PTH, 4900 hrs., shedded. 306-468-2669, Canwood, SK.
17 SHANK/HYD New $50,369.00 $43,500.00 Call 780-990-8412, Cherhill, AB.
17 SHANK/HYD $48,400.00 $41,000.00 2006 NH TJ380 380HP, 4WD, 1721 hours,
19 SHANK/HYD $59,688.00 $47,500.00 5 hyds, front weights, $124,800. Financing
available. Call 1-800-667-4515, or visit:
R .A.W EST IN TER N ATION AL IN C. www.combineworld.com
285 SER V ICE R OAD V U L CAN ,AB
403- 485- 19 9 8 TF: 1- 888- 9 72- 9 378 1996 FORD/NH 1720 acreage tractor, 456
hours, 28 HP diesel, 3 PTH, PTO, Leon
FEL, shedded, very clean, $12,000.
306-963-7861, Imperial, SK.
54 CLASSIFIED ADS THE WESTERN PRODUCER, THURSDAY, AUGUST 7, 2014
SUNFLOWER HARVEST SYSTEMS. Call 2014 FARM KING 750 7’ rough cut mower, WANTED: USED, BURNT, old or ugly trac- ZZZQRXWLOLW\ELOOVFRP SPRUCE FOR SALE! Beautiful locally O N E S TO P
for literature. 1-800-735-5848. Lucke Mfg., 3 PTH, never been used, $2800. Creelman, tors. Newer models too! Smith’s Tractor grown trees. Plan ahead and renew your
www.luckemanufacturing.com SK. 306-433-0003 or 306-737-0610. Wrecking, 1-888-676-4847. 3RODU,QGRRU 2XWGRRU:RRG%RLOHUV shelterbelt or landscape a new yardsite, CATTLE FIN AN CIN G
WANTED: LATE MODEL tractor, 50-100 get the year round protection you need.
RETIRING: 7’ JD sickle mower; 9’ NH hay- TRACTOR TOW ROPES and Tow Straps in H P, w i t h f r o n t e n d l o a d e r. P h o n e &RQVWUXFWHGRI$60(6$%RLOHU3ODWH6WHHO We sell on farm near Didsbury, AB. or de- BC, ALBER TA, S AS K.
rake; NH 352 mixmill; NH 327 manure stock at Flaman. Call 1-888-435-2626. 306-997-4905, Borden, SK. liver anywhere in western Canada. Now “ Fa rm e rs He lping Fa rm e rs ”
spreader; NH 1049 bale wagon; and 9’ hay- www.flaman.com 7UDGLWLRQDO (3$3KDVH taking spring bookings. Details phone
bine for parts. 306-856-4443 Conquest, SK MULCHING - TREES, BRUSH, Stumps. 403-586-8733 or check out our website at FOOTHILLS
145 VERSATILE 4 WD, running; MF 860 Call today 306-933-2950. Visit us at: www.didsburysprucefarms.com
RETIRED: JD 9660WTS combine; CIH combine, shedded; MF 860 turbo for parts, www.maverickconstruction.ca 7LWDQ&RDO0XOWL)XHO6WRNHU%RLOHUV LIV ESTO C K C O - O P
MX285 tractor; Westward 9350 swather rubber- good; IH swather w/15’ header; GUARANTEED PRESSURE TREATED fence ,QGRRU&RDO*DV*UDLQ3HOOHW2LO:RRG BISON WANTED - Canadian Prairie Bison Bred cow program !
w/MacDon 25’ triple del.; NDE feed pro- Versatile minimum till hoe drill 21’. Best posts, lumber slabs and rails. Call Lehner %RLOHUV&RRN6WRYHV)LUHSODFHV+HDWHUV is looking to contract grain finished bison
cessor; JD 8200 w/840 loader; JD forage offer or trade on livestock equip. Outlook, Wood Preservers Ltd., ask for Ron for growing markets. Roger Provencher at FeederProgram !
harvester; Bale shredders; Maternity pen; SK., 306-867-4595, 306-867-8833 eves. 306-763-4232, Prince Albert, SK. )XUQDFHV 6WRYHV 306-468-2316. [email protected] Toll Free 1-8 66-8 48 -6669
Panels; Incubators, etc. 306-468-7315, CUSTOM FENCING, WILL travel. Call for NEBRASKA BISON BUYING ALL CLASSES
Canwood, SK. or [email protected] 1983 JD 7721 combine w/JD 912 PU; bookings. 306-221-8806, Asquith, SK. Bison calves, yearlings, adult bulls, cows, No Res triction s ; Pu rcha s e a n d
2000 MacDon Premier PT swather with fin- SPEEDRITE, PATRIOT ELECTRIC FENCERS pairs. All export requirements processed m a rk etin g -You rchoice
ODESSA ROCKPICKER SALES: New De- ger reel; Morris Magnum II 40’ cultivator; and accessories. 306-725-4820, Bulyea, TROPHY ZONE TANNERY, State of the by Nebraska Bison. Contact Randy Miller,
gelman equipment, land rollers, Straw- JD 24’ discers; Int. 310 discers; RiteWay SK., www.lambacres.ca art facility. Hair on tanning for both taxi- 402-430-7058, Nebraska, NE. or e-mail: w w w.foothills lives tock.ca
master, rockpickers, protill, dozer blades. harrow packer drawbar. Located near Din- MASSEY 44 TRACTOR with post pounder, dermy and domestic hides. Quality work [email protected]
306-957-4403, 306-536-5097, Odessa, SK. smore, SK. Please call Cliff 306-846-2175 $1750. Call 306-642-3189, Assiniboia, SK. with fast turnaround. Call anytime 200 BRED COWS, breeding bulls and heif- Roc k y M ou n ta in Hou s e , AB
or email: [email protected] for info. SOLIDLOCK AND TREE ISLAND game wire 403-653-1565 or cell: 406-450-6300, ers. 306-375-7645, Kyle, SK.
QUIT FARMING: BOURGAULT Series III and all accessories for installation. Heights Cardston, AB. Email: [email protected] WANTED: CALVES AND Yearlings. Call Swift Current, Sask.
850 sprayer, new Bubble Jet nozzles; JD FARM CHEMICAL/ SEED COMPLAINTS from 26” to 120”. Ideal for elk, deer, bison, Ryan 306-646-4974 or cell: 306-646-7743
590 30’ swather, new reels and knife. We also specialize in: Crop insurance ap- sheep, swine, cattle, etc. Tom Jensen 1/4” TREAD PLATE or checker plate, vari- Fairlight, SK. M A GNUS ON R A NC H
306-264-3660, Glenbain, SK. peals; Spray drift; Residual herbicide; Cus- ph/fax 306-426-2305, Smeaton, SK. ous sizes, $7/sq. ft. 306-538-4685, LOOKING FOR ALL class of bison from
tom operator issues; Equip. malfunction. 306-736-7146, Kennedy, SK. yearling to cow/calf pairs and big bulls. Th urs da y, Augus t 21, 2014
B.F. MECHANICAL LTD. Authorized Dealer Call Back-Track Investigations for assis- BLOCKED AND SPLIT seasoned Spruce Phone Kevin 306-429-2029, Glenavon, SK. Sa le a t 1:00 p m a t Fa rm
of Sunnybrook Welding Box Concaves tance and compensation 1-866-882-4779. firewood. Call V&R Sawing, 306-232-5488, IRRIGATION EQUIPMENT or move wa- WANTED TO PURCHASE cull bison bulls Com p le te 100 h e a d dis p e rs a l,
for rotorary and axial flow combines. Elias Rosthern, SK. ter? 6”-10” pipe, 4 cyl. motor and pump and cows for slaughter. Oak Ridge Meats
Reliabelt grain belt augers, highest ca- LEON ROCKPICKER #3000, $2395; Flexi- BLOCKED SEASONED JACK Pine firewood on cart, $4500. 403-308-1400, Taber, AB. 204-835-2365 204-476-0147 McCreary MB fe a turin g 8 5 Pa ir a n d 15 b re d h e ife rs .
pacity grain belt augers. The most innova- Coil 10x65 auger, $2200; 50’ Bourgault and wood chips for sale. Lehner Wood Pre- IRRIGATION TURBINE WATER pumps, ELK VALLEY RANCHES, buying all ages Directio n s : L ittle 6 grid o n #722 grid
tive technology for your farming needs. packer bar w/Valmar, $4895; 50’ Flexi-Coil servers Ltd., 306-763-4232, Prince Albert, 6”-8”, 4 cyl. dsl., 600-1000 gal./min., very of feeder bison. Call Frank 780-846-2980, 17 m iles ea s to fS ha u n a vo n , S K .
Call Brady at 306-741-7968. System 95, $3495; 40’ Bourgault cult., SK. Will deliver. Self-unloading trailer. efficient. 403-878-6302, Grassy Lake, AB. Kitscoty, AB. or [email protected] 3-1/2 m iles s o u th
$4750; 32’ Morris deep tillage cult., $1800. WESTERN IRRIGATION - Large supply of 1/2 m ile w es t to s eco n d ya rd
SOLD CATTLE: 2090 and 2290 Case trac- Call Curtis 306-883-2468, 780-891-7334, FIREWOOD: Cut and split, delivery new and used irrigation equipment. Cad- SASKOTA NATURAL is looking for fin-
tors; 8430 JD 4WD; 2 older cattle trailers, Spiritwood, SK. available. 306-862-7831, 306-862-3086, man travelling gun dealer. Used pivot. ished bison and cull cows. COD, paying HOM E RAIS ED o n e iro n elite Bla ck An gu s
good cond; Cultivators, augers, etc. Mack- Nipawin, SK. We buy and sell used irrigation equipment. market prices. “Producers working with EX POS ED fo rApril 1s tca lvin g.
lin, SK. 306-753-8069 or 306-753-2842. 1997 45’ LODE-KING alum. combo trailer, Call 306-867-9461, Outlook, SK. Producers.” 306-231-9110, Quill Lake, SK. Gu a ra n teed preg tes tto term s .
$7500; 5000 IHC dsl. 24’ swather w/UII BEV’S FISH & SEAFOOD LTD., buy di- BERKLEY 6” PTO PUMP, suction line and
QUIT FARMING: 2008 CIH 8010 combine PU reel, $6900; 20’ UII PU reel, $2000; rect, fresh fish: Pickerel, Northern Pike, intake screen, very good, $5000. WANTED BISON: PURCHASING finished Com e ea rly forBEEF ON A BUN
4 WD, 30’ flex draper, $200,000; 2008 STX Flexi-Coil 65 100’ sprayer, $2700; JD 8 row Whitefish and Lake Trout. Seafood also 306-382-9024, Saskatoon, SK. bison, yearling bison, mature bison bulls served b y S ha una von 4H Club
430, 4 WD, new 680x42 tires, $160,000; 22” all crop head, $4500; JD 15’ head available. Phone toll free 1-877-434-7477, RAIN MAKER IRRIGATION Zimmatic by and cows. 403-783-0356, 403-783-0378, LIVE M US IC to follow a ftersa le
2011 Farm King 13x85 auger, hyd. swing, w/sunflower pans, $1500; Grain dryer, 306-763-8277, Prince Albert, SK. Lindsay pivots/Greenfield mini pivots, K- Rimbey, AB. [email protected]
hyd. lift on swing, $18,000; 2013 Geringh- CMS 14E continuous multi-stage, $5000; Line towable irrigation, spare parts/acces- Bring yourla w n c ha irs
off 8x30” corn chopping header with row JD 7100 18-row planter, $4000; 3 PTH, 90’ HAY RACK log trailers for sale. Call Gord sories, new and used equipment. 33 years 2 HYDRAULIC BISON handling systems:
stompers, $80,000; 2-105 White tractor, sprayer, $3500. 204-325-8019 Winkler MB 306-221-0464, Saskatoon, SK. in business. www.rainmaker-irrigation.com One Balsem special c/w 3 sorting pens; C ON TAC T IN FOR M ATION
rebuilt engine, $7000; 32’ Ezee-On tandem Call 306-867-9606, Outlook, SK. One South River squeeze with sorting alley H LS Office -306-7 7 3-317 4
disc, spring loaded cushing gang, done ELIMINATE DUST WITH ACE DUST LOWEST PRICES IN CANADA on new, high PHIL’S IRRIGATION SALES: Reinke piv- boxes. Both with scales. Call for more in- D ON N IE P EAC OC K-306-662-8288
very little, $25,000; Roadrunner header SUPPRESSANT- safe alternative to quality generator systems. Quality diesel ots, lateral and minigators, pump and used formation, 306-231-9110, Quill Lake, SK. LOR EN M AG N US ON -306-297 -7 5 5 2
haul, $8000; MacDon 30’ draper header, chemicals. We use canola oil, environmen- generators, Winpower PTO tractor driven mainline travelers and pivots. 22 years ex- NORTHFORK- INDUSTRY LEADER for
$20,000; IH 4240 tractor w/15’ mower, tally friendly. Water repellent drying roads alternators, automatic/ manual switch perience. 306-858-7351, Lucky Lake, SK. over 15 years, is looking for finished Bison, Ca ttle c a n sta y a tra nc h until end of
$12,000; Westco 16x30 cult., $1500; Band faster, lasts much longer than calcium gear, and commercial duty Sommers Pow- www.philsirrigation.ca grain or grass fed. “If you have them, we Oc tob er,free ofc ha rge.
sprayer 16x30, $1500. 204-871-0925, chloride. Call Ace Enterprises, Saskatoon, ermaster and Sommers/ Winco portable want them.” Make your final call with
MacGregor, MB. toll free 1-844-291-6582. Or visit our generators and home standby packages. ALUMINUM FRAMED GREENHOUSE Northfork for pricing! Guaranteed prompt QUALITY YEARLING ANGUS BULLS,
website: www.aceenterprises.com 75+ years of reliable service. Contact 20’x30’ incl: gas furnace, tables, electrical payment! 514-643-4447, Winnipeg, MB. semen tested, light to moderate birth
2011 JD 9770 STS, 717/554 hrs, duals, Sommers Motor Generator Sales for all box and exhaust fan. You must dismantle, weight. Ken Bell 306-591-7792, Pense, SK.
Contour-Master; 2012 JD 8285R, 1580 hrs, RETIRED: 1998 JD 7810 tractor, 720 FEL, your generator requirements at $5000. Call 306-738-4905, Gray, SK.
IVT, ILS; 2010 CASE/IH Steiger, 535 HD, shedded, 6260 hrs.; 2005 Ford 350 4x4 1-800-690-2396 [email protected] BLACK ANGUS BULLS, 15 yearlings and
2800 hrs, triples, PTO, Pro 600, high-flow; diesel, auto. PW, PL, 4 door, approx. Online: www.sommersgen.com LAST ONE! 2014 Ferris IS700Z, 61” deck, some 2 year olds, priced to sell. Phone
1996 JD 7600, 12,600 hrs, 740 loader 160,000 kms.; 20 yd. tandem axle, tri- NEW AND USED generators, all sizes from 27 HP commercial, zero-turn, front/rear Merlin Scott 204-835-2087, McCreary, MB.
w/grapple, PQ, 2 valves, 3 PTH, PTO; 2007 dump gravel trailer; 11- U.H.F. radios, 5 kw to 3000 kw, gas, LPG or diesel. Phone suspension, cut up to 5 acres/hour. Year
JD 9620, 4276 hrs, 800x38 duals, PS, base, etc.; 4- 2200 bu. Westeels on hop- for availability and prices. Many used in End Clearance! Cam-Don Motors Ltd. BLACK ANGUS BULLS, two year olds, se-
weights, ASR, premier lights; JD 4755, pers; 4- 1650 Rosco bins (cheap). stock. 204-643-5441, Fraserwood, MB. 306-237-4212, Perdue, SK. men tested, guaranteed breeders. Delivery
10,300 hrs, MFWD, PS, rods, mains and 306-752-3820, 306-921-9920, Melfort, SK. available. 306-287-3900, 306-287-8006,
clutch pack done at 9600 hrs, front fen- Englefeld, SK. skinnerfarmsangus.com
ders; 2001 CIH STX440 quad, 9633 hrs, JOHN DEERE 709 7’ rotary mower, $3500;
PTO, ag-tractor; 2003 CIH MX255, 5920 Also, 18 suitcase weights, $40/each. Call 2 YEAR OLD Black Angus bulls, low birth
hrs, MFWD, PS w/creeper, deluxe cab; 306-697-3469, Grenfell, SK. weight, good performance, good selection
2004 NH TM175, 1600 hrs, MFWD, loader; Rob Garner, 306-946-7946, Simpson, SK.
2009 CAT MT765C, 2720 hrs; 1996 CAT 1997 CUSTOM COACH 5th wheel trailer
CH65D, 6580 hrs, 3 PTH, PTO; 1997 CAT one slide, new roof and awning, 28-1/2’, 2 YEAR OLD BULLS, stout and rugged for
928G wheel loader, 15,168 hrs, AC, cab, 5th wheel hitch available, $10,000 OBO; your cow herd, easy calving for your heif-
bucket, RC, 20.5x25; 2012 JD 612C Stalk- 1979 Ford Ranger Supercab truck, 5 spd. ers. Contact Ernest Gibson, Everblack An-
master header, 12 row, 30”; 2008 JD trans.; Fork type rockpicker; 14’ Hesston gus, Vermilion, AB., 780-853-2422.
612C header, 12 row, 30”, knife rolls, hyd. haybine. 306-722-3579, Fillmore, SK.
deck plates; 1995 JD 1293, 12 row, 30”, PUREBRED BLACK ANGUS long yearling
knife rolls; 1995 JD 893, 8 row, 30”. Call RETIRING: 2- 30’ JD AUTOFOLD 590 bulls, replacement heifers, AI service.
Interstate Equipment Inc., Valley City, swathers; 30’ Premier autofold swather; 2- Meadow Ridge Enterprises, 306-373-9140
ND., 701-845-0013 or 1-800-772-6698 28’ MF #35 swathers; NH 1033 auto bale or 306-270-6628, Saskatoon, SK.
www.IEVCND.com wagon; Walinga grain vac with all updates.
Call 306-638-4550, Findlater, SK. REGISTERED BLACK ANGUS 2 year old
2012 USED 30’ SCHULTE mower, nice con- virgin and yearling bulls. Moderate birth
dition. Call machinery Dave 403-545-2580, WANTED: TRACTOR WEIGHTS, any weights, quiet. Complete performance and
Bow Island, AB. make or model. Call 306-449-2253. ultrasound data available. Contact GBS An-
gus Farm 306-940-9536, Prince Albert, SK.
IH 550 FORAGE HARVESTER; NH 352 mix- WANTED: 25’ TANDEM disc, must be good
mill, NH Hayliner 268 baler, IH 25’ PT condition. 306-662-3385, Golden Prairie, SELLING: BLACK ANGUS bulls. Wayside
swather. All in good condition, shedded, SK. Angus, Henry and Bernie Jungwirth,
not used in many years. Call 306-752-3777 306-256-3607, Cudworth, SK.
or 306-921-6697, Melfort, SK. WANTED: USED BIN CRANE for repair-
ing 1500 - 4000 bu. flat bottom grain bins. ANGUS BULL, REASON for selling, sold
JD 4020 TRACTOR, 7554 hrs.; JD 105 Call 306-241-4022, Saskatoon, SK. cows, health issues. Ready for service. Call
combine; JD 105 combine w/straight cut 306-466-4428, Leask, SK.
header. All shedded. L-240 Morris Chal- WANTED: MF #36 and #360 Discers,
lenger cultivator w/harrows; Kello-Bilt disc all sizes, any condition. Also parts discers. 17-18 MONTH Registered Red Angus bulls,
Series 166; Morris 713 Seed-Rite with Prompt pickup. Ph anytime 306-259-4923, easy calving, quiet, semen tested. Little de
grass seeder; Deep tiller. 204-937-3384, 306-946-9669, 306-946-7923, Young, SK. Ranch, 306-845-2406, Turtleford,SK.
Roblin, MB. Email: [email protected]
WANTED: Older and newer tractors, in SOUTH VIEW RANCH has Red and Black
running condition or for parts. Goods Used Angus yearling and 2 yr. old bulls, semen
Tractor Parts, 1-877-564-8734. and performance tested. Ceylon, SK. Call
Shane 306-869-8074, Keith 306-454-2730.
WANTED: OLDER SP swather, with PU reel,
prefer 18’ or just 14-1/2’ PU reel only. THREE 3 YEAR OLD Red Angus bulls,
306-342-4784, Glaslyn, SK. priced to sell. Phone Merlin Scott
204-835-2087, McCreary, MB.
WANTED: POWER HARROW, 10’ to 20’, in
good cond; 3 PTH sprayer, 60-80’ boom, RED ANGUS BULLS, two year olds, se-
hyd. pump. 306-441-0398, Battleford, SK. men tested, guaranteed breeders. Delivery
available. 306-287-3900, 306-287-8006,
Englefeld, SK. skinnerfarmsangus.com
1-888-92 0-1507 Download the app today
1994 INGERSOL RAND E50 gen set 3.9T Up-to-date
Cummins diesel, 86 HP w/control panel, news,
7610 hrs, 12V, $6950. Financing available. weather,
www.combineworld.com 1-800-667-4515. classifieds
and more.
DIESEL GENSET SALES AND SERVICE,
12 to 300 KW, lots of units in stock, used
and new, Perkins, John Deere, Deutz. We
also build custom gensets. We currently
have special pricing on new John Deere
units. Call for pricing 204-792-7471.
54 CLASSIFIED ADS THE WESTERN PRODUCER, THURSDAY, AUGUST 7, 2014
SUNFLOWER HARVEST SYSTEMS. Call 2014 FARM KING 750 7’ rough cut mower, WANTED: USED, BURNT, old or ugly trac- ZZZQRXWLOLW\ELOOVFRP SPRUCE FOR SALE! Beautiful locally O N E S TO P
for literature. 1-800-735-5848. Lucke Mfg., 3 PTH, never been used, $2800. Creelman, tors. Newer models too! Smith’s Tractor grown trees. Plan ahead and renew your
www.luckemanufacturing.com SK. 306-433-0003 or 306-737-0610. Wrecking, 1-888-676-4847. 3RODU,QGRRU 2XWGRRU:RRG%RLOHUV shelterbelt or landscape a new yardsite, CATTLE FIN AN CIN G
WANTED: LATE MODEL tractor, 50-100 get the year round protection you need.
RETIRING: 7’ JD sickle mower; 9’ NH hay- TRACTOR TOW ROPES and Tow Straps in H P, w i t h f r o n t e n d l o a d e r. P h o n e &RQVWUXFWHGRI$60(6$%RLOHU3ODWH6WHHO We sell on farm near Didsbury, AB. or de- BC, ALBER TA, S AS K.
rake; NH 352 mixmill; NH 327 manure stock at Flaman. Call 1-888-435-2626. 306-997-4905, Borden, SK. liver anywhere in western Canada. Now “ Fa rm e rs He lping Fa rm e rs ”
spreader; NH 1049 bale wagon; and 9’ hay- www.flaman.com 7UDGLWLRQDO (3$3KDVH taking spring bookings. Details phone
bine for parts. 306-856-4443 Conquest, SK MULCHING - TREES, BRUSH, Stumps. 403-586-8733 or check out our website at FOOTHILLS
145 VERSATILE 4 WD, running; MF 860 Call today 306-933-2950. Visit us at: www.didsburysprucefarms.com
RETIRED: JD 9660WTS combine; CIH combine, shedded; MF 860 turbo for parts, www.maverickconstruction.ca 7LWDQ&RDO0XOWL)XHO6WRNHU%RLOHUV LIV ESTO C K C O - O P
MX285 tractor; Westward 9350 swather rubber- good; IH swather w/15’ header; GUARANTEED PRESSURE TREATED fence ,QGRRU&RDO*DV*UDLQ3HOOHW2LO:RRG BISON WANTED - Canadian Prairie Bison Bred cow program !
w/MacDon 25’ triple del.; NDE feed pro- Versatile minimum till hoe drill 21’. Best posts, lumber slabs and rails. Call Lehner %RLOHUV&RRN6WRYHV)LUHSODFHV+HDWHUV is looking to contract grain finished bison
cessor; JD 8200 w/840 loader; JD forage offer or trade on livestock equip. Outlook, Wood Preservers Ltd., ask for Ron for growing markets. Roger Provencher at FeederProgram !
harvester; Bale shredders; Maternity pen; SK., 306-867-4595, 306-867-8833 eves. 306-763-4232, Prince Albert, SK. )XUQDFHV 6WRYHV 306-468-2316. [email protected] Toll Free 1-8 66-8 48 -6669
Panels; Incubators, etc. 306-468-7315, CUSTOM FENCING, WILL travel. Call for NEBRASKA BISON BUYING ALL CLASSES
Canwood, SK. or [email protected] 1983 JD 7721 combine w/JD 912 PU; bookings. 306-221-8806, Asquith, SK. Bison calves, yearlings, adult bulls, cows, No Res triction s ; Pu rcha s e a n d
2000 MacDon Premier PT swather with fin- SPEEDRITE, PATRIOT ELECTRIC FENCERS pairs. All export requirements processed m a rk etin g -You rchoice
ODESSA ROCKPICKER SALES: New De- ger reel; Morris Magnum II 40’ cultivator; and accessories. 306-725-4820, Bulyea, TROPHY ZONE TANNERY, State of the by Nebraska Bison. Contact Randy Miller,
gelman equipment, land rollers, Straw- JD 24’ discers; Int. 310 discers; RiteWay SK., www.lambacres.ca art facility. Hair on tanning for both taxi- 402-430-7058, Nebraska, NE. or e-mail: w w w.foothills lives tock.ca
master, rockpickers, protill, dozer blades. harrow packer drawbar. Located near Din- MASSEY 44 TRACTOR with post pounder, dermy and domestic hides. Quality work [email protected]
306-957-4403, 306-536-5097, Odessa, SK. smore, SK. Please call Cliff 306-846-2175 $1750. Call 306-642-3189, Assiniboia, SK. with fast turnaround. Call anytime 200 BRED COWS, breeding bulls and heif- Roc k y M ou n ta in Hou s e , AB
or email: [email protected] for info. SOLIDLOCK AND TREE ISLAND game wire 403-653-1565 or cell: 406-450-6300, ers. 306-375-7645, Kyle, SK.
QUIT FARMING: BOURGAULT Series III and all accessories for installation. Heights Cardston, AB. Email: [email protected] WANTED: CALVES AND Yearlings. Call Swift Current, Sask.
850 sprayer, new Bubble Jet nozzles; JD FARM CHEMICAL/ SEED COMPLAINTS from 26” to 120”. Ideal for elk, deer, bison, Ryan 306-646-4974 or cell: 306-646-7743
590 30’ swather, new reels and knife. We also specialize in: Crop insurance ap- sheep, swine, cattle, etc. Tom Jensen 1/4” TREAD PLATE or checker plate, vari- Fairlight, SK. M A GNUS ON R A NC H
306-264-3660, Glenbain, SK. peals; Spray drift; Residual herbicide; Cus- ph/fax 306-426-2305, Smeaton, SK. ous sizes, $7/sq. ft. 306-538-4685, LOOKING FOR ALL class of bison from
tom operator issues; Equip. malfunction. 306-736-7146, Kennedy, SK. yearling to cow/calf pairs and big bulls. Th urs da y, Augus t 21, 2014
B.F. MECHANICAL LTD. Authorized Dealer Call Back-Track Investigations for assis- BLOCKED AND SPLIT seasoned Spruce Phone Kevin 306-429-2029, Glenavon, SK. Sa le a t 1:00 p m a t Fa rm
of Sunnybrook Welding Box Concaves tance and compensation 1-866-882-4779. firewood. Call V&R Sawing, 306-232-5488, IRRIGATION EQUIPMENT or move wa- WANTED TO PURCHASE cull bison bulls Com p le te 100 h e a d dis p e rs a l,
for rotorary and axial flow combines. Elias Rosthern, SK. ter? 6”-10” pipe, 4 cyl. motor and pump and cows for slaughter. Oak Ridge Meats
Reliabelt grain belt augers, highest ca- LEON ROCKPICKER #3000, $2395; Flexi- BLOCKED SEASONED JACK Pine firewood on cart, $4500. 403-308-1400, Taber, AB. 204-835-2365 204-476-0147 McCreary MB fe a turin g 8 5 Pa ir a n d 15 b re d h e ife rs .
pacity grain belt augers. The most innova- Coil 10x65 auger, $2200; 50’ Bourgault and wood chips for sale. Lehner Wood Pre- IRRIGATION TURBINE WATER pumps, ELK VALLEY RANCHES, buying all ages Directio n s : L ittle 6 grid o n #722 grid
tive technology for your farming needs. packer bar w/Valmar, $4895; 50’ Flexi-Coil servers Ltd., 306-763-4232, Prince Albert, 6”-8”, 4 cyl. dsl., 600-1000 gal./min., very of feeder bison. Call Frank 780-846-2980, 17 m iles ea s to fS ha u n a vo n , S K .
Call Brady at 306-741-7968. System 95, $3495; 40’ Bourgault cult., SK. Will deliver. Self-unloading trailer. efficient. 403-878-6302, Grassy Lake, AB. Kitscoty, AB. or [email protected] 3-1/2 m iles s o u th
$4750; 32’ Morris deep tillage cult., $1800. WESTERN IRRIGATION - Large supply of 1/2 m ile w es t to s eco n d ya rd
SOLD CATTLE: 2090 and 2290 Case trac- Call Curtis 306-883-2468, 780-891-7334, FIREWOOD: Cut and split, delivery new and used irrigation equipment. Cad- SASKOTA NATURAL is looking for fin-
tors; 8430 JD 4WD; 2 older cattle trailers, Spiritwood, SK. available. 306-862-7831, 306-862-3086, man travelling gun dealer. Used pivot. ished bison and cull cows. COD, paying HOM E RAIS ED o n e iro n elite Bla ck An gu s
good cond; Cultivators, augers, etc. Mack- Nipawin, SK. We buy and sell used irrigation equipment. market prices. “Producers working with EX POS ED fo rApril 1s tca lvin g.
lin, SK. 306-753-8069 or 306-753-2842. 1997 45’ LODE-KING alum. combo trailer, Call 306-867-9461, Outlook, SK. Producers.” 306-231-9110, Quill Lake, SK. Gu a ra n teed preg tes tto term s .
$7500; 5000 IHC dsl. 24’ swather w/UII BEV’S FISH & SEAFOOD LTD., buy di- BERKLEY 6” PTO PUMP, suction line and
QUIT FARMING: 2008 CIH 8010 combine PU reel, $6900; 20’ UII PU reel, $2000; rect, fresh fish: Pickerel, Northern Pike, intake screen, very good, $5000. WANTED BISON: PURCHASING finished Com e ea rly forBEEF ON A BUN
4 WD, 30’ flex draper, $200,000; 2008 STX Flexi-Coil 65 100’ sprayer, $2700; JD 8 row Whitefish and Lake Trout. Seafood also 306-382-9024, Saskatoon, SK. bison, yearling bison, mature bison bulls served b y S ha una von 4H Club
430, 4 WD, new 680x42 tires, $160,000; 22” all crop head, $4500; JD 15’ head available. Phone toll free 1-877-434-7477, RAIN MAKER IRRIGATION Zimmatic by and cows. 403-783-0356, 403-783-0378, LIVE M US IC to follow a ftersa le
2011 Farm King 13x85 auger, hyd. swing, w/sunflower pans, $1500; Grain dryer, 306-763-8277, Prince Albert, SK. Lindsay pivots/Greenfield mini pivots, K- Rimbey, AB. [email protected]
hyd. lift on swing, $18,000; 2013 Geringh- CMS 14E continuous multi-stage, $5000; Line towable irrigation, spare parts/acces- Bring yourla w n c ha irs
off 8x30” corn chopping header with row JD 7100 18-row planter, $4000; 3 PTH, 90’ HAY RACK log trailers for sale. Call Gord sories, new and used equipment. 33 years 2 HYDRAULIC BISON handling systems:
stompers, $80,000; 2-105 White tractor, sprayer, $3500. 204-325-8019 Winkler MB 306-221-0464, Saskatoon, SK. in business. www.rainmaker-irrigation.com One Balsem special c/w 3 sorting pens; C ON TAC T IN FOR M ATION
rebuilt engine, $7000; 32’ Ezee-On tandem Call 306-867-9606, Outlook, SK. One South River squeeze with sorting alley H LS Office -306-7 7 3-317 4
disc, spring loaded cushing gang, done ELIMINATE DUST WITH ACE DUST LOWEST PRICES IN CANADA on new, high PHIL’S IRRIGATION SALES: Reinke piv- boxes. Both with scales. Call for more in- D ON N IE P EAC OC K-306-662-8288
very little, $25,000; Roadrunner header SUPPRESSANT- safe alternative to quality generator systems. Quality diesel ots, lateral and minigators, pump and used formation, 306-231-9110, Quill Lake, SK. LOR EN M AG N US ON -306-297 -7 5 5 2
haul, $8000; MacDon 30’ draper header, chemicals. We use canola oil, environmen- generators, Winpower PTO tractor driven mainline travelers and pivots. 22 years ex- NORTHFORK- INDUSTRY LEADER for
$20,000; IH 4240 tractor w/15’ mower, tally friendly. Water repellent drying roads alternators, automatic/ manual switch perience. 306-858-7351, Lucky Lake, SK. over 15 years, is looking for finished Bison, Ca ttle c a n sta y a tra nc h until end of
$12,000; Westco 16x30 cult., $1500; Band faster, lasts much longer than calcium gear, and commercial duty Sommers Pow- www.philsirrigation.ca grain or grass fed. “If you have them, we Oc tob er,free ofc ha rge.
sprayer 16x30, $1500. 204-871-0925, chloride. Call Ace Enterprises, Saskatoon, ermaster and Sommers/ Winco portable want them.” Make your final call with
MacGregor, MB. toll free 1-844-291-6582. Or visit our generators and home standby packages. ALUMINUM FRAMED GREENHOUSE Northfork for pricing! Guaranteed prompt QUALITY YEARLING ANGUS BULLS,
website: www.aceenterprises.com 75+ years of reliable service. Contact 20’x30’ incl: gas furnace, tables, electrical payment! 514-643-4447, Winnipeg, MB. semen tested, light to moderate birth
2011 JD 9770 STS, 717/554 hrs, duals, Sommers Motor Generator Sales for all box and exhaust fan. You must dismantle, weight. Ken Bell 306-591-7792, Pense, SK.
Contour-Master; 2012 JD 8285R, 1580 hrs, RETIRED: 1998 JD 7810 tractor, 720 FEL, your generator requirements at $5000. Call 306-738-4905, Gray, SK.
IVT, ILS; 2010 CASE/IH Steiger, 535 HD, shedded, 6260 hrs.; 2005 Ford 350 4x4 1-800-690-2396 [email protected] BLACK ANGUS BULLS, 15 yearlings and
2800 hrs, triples, PTO, Pro 600, high-flow; diesel, auto. PW, PL, 4 door, approx. Online: www.sommersgen.com LAST ONE! 2014 Ferris IS700Z, 61” deck, some 2 year olds, priced to sell. Phone
1996 JD 7600, 12,600 hrs, 740 loader 160,000 kms.; 20 yd. tandem axle, tri- NEW AND USED generators, all sizes from 27 HP commercial, zero-turn, front/rear Merlin Scott 204-835-2087, McCreary, MB.
w/grapple, PQ, 2 valves, 3 PTH, PTO; 2007 dump gravel trailer; 11- U.H.F. radios, 5 kw to 3000 kw, gas, LPG or diesel. Phone suspension, cut up to 5 acres/hour. Year
JD 9620, 4276 hrs, 800x38 duals, PS, base, etc.; 4- 2200 bu. Westeels on hop- for availability and prices. Many used in End Clearance! Cam-Don Motors Ltd. BLACK ANGUS BULLS, two year olds, se-
weights, ASR, premier lights; JD 4755, pers; 4- 1650 Rosco bins (cheap). stock. 204-643-5441, Fraserwood, MB. 306-237-4212, Perdue, SK. men tested, guaranteed breeders. Delivery
10,300 hrs, MFWD, PS, rods, mains and 306-752-3820, 306-921-9920, Melfort, SK. available. 306-287-3900, 306-287-8006,
clutch pack done at 9600 hrs, front fen- Englefeld, SK. skinnerfarmsangus.com
ders; 2001 CIH STX440 quad, 9633 hrs, JOHN DEERE 709 7’ rotary mower, $3500;
PTO, ag-tractor; 2003 CIH MX255, 5920 Also, 18 suitcase weights, $40/each. Call 2 YEAR OLD Black Angus bulls, low birth
hrs, MFWD, PS w/creeper, deluxe cab; 306-697-3469, Grenfell, SK. weight, good performance, good selection
2004 NH TM175, 1600 hrs, MFWD, loader; Rob Garner, 306-946-7946, Simpson, SK.
2009 CAT MT765C, 2720 hrs; 1996 CAT 1997 CUSTOM COACH 5th wheel trailer
CH65D, 6580 hrs, 3 PTH, PTO; 1997 CAT one slide, new roof and awning, 28-1/2’, 2 YEAR OLD BULLS, stout and rugged for
928G wheel loader, 15,168 hrs, AC, cab, 5th wheel hitch available, $10,000 OBO; your cow herd, easy calving for your heif-
bucket, RC, 20.5x25; 2012 JD 612C Stalk- 1979 Ford Ranger Supercab truck, 5 spd. ers. Contact Ernest Gibson, Everblack An-
master header, 12 row, 30”; 2008 JD trans.; Fork type rockpicker; 14’ Hesston gus, Vermilion, AB., 780-853-2422.
612C header, 12 row, 30”, knife rolls, hyd. haybine. 306-722-3579, Fillmore, SK.
deck plates; 1995 JD 1293, 12 row, 30”, PUREBRED BLACK ANGUS long yearling
knife rolls; 1995 JD 893, 8 row, 30”. Call RETIRING: 2- 30’ JD AUTOFOLD 590 bulls, replacement heifers, AI service.
Interstate Equipment Inc., Valley City, swathers; 30’ Premier autofold swather; 2- Meadow Ridge Enterprises, 306-373-9140
ND., 701-845-0013 or 1-800-772-6698 28’ MF #35 swathers; NH 1033 auto bale or 306-270-6628, Saskatoon, SK.
www.IEVCND.com wagon; Walinga grain vac with all updates.
Call 306-638-4550, Findlater, SK. REGISTERED BLACK ANGUS 2 year old
2012 USED 30’ SCHULTE mower, nice con- virgin and yearling bulls. Moderate birth
dition. Call machinery Dave 403-545-2580, WANTED: TRACTOR WEIGHTS, any weights, quiet. Complete performance and
Bow Island, AB. make or model. Call 306-449-2253. ultrasound data available. Contact GBS An-
gus Farm 306-940-9536, Prince Albert, SK.
IH 550 FORAGE HARVESTER; NH 352 mix- WANTED: 25’ TANDEM disc, must be good
mill, NH Hayliner 268 baler, IH 25’ PT condition. 306-662-3385, Golden Prairie, SELLING: BLACK ANGUS bulls. Wayside
swather. All in good condition, shedded, SK. Angus, Henry and Bernie Jungwirth,
not used in many years. Call 306-752-3777 306-256-3607, Cudworth, SK.
or 306-921-6697, Melfort, SK. WANTED: USED BIN CRANE for repair-
ing 1500 - 4000 bu. flat bottom grain bins. ANGUS BULL, REASON for selling, sold
JD 4020 TRACTOR, 7554 hrs.; JD 105 Call 306-241-4022, Saskatoon, SK. cows, health issues. Ready for service. Call
combine; JD 105 combine w/straight cut 306-466-4428, Leask, SK.
header. All shedded. L-240 Morris Chal- WANTED: MF #36 and #360 Discers,
lenger cultivator w/harrows; Kello-Bilt disc all sizes, any condition. Also parts discers. 17-18 MONTH Registered Red Angus bulls,
Series 166; Morris 713 Seed-Rite with Prompt pickup. Ph anytime 306-259-4923, easy calving, quiet, semen tested. Little de
grass seeder; Deep tiller. 204-937-3384, 306-946-9669, 306-946-7923, Young, SK. Ranch, 306-845-2406, Turtleford,SK.
Roblin, MB. Email: [email protected]
WANTED: Older and newer tractors, in SOUTH VIEW RANCH has Red and Black
running condition or for parts. Goods Used Angus yearling and 2 yr. old bulls, semen
Tractor Parts, 1-877-564-8734. and performance tested. Ceylon, SK. Call
Shane 306-869-8074, Keith 306-454-2730.
WANTED: OLDER SP swather, with PU reel,
prefer 18’ or just 14-1/2’ PU reel only. THREE 3 YEAR OLD Red Angus bulls,
306-342-4784, Glaslyn, SK. priced to sell. Phone Merlin Scott
204-835-2087, McCreary, MB.
WANTED: POWER HARROW, 10’ to 20’, in
good cond; 3 PTH sprayer, 60-80’ boom, RED ANGUS BULLS, two year olds, se-
hyd. pump. 306-441-0398, Battleford, SK. men tested, guaranteed breeders. Delivery
available. 306-287-3900, 306-287-8006,
Englefeld, SK. skinnerfarmsangus.com
1-888-92 0-1507 Download the app today
1994 INGERSOL RAND E50 gen set 3.9T Up-to-date
Cummins diesel, 86 HP w/control panel, news,
7610 hrs, 12V, $6950. Financing available. weather,
www.combineworld.com 1-800-667-4515. classifieds
and more.
DIESEL GENSET SALES AND SERVICE,
12 to 300 KW, lots of units in stock, used
and new, Perkins, John Deere, Deutz. We
also build custom gensets. We currently
have special pricing on new John Deere
units. Call for pricing 204-792-7471.
THE WESTERN PRODUCER, THURSDAY, AUGUST 7, 2014 CLASSIFIED ADS 61
REQUEST FOR PROPOSALS. Egg Farm- MECHANIC WANTED, full or part-time, 3 SHEET METAL INSTALLERS needed. Full- CLASS 1A HD Tow Truck Driver required LEASED OPERATORS WANTED: P&K Farm
ers of Newfoundland and Labrador (EFNL) machinery, vehicles and small equipment. time year-round employment in Edmon- for Lloydminster, AB. area. Permanent full- Trucking Ltd. looking for leased operators.
is a non-profit entity and was formed in Please contact Jamie 306-352-1440, Regi- ton, AB. and area. $25.50 - 29./hour to time position. Will train. Abstract required. We offer fuel cards with volume discount
1970 to govern provincial egg production na, SK. or email: [email protected] start depending on experience, plus bene- John 780-846-0002 or fax 780-846-0005, and a benefit plan. We operate primarily in
according to federal-provincial agree- fits: Extended Health Coverage, Life and [email protected] SK., AB., MB., North Dakota and Montana.
ments. EFNL are presently requesting pro- LABOURER WANTED, $16/hr. Exp. in fork- Long Term Disability Insurance after 3 Fax abstract and resume to: 306-957-0003.
posals from firms or individuals to provide lift and powerjack handling. Sun Country months probation period. Minimum 6 CLASS 1 AND 3 Vac/Water/Tractor Trailer 306-531-4641, 306-957-0002, Odessa, SK.
a “current state” assessment of the supply Farms, 306-283-9225, Langham, SK. years experience as a sheet metal worker Operators, 3 to 5 years driving experience
and demand of feed inputs as it relates installing roof flashings and performing in remote conditions. Knowledge of the A t Enbridge, one of C anada’s Top 100
primarily to NL egg farmers; and secondly, WANTED: MATURE RURAL country person, custom sheet metal work on commercial safe operation of vacuum and/or water Em ployers, w e recognize that it is the
to generate options for analysis, with sup- women welcome. Immediate permanent buildings. Journeyman certificate or truck and auxiliary equipment (Pump, Agi-
ported recommendations for feasible and position for housekeeping, cooking, gener- equivalent is required. Apply with resume tator, TPC etc.). Safety Training: H2S, First
alternative feed input approaches that can al labour, etc. Must be fit, non-smoker at: West Point Roofing Inc., 9810 - 62 Aid, TDG, WHMIS, PST/CSTS, Confined
be considered by the NL egg industry w/valid drivers license. Optional live-in Avenue NW, Edmonton, AB., T6E 0E3 or Space (training can be provided). Please
which have high potential for commercial room and board w/private quarters. Rural email: [email protected] or email current resume, drivers abstract and
success. The overarching goal of this study fax: 780-435-0436. safety certificates to: [email protected] or
fax to: 403-201-3684, Calgary, AB. Lac La
is to enhance the competitive position of setting in Edmonton, AB. Excellent secure talent and inspiration of our dedicated
Biche, AB. and Fort McMurray, AB.
egg farmers in Newfoundland and Labra- home for the right, responsible and trust-
dor. This is a competitive process, and en- worthy person. Top wages paid based on WANTED: 1A DRIVER for Super B grain team thathave positioned us as a leader
quiries and proposals will be kept confi- performance. 780-472-6202 for interview. hauling, local hauling. Housing available. in the safe and reliable delivery of
dential. Proposals received after 12 noon, 306-677-7303, Hodgeville, SK. energy in N orth A m erica.
August 29 Newfoundland Time, will not PARTS PERSO N REQ UIRED HIR IN G IM M EDIATELY CLASS 1A DRIVER WANTED to haul cat- If you are looking to w ork w ith a grow ing and innovative com pany that
be considered and will be returned W ellEsta blished M u ltilin e tle, grain, and feed for Buffalo Plains Cattle shares its successes w ith its em ployees w hile supporting them in reaching
Agricu ltu ra lDea lership in Ea st Ag Equipment Co. Experience and a good driving record their fullpotentialand a rew arding role w ith greatw ork-life balance w ithin
unopened. If you or your firm has capa- Cen tra lAlberta IsLo o kin g Fo rAn required. Competitive salary and group an excellentteam environm ent,then apply today!
bilities and interest to receive a detailed Ho n est,Aggressive & Am bitio u s Mechanic/Repair benefits avail. Fax resume 306-638-3150
Request for Proposal package, please or call Kristen, 306-631-8769, Bethune, SK SENIO R M ECHANICAL TECHNICIANS
visit the website link below or contact: PARTS PERSO N . Person Positions available in
Mary Oliver, email [email protected] Tru ck Driver sW a n ted Crom er,M anitoba and Loreburn,Saskatchew an
Agricu ltu ra lBa ckgro u n d a n d $35/ho u r+ b en efits &
Egg Farmers of Newfoundland and Labra- Co m pu terExperien ceW o u ld pen sio n pla n . ~Big g a r Tr a n s p or t~ W orking for Enbridge as a skilled Industrial M echanic/M illw right or
equivalentyou can expectto w ork in a safe, respectfuland friendly team
dor, Box 175, Mount Pearl, NL, A1N 2C2. Be An Asset. Du ties in clu d e: sho p w o rk Co m pa n yDrivers& Lea sed O pera to rs environm ent.
Phone: 709-722-2953. View RFP at: co o rd in a tio n , pa rts o rd erin g, to pu llSu perB’sin bu lkgra in &
www.nleggs.ca in the submenu under Fu ll-Tim e Po sitio n , $15 to $20 per fertilizerd ivisio n A n alternate w ork schedule is offered for a great w ork/life balance and
ho u r.Ben efits,(a fter6 m o n th perio d ). w eekend w ork is not typical. Excellent pension plan, yearly perform ance
“Contact Us”. EFNL will negotiate contract bonuses as w ellas various other exceptionalbenefits included.Stable w ork
Plea se Fo rw a rd Resu m esto M a rca t w ith opportunitiesforcareergrow th.
terms upon selection. All contracts are G ra tto n Co u lee AgriPa rtsLtd .,
subject to review by EFNL legal counsel,
and a project will be awarded upon signing
of an agreement or contract, which out-
lines terms, scope, budget and other nec-
essary items.
COMBINE AND SWATHER operator re- B o x 4 1,Irm a ,AB T0B 2H 0 o r m a chin ery o pera tio n & testin g, Co m petitive w a ges& ben efits& A com prehensive relocation program isavailable forqualified candidates.
quired 25 minutes east of Saskatoon. Ex- S en d Fa x to 780-75 4 -2333. m a chin ery repa ir. Sign in g Bo n u s C rom er and Loreburn are greatfam ily com m unities and a greatchoice for
perience preferred. Call 306-222-5757. M o d ern sho p, to o ls su pplied . S en d Resu m e& DriversAbstra ctto those w ho enjoy outdoorliving w ith hunting and fishing atyourbackdoor!
SOMEONE EXTREMELY CAPABLE of financ- 30km ea sto f S a ska to o n , S K. ro d p a cik@ tra n sa llg ro u p .co m Fordetailed job descriptionsand inform ation on how to apply,
o r fa x:3 06 -24 2-2077 please visitourw ebsite
ing large amount. Will repay with interest. Ca llCha rlie a t C a ll:Ro d Pa cik
(306) 2 2 1- 3800 o re- m a il 3 06 -24 9-6 85 3 jobs.enbridge.com and reference #24539 and #24546.
Call 306-883-2536, Spiritwood, SK. DIRECTOR VETERINARY RESEARCH and cha rlie@ co m b in ew o rld .co m 3 06 -3 81-6 5 3 5
Please contactC hristy at780-371-5045 w ith inquiries.
Field Compliance Pfizer Canada is currently
FREE RENT, UTILITIES, Bell Expressvue, looking for a Director, Veterinary Research
furnished living quarters available to full- & Field Compliance located in the Brandon/
time employee, single, couple or family. Carberry, Manitoba area. The selected HD TRUCK MECHANIC required for
Individuals will mainly serve customers candidate must have a Doctor of Veterinary small trucking co. in Lloydminster, AB
but will be required to cook and clean as Medicine degree. Please apply via our area. License an asset, but not necessary.
well. Call Wanda, Coderre Bar and Grill, website www.pfizer.ca (Posting # 999819). John 780-846-0002 or fax 780-846-0005,
306-394-2122, 306-631-7440, Coderre, SK 204-728-1511, www.pfizer.ca
[email protected]
WHEAT BREEDING MECHANIC WANTED, full or part-time, Apply today to join an exciting team of leading grain handling equipment manufacturers!
FIELD RESEARCH TECHNICIAN machinery, vehicles and small equipment. Batco is a leading Canadian manufacturer of belt conveyors and REM is the market leader
Please contact Jamie 306-352-1440, Regi- in GrainVac equipment. Both Batco and REM are part of the Ag Growth International
CROP DEVELOPMENT CENTRE, na, SK. or email: [email protected] family, home to over 1600 team members in 11 manufacturing facilities across the world,
UNIVERSITY OF SASKATCHEWAN constantly expanding operations and growing. With competitive salary and benefits
is looking for packages, you don’t want to miss this great opportunity to take your career to the
A full-time Field Research Technician is required in the Spring Wheat next level!
Breeding Program in the Crop Development Centre, Department of Plant OWNER OPERATORS
Sciences, College of Agriculture and Bioresources. & COMPANY DRIVERS Hiring multiple positions including:
Job Description and Duties: The technician will work as part of a research to Haul Livestock. t Welders
team to support breeding and development of improved spring wheat varieties. Competitive Wages, Benefit t Fabricators
The successful candidate will be responsible for breeding nursery and field plot t Equipment Assemblers
establishment, maintenance and harvest, herbicide application, sample Package, Signing Bonus.
organization, crossing, and green house management. Operation of small plot Please stop by Brenda Wilson, Human Resources Manager
equipment including tractors, plot seeders, sprayers, and plot combines will be Please fax in person or send Batco-REM
required. Overtime work, including evenings and weekends will be required at Resume and Abstract to us an email with 201 Industrial Drive, Swift Current, SK S9H 4G5
certain times, particularly during planting (May) and harvest (August/September). your resume: E: [email protected]
The successful candidate will report to the head technician of the breeding 306-242-2077
program, and will assist in training and supervision of junior staff and graduate Or Email to
students in field and field laboratory activities.
[email protected]
Qualifications and Experience: An undergraduate degree or diploma in Or Contact
agriculture or related work experience in a plant-breeding and/or field based
research environment including experience in operation of small plot equipment, Rod Pacik @ 306-249-6853
data collection and management is preferred. Applicants with a M.Sc. or Ph.D.
will not be considered. Experience in data collection and data organization is LOOKING FOR LEASED Operators to run
required, as well as demonstrated experience with data management including the flatdeck across Canada and province wide.
use of MS-Excel®, MS-Word®, and related database software is required as well One Lease-to-Own truck available. Regina,
as a good working knowledge of desktop and handheld computers and software. SK. Phone Denise at 306-757-1448 or
The successful candidate must possess good mechanical skills, be willing to work email to: [email protected]
outdoors, work flexible hours during planting and harvest, and be willing to travel
outside of the Saskatoon area. Must be able to lift and carry up to and including JIMCO FARMING INC. is now hiring Class
25 kgs. Candidates must hold a valid class 5 license and should hold or be 3 and Class 1 truck drivers for fall harvest.
willing to obtain a pesticide applicators license. The position requires a motivated, Call Jim at: 403-575-0069, Coronation, AB.
reliable and well organized person able to work in a multi-disciplinary group
environment. Candidates must possess excellent oral and written communications CO3 ENERGY
skills in the English language.
Is looking for Class 1 Drivers
Salary and Term: Two-year term position with the possibility of extension with a and Leased Operators
possible start date of September 2, 2014. Salary to commensurate with *Competitive Salary
qualifications and experience.
Please email or fax Resume
To apply, please send application via email, including the following with Driver’s Abstract to:
three components: a cover letter, resume, Fax: (403) 526-5315
and the names of three references by August 15, 2014 to: Email: [email protected]
Mr. Mike Grieman BDM TRUCKING LTD., Tessier, SK. is
looking for O/O to haul cattle in Canada
Department of Plant Sciences and USA. Year round work. Benefits. $500
University of Saskatchewan starting bonus. Pay 80% of gross to truck.
51 Campus Drive, Saskatoon SK S7N 5A8 Phone 306-260-9027.
Email to: [email protected]
ROY HARVESTING is now hiring for the
Please Include “ Breeding Field Technician” in the email subject line. Applications 2014 harvest season. Need Truck Drivers
that do not include all requested information will not be considered. Please, no and Combine Operators starting towards
phone calls. We thank all applicants in advance. Only those who are selected for the end of August. Call Chuck
an interview will be contacted. 306-642-0055, Glentworth, SK.
The University of Saskatchew an is strongly com m itted to a diverse and inclusive w orkplace WANTED: DRIVERS/OWNER Operators
that em pow ers all em ployees to reach their full potential. All m em bers of the university for grain and fertilizer hauling, based in
com m unity share a responsibility for developing and m aintaining an environm ent in w hich Kenaston, SK. Phone Leon at TLC Trucking
differences are valued and inclusiveness is practiced.The university w elcom es applications 306-252-2004 or 306-567-8377.
from those w ho w illcontribute to the diversity ofour com m unity.Allqualified candidates are
encouraged to apply; how ever, Canadian citizens and perm anent residents w ill be given
priority.
62 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER NEWS
WATER | MANAGEMENT
Installing tile drainage
a ‘winning proposition’
Yield benefits in wet, dry years | Cost could be up to $600 per acre
BY KAREN BRIERE “This year we had the best looking MIKE KLECKNER Excessive moisture for several years has sparked interest in tile
crop we’ve had in the last 10 years,” MJK AG VENTURES drainage, said Mike Kleckner during an installation demonstration at a
REGINA BUREAU Weisberg said. MJK Ag Ventures field day near Rouleau, Sask. | KAREN BRIERE PHOTO
equipment is seven to 10 years.
ROULEAU, Sask. — Tile drainage “Then we got seven inches of rain. However, some American farmers starting work. land without harming anyone else or
hasn’t traditionally been installed on After the first two inches it was toast.” Kleckner said anyone considering buying more land.
Saskatchewan cropland, but the last have found payback periods of three
several wet years and a backlash He is looking for ways to farm his years because of higher yields. tile drainage should contact the “To me, if everybody tiled and
against agricultural drainage have land without digging drainage agency, which falls under the envi- closed their ditches, it would be bet-
sparked interest in the practice. ditches. Estimates for the Prairies suggest a ronment ministry. There are also ter for everyone,” he said.
cost of $400 to $600 per acre. underground utilities and pipelines
Wayne Weber, designer of the Crary Tile drainage takes some time to to consider. Kleckner thinks it will take time for
Tile Pro plow from Morgan, Minne- work, said Mike Kleckner of MJK Ag Tile drainage will also clean up Saskatchewan farmers to adopt the
sota, predicts a lot more will come. Ventures, who hosted the field day at salinity and increase production, However, neighbours are likely to technology.
his farmyard. particularly on irrigated land. be the main concern.
“This is going to be a new wave of Added Weber: “Education is the
precision farming,” he said at a recent His company has just started to Justin Dugdale, who farms at Pense, Water and drainage have fractured key.… Their biggest fear is how to do
field day and demonstration at MJK offer tile drainage equipment, from Sask., said his family farm intended many a friendship, and Kleckner it.”
Ag Ventures near Rouleau. tile to the required electronics to the to buy the first unit that Kleckner advised meeting with neighbours or
plows, in response to what he has brought in with a view to draining forming a conservation and develop- However, he said new computer
Weber said changing climate and seen farming on the heavy clay of the into a creek. ment district to work together to software is available that helps farm-
weather patterns have farmers won- Regina plains. develop a drainage plan. ers determine where to place the tile.
dering where water they aren’t used He and other farmers in his area are
to dealing with should go. However, “It’s not an overnight fix,” said struggling with soil saturation. The water has to go somewhere, he Visit us online at
the benefits extend past wet years. Kleckner, who operates a custom said. www.producer.com
spraying, swathing and hauling busi- However, he had questions about to see a video about
“Even in a dry year you increase ness. how the pipe would perform in clay “Maybe it’s your own place you this story.
yields,” he said. “It’s an all-round soil, which is prone to heaving, and sacrifice.”
winning proposition.” “It takes time to get the soil trained.” when he would find the time to install
Tile drainage is designed to remove the tile. Weisberg said he likes the idea of
Tim Weisberg drove several hours subsurface moisture and allow oxy- increasing productivity on his own
from his farm southwest of Melfort, gen to get at plant roots. The roots Dugdale also said he would obtain
Sask., to the field day in a search of a develop better, which improves the proper permits from Saskatche-
solution to soil moisture in his yields. wan’s Water Security Agency before
region. Pipes placed about a metre below
the surface catch water and move it to
“We don’t have big bodies of water,” an outlet located at a lower elevation.
he said. “But probably since the fall of Typically it has been used on high-
’05 we’ve been wet.” er-value vegetable crops because the
payback time for installation and
The land is so saturated that at
times it’s difficult to walk on.
AGRONOMY | SEEDING SYSTEM
Syngenta deal allows artificial seed technology to proceed
BY JEFFREY CARTER apply the planting system to the Bra- work with miscanthus. The perenni- cise drilling and high density planta- company. It will allow for a higher
zilian sugar cane industry. al species has been touted as an alter- tions. Miscanthus growers initially multiplication rate with lower costs
FOR THE WESTERN PRODUCER native to natural gas for heating planted underground stems called per ton compared to conventional
“The licence agreement with Syn- greenhouses and as a feedstock for rhizomes, which was a costly planting systems.
LEAMINGTON, Ont. — The dream genta creates a huge opportunity for biogas production, but it has not yet approach with mixed results. The
of two Ontario entrepreneurs is both partners to introduce signifi- been able to fully compete in the later development of plug plants was The target market is five million
beginning to bear fruit now that Syn- cant benefits to sugar cane growers North American marketplace. an improvement but still expensive. acres of sugar cane planted annually
genta has signed a technology use and sugar and bio-ethanol produc- in Brazil. Commercialization is
agreement. ers in Brazil,” Carver said. Other projects include arundo The artificial seed technology and expected by 2017.
donax and Napier grass. other advances are expected to
The Crop Expansion Encapsula- “We have been working in peren- increase miscanthus yields to almost “This will make the planting pro-
tion and Drilling System (CEEDS), nial grass propagation for 20 years. The CEEDS technology involves a 100 percent of their potential in as cess for growers more efficient and
which was developed by Paul Carver Sugar cane is the largest market for coating that may also contain insec- little as two years. will bring them high quality genetic
and the late Dean Tiessen at New these types of perennial grasses.… ticide and bio-stimulants. The vege- material at scale,” said Syngenta chief
Energy Farms (NEF), allows material We hope this will assist other areas of tative pieces can be stored in a cold Syngenta plans to incorporate operation officer John Atkin.
used for vegetative propagation to be our business where we have crops for room for six months or longer, CEEDS with its PLENE platform of
treated like seed. fuel and fibre markets.” depending on the species. integrated sugar cane solutions, “By multiplying in a controlled
according to a news release from the environment, we can eliminate field
The agricultural giant plans to NEF may be better known for its The technology also allows for pre- production uncertainties.”
NEWS 63THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
FEELING BLUE ALL OVER
Flax is in full bloom in Gerald Ylioja’s field near Birsay, Sask. Saskatchewan typically grows 75 percent of the flax in Canada. | JOLINE YLIOJA PHOTO
RESEARCH | FIELD TOUR RESEARCH | TOMATOES
Sask. college, Tomato upgrade comes with purple hue
research facility Packed with anthocyans | The nutritious purple tomato has been found to have anti-inflammatory properties
partner on plots BY JEFFREY CARTER
BY CALVIN DANIELS FOR THE WESTERN PRODUCER
FREELANCE WRITER RIDGETOWN, Ont. — The search then enhancing positive traits. cover crops in vegetable-production LEFT: Steve Loewen is working
for a healthier processing tomato The results are lines that commer- rotations are an economically viable with 1,200 breeding lines in this
YORKTON, Sask. — Crops are continues at the University of option with improved yields paying sandy-loam field near Ridgetown,
growing well this year at a research Guelph’s Ridgetown Campus. cial breeders can use. for the cover crop and sometimes Ont. | JEFFREY CARTER PHOTOS
facility in Yorkton run by Parkland An objective that has so far eluded paying a dividend.
College and the East Central Re- Researcher Steven Loewen told a ABOVE: There are now about 200
search Foundation. Vegetable Day held on the campus Loewen is the development of Long-term plots that use the acres of okra in Ontario, enough
July 17 that he now has a line of pur- tomato lines resistant to bacterial 17-point Cornell Soil Health Test as to offset just a small percentage
Researchers are testing soybean ple-skinned tomatoes. disease. He had been using a hori- an evaluation tool have demon- of what’s imported to Canada.
varieties by seeding date, canary- zontal breeding technique to devel- strated that wheat in the rotation
seed fertility, oat varieties by nitro- Unlike heritage tomatoes, which op multi-gene resistance but later benefits soil health in Ontario. Vegetable Growers Association,
gen rate, wheat and canola with are often more brown than purple, abandoned the effort. which sees an opportunity to re-
environmentally smart nitrogen Loewen said his purple tomato has However, while farmers recognize place imports.
technology, wheat fungicide timing an eggplant-like colour on the out- Phil Richards, a tomato grower the benefits of rotation, they also pay
and cereal forage. side and is deep red inside. near Dresden, Ont., said bacterial attention to commodity prices. For example, Ontario’s okra pro-
spot is a significant problem this duction meets only five percent of
The facility recently held a field The purple hue is associated with year. The canopy sags in affected As a result, more than 2.5 million the demand, although field produc-
tour to check on the plots’ progress, higher levels of anthocyans, which fields as the disease moves from acres of soybeans were planted in tion in the province is limited to mid
but researcher Mike Hall said the are reputed to have a wide range of lower leaves upward. Ontario this year compared to less to late summer.
important information will come health benefits. Recent research at than two million acres of corn and
early next year when the reports are the U of G and in China has demon- Other work at Ridgetown focuses 750,000 acres of wheat. About 200 acres of okra are now
written. strated an antioxidant effect. on pesticide evaluation, the benefit grown in Ontario, said Michael
of cover crops and a rotational Okra and Asian-type eggplant Brownridge of Agriculture Canada.
“We’re in the process of building a “They applied it to an animal study. varieties are being evaluated in
website (connected to the college model by feeding those tomatoes to Ridgetown for the first time as part of The crop is handpicked by work-
site),” he said. “The results will be rats,” he said. Trials conducted by Laura Van a project led by the Ontario Fruit and ers who repeatedly sweep through
available there.” Eerd show that the long-term use of fields. Much of the okra exported
“They found it reduced inflamma- to Canada originates in Central
Hall said the 12 research projects tion, and the effect was dose depen- America.
were selected based on a variety of dent. What we’re trying to do is to
sources. take a tomato that’s already very Sweet potatoes, which can be
good from a nutritional standpoint stored for more than a year, also have
The East Central Research Foun- and make it even better.” potential in Ontario. Most of the
dation is one of eight producer- increased demand has been driven
directed research and demonstra- The purple tomato is just one of by the popularity of sweet potato
tion groups in Saskatchewan that Loewen’s many projects. He’s also fries.
make up the Agriculture — Applied working with 1,200 breeding lines in
Research Management (Agri-ARM) a search for better agronomic char-
network. The network members acteristics, improved yields and
often share research ideas and repli- greater genetic diversity.
cate projects to provide more broad-
ly based results for relevance over a It’s a long-term effort, with another
larger area of the province. breeder making the initial crosses
between wild and commercial lines
“The groups share ideas,” he said. many years ago.
In other instances, an idea can
come from the foundation board, Loewen has been focusing on the
which includes local farmers. They positive traits of poorly adapted
may want to see research into spe- material, eliminating line defects
cific crops and systems that relate through a backcrossing process and
directly to local farming.
“Projects are supposed to be farm- RESEARCH | ONIONS, GARLIC
er driven,” he said.
This year’s projects will all provide Gardeners’ help sought in solving issue affecting garlic, onions
data that can be related back to pro-
duction on farms in east-central BY MARY MACARTHUR the bottom of the problem. decline or death, or in some cases grown in the province, but it is
Saskatchewan. He said one cause is aster yellows, the problem carries on into storage,” prevalent.
Hall said the partnership between CAMROSE BUREAU Spencer said. “We want to figure out
Parkland College and the research the disease that damaged canola what is happening.” “Everybody has got some.”
foundation officially began with the Alberta Agriculture’s horticulture crops a couple years ago. About 1,000 acres of onions are
signing of a memorandum of under- branch is trying to sleuth out why Gardeners are asked to report and grown commercially in the prov-
standing last year, which led to the some onion and garlic crops have However, it’s not the only factor collect plants with suspicious symp- ince, as well as small amounts of
collaborative work on agriculture reduced yield, poor storability and causing problems. toms as the first step to finding out onions on Hutterite colonies and in
applied research projects. overall poor performance. what diseases and insects are hitting market gardens.
Hall said the college opens doors to Fungal diseases such as white rot, the onion and garlic crops. It’s hoped Growers who want to submit sam-
additional research funding sources Horticulturalist Rob Spencer said fusarium basal plate rot and embel- solutions will follow. ples are asked to contact Spencer at
than those the foundation can the department is asking home, lisia blotch can all cause problems in the Alberta Ag-Info Centre for col-
access. The plots also provide what is market and commercial gardeners garlic and onions. Parasitic soil Spencer doesn’t have an accurate lecting and shipping instructions.
essentially a living classroom, allow- to report issues in an effort to get to worms are also a concern. estimate of the amount of garlic
ing students to identify weeds field
crop diseases. “We’re seeing poor yield, early
64 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER
SUBSCRIBE.
SUBSCRIPTION/RENEWAL ORDER FORM
Name Account # I would like to give a GIFT SUBSCRIPTION to:
Address
City/Town Postal Code Name Province
Phone ( ) Year of Birth Address
Email City/Town Phone ( )
Two Years: Postal Code Two Years:
One Year:
I’m an active farmer/rancher One Year:
I would like to pay by (check one):
I’m interested in agriculture
Cheque enclosed Visa Mastercard Name
Address
MONTH YEAR City/Town
Postal Code
CARD NUMBER EXPIRY DATE Province
One Year:
Phone ( )
Two Years:
Signature Date
Subscription Prices One Year Two Years
BC, AB, SK, ON & QC residents (GST 5% inc.) $90.55 $168.43 United States US/year $186.85
$181.26
MB residents (GST 5% & PST 8% inc.) $97.45 $184.48 All other countries CDN/year $372.52 Per copy retail add taxes $4.25
NS residents (HST 15% inc.) $99.18
MY BILLING INFORMATION:
Name Account # I would like to pay by (check one): Cheque enclosed Visa Mastercard
Address MONTH YEAR
City/Town Postal Code CARD NUMBER EXPIRY DATE
Phone ( ) Year of Birth Signature Date
Email
Mail to: The Western Producer, Box 2500, Saskatoon, SK S7K 2C4 or Call 1-800-667-6929
What’s the bottom line?
Keep yours in sight
with the
2(#$*/$0.&5"93&$03%4 Prairie Farm Account Book
1SBJSJF'BSN"DDPVOU#PPL The Prairie Farm Account Book
is designed for farm and ranch use. Whether it’s your
$0 primary bookkeeping method or a supplement to computer
programs, the Prairie Farm Account Book is a simple, portable
and affordable ledger to help you keep the books straight.
Prairie Farm Account Books SK & AB $19.43 taxes inc.
P.O. Box 2500, Saskatoon, SK S7K 2C4 MB $20.72 taxes inc.
ON $20.91 taxes inc.
or call toll-free 1-800-667-6929 BC $20.72 taxes inc.
NEWS 65THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
ROAD PAVED WITH GOLD ANIMAL WELFARE | FIGHTING ACTIVISTS
U.S. millionaire eager
to protect agriculture
Forrest Lucas refutes claims made by animal activists
BY MARY MACARTHUR
CAMROSE BUREAU
A dozer clears a path in a canola field northwest of Clairmont, Alta. Residential and commercial subdivisions INDIANAPOLIS, Ind. — An Ameri- FORREST LUCAS
are being built in the County of Grande Prairie near the city outskirts. | RANDY VANDERVEEN PHOTO can multimillionaire who grew up
poor on a southern Indiana farm is ANIMAL ACTIVIST OPPONENT
TECHNOLOGY | RURAL WI-FI taking on animal rights activists.
electricity. That old chicken out there
Field access to wi-fi eases data collection Forrest Lucas said he is standing up was an instant meal. You chopped its
to well-funded animal rights activists head off and you had an instant meal.
BY MARY MACARTHUR Ayrstone Productivity has designed “Farmers were collecting a lot of data who want to stop animal agriculture Every fall we had to kill a pig. A lot of
an antenna mounted on equipment on flash cards and not doing anything because few people are willing to do times I would befriend that pig
CAMROSE BUREAU that provides access to the home with it. This fixes the data problem,” he so. before we killed it. But that is the way
wi-fi. | MARY MACARTHUR PHOTO said during an American Agricultural it had to go.
INDIANAPOLIS, Ind. — A small Editors’ Association conference. “We are punching the hell out of
antenna mounted on top of a tractor, existing wireless network system. these guys,” Lucas said during an agri- “We milked the cows by hand.
sprayer or combine can now give Moffitt said there seemed to be no Moffitt said it wasn’t easy to createa culture event at the Lucas Oil Stadi- Those calves had to be sold because
farmers wi-fi access in the field from device to provide long-distance wi-fi um, home to the Indianapolis Colts of that’s where the money comes from.
their home router. easy way to collect and download all for rural areas. the National Football League. We worked horses. These are ani-
the information produced by mod- mals. We are the masters of animals.
Ayrstone Productivity of Minnesota ern farm equipment. The tendency was to add more Lucas, who raises purebred black We have to take care of our animals. If
created the tractor-based wi-fi system options to thewi-fisystem, headded. Simmental cattle in Missouri, estab- you are going to get the most out of
to give farmers access to their farm lished Protect the Harvest after a law youranimals,youhavetotakecare of
equipments’ production data and use Moffitt wrote computer code spe- designed to limit agriculture in Mis- them, but there has to be an end for
their laptop, smartphones and other cifically to allow wi-fi for the hubs souri was narrowly defeated four them. When that horse is no good for
equipment through the home wi-fi and receivers for use in remote areas years ago. you anymore, it has to have a place to
while in the field. with few people. go.”
“In the state of Missouri, they use
“This is driven by what we heard “It’s designed for people who need the word ‘pet’ in the constitution,” he Lucas’s television production com-
from our customers,” said company good access across their farm.” said. pany is making a documentary about
founder Bill Moffitt. abandoned horses starving to death
Moffitt said some of the company’s “They want to come in and take on public lands in the U.S. He wants
The in-cab hub is the latest addition existing customers use the service for your pets. Anything that lives with- to reintroduce horse slaughter plants
to Ayrstone’s existing rural wi-fi sys- early morning Skype or Face time in 15 feet of your house is your pet. in the United States to allow a better
tem. It allows a home wi-fi to be used conference calls with their employ- We had to do something, and we end of life for abandoned, old and
up to 11 kilometres away through a ees in different parts of the farm. did. When we got done with that, unused horses.
series of hubs. They have also sold hubs and receiv- we realized there was no big com-
ers for campgrounds or arenas with pany out there fighting these guys, “Our country is overfilled with
Moffitt, a California software devel- small numbers of internet users. and we realized we had to do some- horses now,” he said.
oper, and his partner, Robert Hill of thing. We are trying to get every-
Minnesota have created a tiny anten- He said it’s fine for 100 devices to body made knowledgeable about “The whole horse industry wants it
na that can be mounted on a tractor, use the wi-fi system, but 1,000 is too what we are doing. We are going to fixed, but they want me to do it. They
sprayer or combine. The device is many. Trees and two by fours reduce fight these guys, and that is what we don’t want to say anything about it
plugged into the vehicle’s cigarette the distance and effectiveness of the are doing.” and we’re going to do it.”
lighter and will give access to the wi-fi, he added.
home wi-fi through the company’s Lucas said farmers and those who Lucas said his documentary would
The base, receiver and cab antenna believe in agriculture need to stand raise awareness of horses starving to
cost about $500. up against the lies told by groups death and dying of thirst on federal
such as the Humane Society of the Bureau of Land Management land
United States, which he claims want and on Indian reservations.
to ban all production agriculture.
“I am trying to bring it to every-
“We don’t want anybody abusing body’s realization that we have an
their animals, but there are already overpopulation problem,” he said.
laws for that.”
“We need to reintroduce horse
Lucas said his work ethic was slaughter to stop suffering. It’s no
formed by growing up in poverty and good living when you’re starving to
understanding the importance of death.”
livestock for food.
However, he said he also under-
stands the need to have humane
slaughter plants for livestock.
“I know reality,” he said.
“When I was a kid, we didn’t have
It’s about time.
Relax with the paper and say goodbye to the paperwork.
Make the switch! Our new pre-authorized debit option lets you pay
for your subscription easily with monthly payments right from your
account. No paperwork or postage required.
Call us today to sign up.
| |1-800-667-6929 www.producer.com
66 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER IS IT EVER A GOOD TIME
FOR TILLAGE?
PRODUCTION
Compaction and crop residue problems
may spark the need. | Page 69
PRODUCTION EDITOR: MICHAEL RAINE | Ph: 306-665-3592 F: 306-934-2401 | E-MAIL: [email protected]
WATER | FINDING A WELL
When drilling a well, location is everything
Seismo-electric technology | New method for locating groundwater cites 75 to 90 percent success rate
BY RON LYSENG and bigger (water) yields by getting due to centralization of livestock There’s no indication yet that water 50 years ago. Oil prospectors aban-
away from shallows wells that may be production requiring one central witches are applying for employ- doned the old electroseismic tech-
WINNIPEG BUREAU susceptible to surface contamina- well that waters 200 cow-calves, ment insurance, but science is defi- nology because electrical interfer-
tion,” says groundwater specialist which in prior times would have nitely gaining a toehold in the once ence tainted their data.
Farmers are drilling deeper with Gary Kehler of Longview, Alta.. been a number of wells on smaller mysterious realm of locating a good
each passing generation as they look land parcels.” aquifer. In the past two decades, a British
for reliable quantities of good water “Many of the old wells were drilled company, Groundflow, has worked
to support livestock operations. with equipment not even able to go New holes cost $35 to $50 per foot, The technology used in identifying with that seismo-electric technolo-
that deep. In some cases, we are look- and more producers are turning to subterranean water is basically the gy, turning it into one of the primary
“It is simply due to the thinking that ing for more water in a specific area science to find the best drill spot. same as that used in oil exploration methods for locating groundwater.
we can obtain more reliable water
The system produces a sound that
impacts the Earth. The seismic impact
creates a slight electrical signal if
groundwater is present. By analyzing
micro voltage at the pickups, the
computer can tell the operator if
there’s enough water to merit drilling.
The computer also determines the
depth and quantity of water.
The operator typically does six to 12
sonar sounding sites on each property
and then ranks them from the best to
the worst.
No matter where I am, I always
like to see the well logs from
previous wells.
GARY KEHLER
After researching the site and reviewing previous well logs with the landowner, Gary Kehler drills the first of TOP: Copper clad rods are pounded one metre into the soil at a distance
six sounding holes. His equipment is installed on an all-terrain vehicle for better safety and also to turn the of five metres out from the sounding hole. The sounding hole is one
operation into a one man show. metre deep.
ABOVE: Kehler has three different shotgun loads from which to choose,
depending on soil conditions. When he leaves a property, he’ll have 40
to 100 individual data sets that need to be processed before he can give
the client the best drill spot.
PRODUCTION THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014 67
Kehler said a sounding site is the grees of difficulty. He brings data “The hammer also shows me penetrates the deepest so the signal good enough for a 100 head cow-calf
next best thing to a test hole. with him from 80 of the most groundwater near the surface. In gives the best definition.” operation and the family.
common rock formations found in some conditions, it shows me water
Kehler is one of those modern day Western Canada. as deep as 50 metres. And in the Kehler is one of the few operators “As for depth, I always recommend
water witches who uses the latest mountains, the hammer and plate who loads his own shotgun shells, going to the maximum depth. We
AquaLocate Groundflow GF6 sys- “No matter where I am, I always like can tell me if there’s water all the way allowing him to access three differ- always want the well at the bottom of
tem. He started his business, Water- to see the well logs from previous down to 100 metres, so it’s a very ent loads for various ground condi- the aquifer, not the middle or the
Find, 10 years ago in Manitoba. wells,” he said. helpful guide.” tions. top.”
When he realized there was no “I work with the landowner and do The most important weapon in his He said the data is entered in the Kehler said going to the bottom of
money to be made finding water in a what research I can to determine the arsenal is the 12-gauge black computer the nano-second the shot the aquifer is the only way to be sure
province where water often gushes best spots to survey. If none of that powder buffalo gun, and the most is fired. the well keeps supplying water
out of the ground, Kehler moved the information is available, then I go to important item of information is when pumped at the recommended
business to Alberta, where a rapidly my rock formation parameters for logged when he fires it down the However, the field work is only part rate.
expanding livestock sector had guidance.” sounding hole. of the process.
bigger demands for water that was The test should be reviewed by a
becoming more difficult to find. Kehler drills a one metre deep hole The system works much like radar. “There’s a fair amount of analysis hydrologist, he added.
when he has identified sounding The bounce back signal is picked up that needs to be done before I can
“In Alberta, drillers find water sites with the best potential. by the two copper clad rods and give the results or recommend which There’s always a risk of drilling too
where I said they would 90 percent of relayed to the computer, which is is the best drilling spot,” he said. fast when drilling Category A or B
the time. In the mountains, it’s down He then installs one-metre-deep why Kehler takes such care in making wells or wells that may be marginal.
to 75 percent because it’s harder to copper clad rods into the ground sure the rods receive and then relay “That’s why I never give a recom- Low yield wells require patience, and
decipher information coming about three metres to the left and an honest signal. mendation on the day I do the test- that means a patient driller.
through rocks and bedrock. In three metres to the right of the hole. ing. It takes 10 to 14 days to get results
Saskatchewan, it falls between 75 The rods will pick up the return “When I fire a shot, it makes the soil back to the landowner.” Drilling too fast can “skin off” a low
and 90 percent.” signal from the buffalo gun blast and move,” he said. yield aquifer with mud or clay. A
relay it to the computer. Most of the wells in the areas where driller who is in a hurry might also
Kehler concedes that seismo-elec- “That creates a micro voltage that he concentrates his efforts are cate- puttheholerightthrough theaquifer
tric technology is not perfect, but Then he places a metal disc over the can be picked up by the rods. If gories A, B or C. without the client or the driller even
neither is a series of 500 foot dry holes sounding hole and strikes it a mighty there’s water down below the hole, it knowing water was there waiting for
at $50 per foot. blow with a heavy rubber sledge gives off an electrical signal we call a Category A wells give up to three them.
hammer. shimmer, which we see on the gallons per minute, Category B wells
He nearly always works in areas computer. yield three to five g.p.m. and Catego- For more information, contact
where water is difficult to find, and “The resonation tells me if I have ry C wells yield five to 10 g.p.m. Kehler at 877-388-7388 or visit www.
people usually call him when they good connections on all my circuits “The data logging equipment is Potential categories extend to wells findwellwater.ca or aqualocate.com/.
are desperate. and if the rods have good contact triggered when I fire the buffalo gun. that yield hundreds of g.p.m.
with the soil,” he said. It only records for about five thou- What’s your take? Join us
His standard rate is $2,100 for sandths of a second. I typically fire “Anytime I see three or four g.p.m., I at www.producer.com or
southern Alberta, $2,200 for Sask- “If I don’t get good readings with only two shots per hole. automatically apply a risk factor,” he follow us on social media.
atchewan and northern Alberta and the hammer, then I know I have to fix said.
$2,500 for the mountainous regions things before I proceed to fire the After the first shot, the ground starts
of British Columbia and Alberta. buffalo gun down the sounding hole. to loosen up too much, so it doesn’t “I advise the client that Category A
I may use the rubber hammer two or give good transmission. The first shot might mean no water at all or it might
There are hundreds of different three times before I’m satisfied that is always the best shot because it be a small isolated aquifer that goes
rock formations, with varying de- I’m getting honest readings. dry in a short period. But a proven
pump test of two or three g.p.m.
along with a 10,000 gallon tank is
> Empty Pesticide Container Recycling Program
A metal plate is placed over the hole and pounded with a hammer to 1# Only rinsed containers can be recycled
test connections and determine if there is shallow water. In some cases, 2# Helps keep collection sites clean
the hammer and plate can produce a positive water signal as deep 3# Use all the chemicals you purchase
as 30 metres. If the rubber hammer determines there is a fault in the 4# Keeps collection sites safe for workers
connections, the copper clad rods may have to be pulled out and moved. 5# Maintain your farm’s good reputation
No excuse not to!
For more information or to find
a collection site near you visit
cleanfarms.ca
The seismic gun is placed into the Gary Kehler says his success rate is better than 90 percent in most of
one metre deep hole and fired. Alberta. However, in mountainous regions that success rate drops to 75
The trigger automatically activates percent because it’s difficult to decipher data coming from the rocks. In
the data collection devices for a most of Saskatchewan and western Manitoba, his success rate ranges
period 0.005 of a second. It takes from 75 to 90 percent. Prices range from $2,100 to $2,500 depending on
a full day to compete the six to the area. | WILLIAM DEKAY PHOTOS
12 sounding sites Gary Kehler
normally does on a property. The
client normally gets a report within
two weeks.
68 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER PRODUCTION
Anthony Hession of Brownsburg, Indiana, grows 5,000 acres of continuous corn. | MARY MACARTHUR PHOTO
,-*
*!!+, U.S. CORN | YIELD SUCCESS
7KHIXWXUHRI\RXUEXVLQHVVGHVHUYHVDSURIHVVLRQDO Continuous corn cropping
works for Indiana farmer
ΖV\RXUDGYLVRUD3URIHVVLRQDO$JURORJLVW3$J"
%\6DVNDWFKHZDQODZRQO\D3$JFDQSUDFWLFHDJURORJ\ Big yields with hybrid varieties | Farmer says the yields he generates
from growing corn year after year are better than a corn-soybean rotation
-LP%HVVHO$7
BY MARY MACARTHUR ties averaged 210 bushels per acre. It 108 to 113 days maturity to help
$JUL7UHQG$JURORJ\ was the best yielding crop that the spread out harvest.
&DQROD&RXQFLORI&DQDGD CAMROSE BUREAU multi-generational family farm has
-LPDWWHQGHGWKH&ROOHJHRI$JULFXOWXUHDQG ever produced. He plants his corn at 38,000 seeds
%LRUHVRXUFHVDVDPDWXUHVWXGHQWZKLFKIDQQHG BROWNSBURG, Ind. — Most U.S. per acre: rates higher than that don’t
WKHȵDPHVIRUDJULFXOWXUDOSURGXFWLRQ-LP Midwest farmers follow a corn-soy- More rain this year will produce generate the same yields and lower
VSHQWWKHQH[W\HDUVDVDSURGXFWLRQH[SHUW bean rotation, but Hession Farms’ good yields, but Hession doesn’t rates reduce the crop’s standability.
ZLWKWKHFDQRODLQGXVWU\IRFXVLQJRQQHZDQG 5,000 acres are always in corn. think the farm will reach last year’s
LQQRYDWLYHLGHDVWKDWFRPELQHEHVWPDQDJHPHQW good yields. Hession was an early adapter of
SUDFWLFHZLWKDGYDQFHGWHFKQRORJLHV$VDUHVXOW “We feel we are better at producing GPS technology in the mid-1990s,
RIKLVRXWVWDQGLQJZRUNZLWKWKH&DQROD&RXQFLO corn. Year in year out, we consis- Hession seeds hybrid varieties including auto steer and yield map-
RI&DQDGD-LPUHFHQWO\UHFHLYHGWKH4XHHQ tently hit top yields with corn,” said from DeKalb and AgriGold after ping.
(OL]DEHWK'LDPRQG-XELOHH0HGDODVUHFRJQLWLRQIRUKLVFRQWULEXWLRQWR Anthony Hession, whose family emi- years of using Pioneer varieties.
DJULFXOWXUH grated from Ireland in 1837. This year he used drones to help
“We don’t think the new varieties him map a 540 acre piece of land for
ȊΖDPNHHQO\LQWHUHVWHGLQSDUWLFLSDWLQJLQWKHΖQVWLWXWHȇVJURZWKSODQ “Our corn yields can compete with have the grain quality, but they’re tile drainage.
RIDWWUDFWLQJWKHQH[WJHQHUDWLRQRISURIHVVLRQDOVDQGVXSSRUWLQJWKHLU any corn-soy rotation.” beating them hands down on yield,”
FDUHHUGHYHORSPHQWLQSURȴWDEOHDQGVXVWDLQDEOHIRRGSURGXFWLRQȋ he said. “It’s amazing what you can see with
Last year, corn grown on the farm’s the drones,” he said.
&KDG%RKDFKHZVNL3$J three locations in three nearby coun- The varieties he seeded vary from
Hession contracts all his corn with
$\OVKDP$JUR Trait Stewardship Responsibilities Notice to Farmers Cargill, which supplies the food-
&KDGȴUVWHQUROOHGLQHQJLQHHULQJEXWDIWHUWZR grade crop to General Mills and Kel-
\HDUVKHVZLWFKHGWRWKH&ROOHJHRI$JULFXOWXUH Monsanto Company is a member of Excellence Through Stewardship® (ETS). Monsanto products logg’s.
DQG%LRUHVRXUFHVZKHUHKHJUDGXDWHGZLWKD are commercialized in accordance with ETS Product Launch Stewardship Guidance, and in
PDMRULQDJURQRP\ΖWZDVDGHFLVLRQKHKDV compliance with Monsanto’s Policy for Commercialization of Biotechnology-Derived Plant Products About half of this year’s crop has
QHYHUUHJUHWWHG in Commodity Crops. Commercialized products have been approved for import into key export been pre-priced.
markets with functioning regulatory systems. Any crop or material produced from this product can
Ȋ%HLQJSDUWRIWKHΖQVWLWXWHȇV1RUWKHDVW%UDQFKKDV only be exported to, or used, processed or sold in countries where all necessary regulatory approvals He has 600,000 bu. of storage and
SURYLGHGJUHDWQHWZRUNLQJZLWKRWKHUDJURORJLVWV have been granted. It is a violation of national and international law to move material containing hauls 75,000 to 100,000 bu. a month
DQGJLYHQPHFRQȴGHQFHLQEHLQJDOHDGHULQWKH biotech traits across boundaries into nations where import is not permitted. Growers should talk to the Cargill facility in nearby India-
LQGXVWU\ȋ to their grain handler or product purchaser to confirm their buying position for this product. napolis from October to July.
Excellence Through Stewardship® is a registered trademark of Excellence Through Stewardship.
&KDGEHOLHYHVWKHUHFRJQLWLRQRIWKHSURIHVVLRQLVJURZLQJDPRQJ The old corn rows are split each fall
IDUPHUVDQGWKHLQGXVWU\Ȋ)DUPHUVZDQWWKHEHVWDGYLFHDQGNQRZLW ALWAYS READ AND FOLLOW PESTICIDE LABEL DIRECTIONS. Roundup Ready® crops contain and fertilizer is applied eight to 10
FRPHVIURPDJURORJLVWV(PSOR\HUVDUHUDSLGO\ȴJXULQJRXWWKDWKDYLQJ genes that confer tolerance to glyphosate, the active ingredient in Roundup® brand agricultural inches deep in preparation for spring
DJURORJLVWVRQVWDUHJLVWHUHGZLWKWKHΖQVWLWXWHLVMXVWSODLQJRRG herbicides. Roundup® brand agricultural herbicides will kill crops that are not tolerant to seeding.
EXVLQHVVVHQVHȋ glyphosate. Acceleron® seed treatment technology for canola contains the active ingredients
difenoconazole, metalaxyl (M and S isomers), fludioxonil, and thiamethoxam. Acceleron® seed The farm’s location on the edge of a
ZZZVLDVNFDȴQGDPHPEHU treatment technology for soybeans (fungicides only) is a combination of three separate individually growing city means land is difficult to
6FLHQFHEDVHGSURIHVVLRQDOVLQDJULFXOWXUHELRUHVRXUFHVIRRG WKHHQYLURQPHQW registered products, which together contain the active ingredients fluxapyroxad, pyraclostrobin buy or rent. The family bought two
and metalaxyl. Acceleron® seed treatment technology for soybeans (fungicides and insecticide) is farms in counties further from India-
6XSSRUWHGE\ a combination of four separate individually registered products, which together contain the active napolis to help ensure they can con-
ingredients fluxapyroxad, pyraclostrobin, metalaxyl and imidacloprid. Acceleron® seed treatment tinue to farm.
ZZZSURGXFHUFRP technology for corn (fungicides only) is a combination of three separate individually-registered
products, which together contain the active ingredients metalaxyl, trifloxystrobin and ipconazole. Land prices are $8,000 to $12,000
Acceleron® seed treatment technology for corn (fungicides and insecticide) is a combination per acre.
of four separate individually-registered products, which together contain the active ingredients
metalaxyl, trifloxystrobin, ipconazole, and clothianidin. Acceleron® seed treatment technology The Hessions planted 10,000
for corn with Poncho®/VoTivo™ (fungicides, insecticide and nematicide) is a combination of hybrid walnut trees developed at
five separate individually-registered products, which together contain the active ingredients nearby Purdue University when they
metalaxyl, trifloxystrobin, ipconazole, clothianidin and Bacillus firmus strain I-5821. Acceleron®, sold their cattle and hogs in 1996. The
Acceleron and Design®, DEKALB and Design®, DEKALB®, Genuity and Design®, Genuity®, trees were planted on low land that
RIB Complete and Design®, RIB Complete®, Roundup Ready 2 Technology and Design®, was once used for pasture.
Roundup Ready 2 Yield®, Roundup Ready®, Roundup Transorb®, Roundup WeatherMAX®,
Roundup®, SmartStax and Design®, SmartStax®, Transorb®, VT Double PRO® and VT Triple They take about 25 years to mature,
PRO® are trademarks of Monsanto Technology LLC. Used under license. LibertyLink® and the compared to 100 years for a native
Water Droplet Design are trademarks of Bayer. Used under license. Herculex® is a registered walnut tree. The trees will be sold for
trademark of Dow AgroSciences LLC. Used under license. Poncho® and Votivo™ are trademarks lumber at about $10,000 each.
of Bayer. Used under license. All other trademarks are the property of their respective owners.
The trees are not much work now,
but at the beginning, the family spent
days pruning them to ensure a
straight, knot-free tree for lumber.
Most of the trees are sold overseas to
be used for veneer furniture.
PRODUCTION 69THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
Sam Hofer eats lunch while contemplating the attributes of the Kuhn Krause Landstar, a combination soil finisher implement, during a tillage clinic at Rocky Mountain Equipment in Taber,
Alta., July 22. | BARB GLEN PHOTO
LAND MANAGEMENT | SELLING TILLAGE
Tillage remains part of toolbox
Another tool for farmers | Tillage combats compaction, residue issues
BY BARB GLEN CURT DAVIS MEASURING RESIDUE COVER START THE SEASON SMART.
KUHN KRAUSE
LETHBRIDGE BUREAU • Choose a random area of the field ORDEr NOW FOR BETTER DEALS
air pockets as well as plant residue. away from headlands. and BIGGER SAVINGS.
TABER, Alta. — Years of minimum That improves moisture penetration
and zero tillage on prairie soil have and capillary activity and fosters • Extend a 50-foot tape measure Order a Model Year 2015 New Holland air drill and air cart NOW and
had their benefits, but they might interaction between soil, water, bac- diagonally across the rows. take advantage of Built My Way incentive packages. The earlier your
also have led to soil compaction best teria, insects and plant life. crop production equipment is ordered and built, the better the deal*.
addressed by tillage. • Count the pieces of residue You also get these Built My Way benefits:
Davis described two types of com- beneath each one-foot mark.
Curt Davis, marketing manager for paction: surface and plow pan. • MODELS FACTORY-BUILT TO
the implement company Kuhn • Multiply by two. YOUR REQUEST
Krause of Kansas, brought that mes- The first is created by simple traffic
sage to Taber area growers July 22. from livestock and equipment. • The result is the percentage of sur- • THE LATEST INNOVATIONS AND
face residue. IMPROVEMENTS FROM NEW HOLLAND
His job is to sell tillage tools, but his Plow pan compaction occurs from
agronomic messages struck chords shearing just below the leading edge Source: Curt Davis, Kuhn Krause • THE BEST FINANCIAL PACKAGE
with farmers and weren’t exclusive of tillage equipment. Tillage at the
pitches for soil disturbance. same depth compacts a specific layer applied near the surface might not *Check with your local New Holland dealer for timing.
of soil over time. reach the root zone where plants can
“We have to understand the plant to use it. Vanee Farm Centre Inc.
really understand the iron,” said Large seeding toolopeners can cre- Lethbridge, AB.............................................................403-327-1100
Davis. “Whether it’s no-till or wheth- ate this issue in heavier soils. Compaction can be measured with
er it’s tillage, it’s a tool that every soil probes, but Davis said a shovel and Linden Agri-Centre Ltd.
farmer has in the toolbox. It’s wheth- “We kind of want to mix it up every a knife are his preferred method. A 12- Linden, AB ...................................................................403-546-3814
er it’s the right time in that particular now and then,” he said. to 14-inch hole easily shows the layers
field to apply that tool or not. and indicates the depth at which to set Bill’s Farm Supplies
In the same way farmers vary their deep tillage equipment if necessary. Stettler, AB ...................................................................403-742-8327
“If there’s no compaction problem chemical modes of action, they
and if there’s not a residue problem should periodically alter their tillage When using a probe, a reading of Tri-Ag Implements
that we’re trying to deal with, then management. 200 to 200 pounds per sq. inch is the Wainwright, St. Paul, Consort, AB...............................780-842-4408
no-till could be a perfectly fine appli- point where root development will
cation for that particular condition. “We swung from full tillage all the be limited. Markusson New Holland of Regina
way over to complete no-till but now Emerald Park, SK.........................................................306-781-2828
“But if there’s a compaction prob- we’re starting to come back toward Davis said there is a myth that the
lem, if there’s a residue issue that the centre and find where’s that good natural freezing and thawing of prai- Novlan Bros Sales
we’ve got to deal with, then no-till balance of tillage and residue rie soil eliminates compaction. Paradise Hill, SK ..........................................................306-344-4448
might not be the right application.” because there are benefits to both,” Though it helps to some degree, it
said Davis. depends on soil moisture level and E. Bourassa & Sons
Davis described the ideal soil pro- won’t reposition soil particles. Radville, Pangman, Assiniboia,
file as five percent organic matter, 25 Tillage naturally affects fertilizer Weyburn, Estevan, SK .................................................877-474-2456
percent water, 25 percent air and 45 application and position, he added. Similarly, the idea that deep-rooted
percent mineral. Limiting the vol- crops such as alfalfa or tillage rad- John Bob Farm Equipment
ume of air and water through com- Nitrogen moves in the soil, while ishes address compaction is only Tisdale, Outlook, SK ....................................................306-873-4588
paction reduces the area where roots phosphorus and potassium attach to partially true. These crops create
can grow, which limits production soil particles. Fertilizer that is always holes in the soil profile but will not © 2014 CNH Industrial America LLC. All rights reserved. New Holland is a trademark registered in the United States and many other countries, owned by
and yield. solve a compaction problem. or licensed to CNH Industrial N.V., its subsidiaries or affiliates.
“This is one of the primary yield “We have to reorient those soil par-
limiting factors in our farming opera- ticles to really get the biggest benefit,”
tions,” he said. Davis said.
Proper tillage for a given situation “The greatest influence on (yield)
can redistribute soil particles into an potential can occur before the seed is
array of different sizes, incorporating ever planted.”
70 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER
LIVESTOCK
LIVESTOCK EDITOR: BARB GLEN | Ph: 403-942-2214 F: 403-942-2405 | E-MAIL: [email protected] | TWITTER: @BARBGLEN
A grazing response index, which was developed in the United States, is being tested to see whether it can effectively evaluate Canadian pastures. | FILE PHOTO
PASTURES | HEALTH ASSESSMENT
Producers could have new grazing tool
Grazing response index | The index was designed for native pasture in the U.S., but Canadian researchers take it for a spin
BY DAN YATES Conservation Ranch to test the graz- one of the things of course that comes It’s not meant to replace long-term to be a little more producer friendly,
ing response index. into play for everybody on their monitoring, she said. something you could do every year,
SASKATOON NEWSROOM operation,” said Leanne Thompson, and that’s how it’s supposed to be
The project is funded through Sask- executive director of the Saskatche- As part of the project, Horvath will used,” she said.
Officials are confident that an atchewan’s Agriculture Demonstra- wan Forage Council, which is also also conduct a traditional tame pas-
American pasture health assessment tion of Practices and Technologies involved with the project. ture health assessment. “Whereas maybe your rangeland
tool can assist prairie ranchers in initiative. health assessment, you might only
Canada. A positive number shows beneficial Thompson said the data recorded do that once every few years.”
The system uses observations made management, while a negative num- as part of the GRI system would be
However, the grazing response in the field to help producers assess ber indicates the area has been over- familiar to anyone who does rota- The grazing response index has
index created by Colorado State Uni- the impacts of grazing and make grazed. From there, producers may tional grazing. already been tested and used in Can-
versity researchers has never been management decisions. modify how they use the paddock: ada but not on tame pastures, where
tested in tame pastures, such as those extend recovery time, change stock- The system relies on observations plants such as meadow brome recov-
commonly found in eastern Sas- Producers use guidelines to make ing rates or graze the area for a short- made in the field and basic record er more quickly than native grasses
katchewan. observations about the frequency and er period of time. keeping — when animals were and are grazed more intensively.
intensity of plant defoliation, as well as moved and how long they stayed on
“In the parkland (region) we don’t the opportunity for regrowth, assign- “I think what it does is it … allows pasture —rather than measurements “I think we’re pretty comfortable
have a lot of native pasture left,” said ing a number to each category on a you for morequick decisions, Iguess, of specific plant species, which with the fact that we can use it. We
Jodie Horvath of Ducks Unlimited. scale of minus two to plus two. At the having a quicker impact maybe on makes it less intensive than range- just want to showcase what we did
endoftheyear,theproducerwillhavea the pasture rather than looking at the land or tame pasture health assess- (and) how we applied it using the
“I think the average producer in this positive, neutral or negative number. overall tame (pasture) health and ments. area that we are in at the ranch,” said
area would be using a tame pasture. It long-term viability of the stand,” said Horvath.
does act a little bit differently.” “We wanted to capture the time Horvath. “There’s a more intensive amount
commitment that it would take to do of information gathered in those “It’s a valuable asset to have there
Horvath is overseeing three sites at these sorts of things because that’s assessments. This one is really meant because it’s a working ranch.”
Ducks Unlimited’s Touchwood Hills
TRADE | COUNTRY-OF-ORIGIN LABELLING
COOL opponents lose bid in court for injunction
Groups opposed to country-of-origin labelling in the U.S. lose their appeal seeking a preliminary injunction against the rule
BY BARBARA DUCKWORTH been denied and it is status quo,” said option worth pursuing,” said Mass- imports. The original rule allowed English, French and Spanish.
John Masswohl of the Canadian Cat- wohl. beef and pork to be labelled Prod- The next step requires the decision
CALGARY BUREAU tlemen’s Association. uct of the United States and Cana-
The full case for an injunction has da. to be tabled at a meeting of the dis-
The fight against the U.S. country- The American Meat Institute was not been scheduled in court, he said. pute settlement body, which meets
of-origin labelling law has been set the lead plaintiff working with other In response to the WTO ruling, the once a month.
back after an appeal seeking a pre- industry organizations. Plaintiffs must nowdecidewhether USDA produced a more detailed rule
liminary injunction against the rule to continue. that said all retail packages must The next three scheduled meetings
was lost. The group hoped to get an injunc- include information on where the for the dispute panel are Aug. 29,
tion against the U.S. Department of Legal counsel for the AMI and other animals were born, raised and Sept. 26 and Oct. 23.
The U.S. Court of Appeals for the Agriculture rule released last year. It industry organizations will review slaughtered.
District of Columbia Circuit rejected felt a World Trade Organization chal- the decision more thoroughly and Masswohl said an August release is
the case in a 9-2 decision on the basis lenge would take too long and want- recommend the next action. A WTO decision on the appeal unlikely.
it “was unlikely to succeed.” ed action sooner. against the second rule has been
The case is against the COOL law reached but not released. Govern- “My guess would be Sept. 26,” he
The 70 page decision was released “If a quick preliminary injunction that was implemented in May 2013. ments have received confidential said.
July 29. was granted to prevent the new rule It followed a WTO ruling that the copies but it must be translated into
from coming into effect, it was an USDA rule discriminated against The most recent court documents
“The preliminary injunction has Canadian and Mexican livestock may be viewed at http://1.usa.
gov/1xyFe8F.
LIVESTOCK THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014 71
RECREATION | LOFTY HOBBY
High altitude rocket launching; ranch style
Digital dermatitis is found primarily in dairy cattle, but it does occur in COWBOY LOGIC the age recommendation said 10 and We packed it in.
beef animals, especially in feedlots. | FILE PHOTO up, it was quickly followed with A week or two later, adult supervi-
RYAN TAYLOR “adult supervision under 12,” or was sor and the supervised installed a
CATTLE DISEASE | SEVERE LAMENESS that “adult supervision under 12!” different rocket engine (the neat
One of the new, exciting devel- Either way, I wouldn’t have not been explosive part) and starter (the little
Digital dermatitis opments in agriculture is the part of this easy to assemble project piece of wire that makes it explode
emerges in beef cattle potential for unmanned aer- to explore the air space above our when you hit the switch that sends
ial systems to give farmers and ranch. current from the battery).
ANIMAL HEALTH ture with manure contamination are ranchers a bird’s eye view of what’s We just went a couple hundred feet
probably responsible for softening going on with their plants and ani- The potential uses for UAS in agri- out in the pasture with no siblings or
JOHN CAMPBELL, DVM, DVSC the skin and allowing the organism to mals. culture are nearly endless. Outfitted camera because past experience told
penetrate the skin surface. with cameras and software, the little us that it probably wouldn’t work
Digital dermatitis is a painful Maybe that’s what our 10-year-old farm drones could update you on anyway.
foot condition that causes The disease is highly contagious had in mind when he bought a plant development, weed infesta- “Ten, nine … zoom,” off it went
severe lameness in cattle. and can spread rapidly and affect a model rocket launch set with money tions and spray and fertilizer needs, before we even got to eight. It’s then
This highly contagious disease was large percentage of animals once he had been saving. It’s kind of a next and all without traipsing across the that we realized how hard it is to see a
first described in Italy in 1974 and has introduced via the addition of new step into UAS technology for the Tay- field. little yellow rocket 1,100 feet in the
since spread around the world, pri- cattle into a herd. lor Ranch following up on Fourth of air. It popped out the orange and
marily within dairy cattle. July bottle rockets and parachute Us livestock guys could be checking white parachute, all according to
Younger cattle tend to be more sus- fireworks. cattle and fences from our desk, and plan. I lost sight of it as it drifted
However, the disease is also becom- ceptible, and cases in dairy cattle tend findingout if thestockwatertanktwo northwest from the southeast wind,
ing an emerging threat in beef cattle. to occur around calving. This suggests Either that, or he just saw the cool miles away is still full on a hot day. while my son lost sight of it as it drift-
that immune system suppression picture on the box and the words ed toward the setting sun.
It is most common in cattle kept in may play a role in the disease. “High altitude rocket!” and “1,100 Granted, a lot of the potential is yet As of this writing, we have yet to find
confinement, and although it can feet!” on the front. Exciting stuff, as to be sorted out as the rules are writ- our rocket. Thankfully, it was un-
affect breeding cows, it has been Treatment has proven to be difficult indicated by the exclamation points. ten for commercial uses and desig- manned. Sadly, the claim on the box
identified primarily in feedlot cattle and usually requires cleaning and nated airspace and privacy concerns. that “this rocket can fly over and over
within the beef industry. drying the lesion and then applying Actually, looking at the box, nearly However, the idea of getting to play again!” may not prove out for us.
an antibiotic on the skin in a bandage everything was followed by an excla- with a remote controlled helicopter I guess if we’re going to experiment
A research study in 2000 in south- or with a topical spray. mation point: “Includes Launch Pad or airplane and make it part of your with UAS on the ranch, we just as well
eastern United States identified digi- and Controller!” and “More Exciting work is pretty engaging. lose the $30 ones and get that out of
tal dermatitis in 29 percent of culled Antibiotic sprays, which are usually Choices!” I guess that’s how rocket our system before getting into the
dairy cattle at the packing plant. The a tetracycline mixture, need to be people talk! And son and I would For now, on the Taylor Ranch, the $3,000 or $10,000 models.
same study said four percent of applied twice daily, which is feasible soon be part of that exclamatory fra- adult supervisor and the supervised For now, I have something to keep an
culled adult beef cattle had lesions of in a dairy herd but highly difficult in a ternity! were going to send that rocket up eye out for as I check that pasture with
digital dermatitis. feedlot setting. 1,100 feet and see what we thought our old technology … by horseback.
It would be son and I because, while about sending stuff up in the air.
Outbreaks have been anecdotally Injectable antibiotics are often Ryan Taylor is a rancher, writer and senator
reported in feedlots in Western used in conjunction with topical The first time we had it all set up in the state legislature from Towner, North
Canada. treatments, but there is limited evi- and ready to go, we packed up the Dakota.
dence that they are helpful. whole family, set it up in a wide open
Digital dermatitis goes by many area, had a camera ready to capture
names including strawberry foot rot, Prevention is focused on hygiene the action and did a “T minus 10”
raspberry heel, foot wart and hairy and pen conditions by trying to countdown. Nothing. Just disap-
heel wart. reduce stocking density, maintain- pointment and mosquito bites.
ing watering and feeding areas to
The hind legs are affected in 85 per- avoid mud and manure accumula-
cent of cases. tion and managing corrals to avoid
wet areas.
These lesions may appear initially as
a raw, red, oval ulcer on the back of the Foot bath solutions such as copper
heeljustaboveoratthecoronaryband. sulfate, zinc sulfate and formalin con-
trol the disease in dairy herds but can
Many of them often develop raised, be difficult to manage in beef cattle.
hair-like projections or wart-like
lesions, and some may extend up Cattle that live in settings where
between the claws or appear on the manure management is difficult to
front of the foot. achieve should walk through foot
baths twice a day for at least five days
These raw skin lesions are incredibly a week, but this is difficult to achieve
painful, and cows will dramatically in a feedlot.
altertheirgaitandposturetoavoidput-
ting pressure on them. Animals will Once-a-week foot baths may be
walk on their toes because the lesion is sufficient in more hygienic condi-
usually at the heel, which may cause tions, which is more practical in beef
the hoof on the heels to overgrow. cattle herds.
This condition may resemble a wart, Producers should consult a veteri-
but it isn’t because warts are caused narian before starting a treatment
by a virus. This disease is caused by a program. Foot baths require consid-
bacterium in the “spirochete” family erable effort to manage and need to
called treponema. be long enough and deep enough to
allow for two dunks for each foot.
Researchers still disagree about
whether other pathogens are in- Researchers are attempting to cre-
volved, but treponema has been the ate a vaccine, but results have not
primary organism associated with been promising.
digital dermatitis.
Producers can attempt to prevent
There are likely predisposing fac- bringing digital dermatitis into their
tors such as immunity, infectious herds by avoiding contact with
and environmental components. infected dairy cattle.
Wet conditions and constant mois- Hoof trimmers should disinfect
their equipment between farms to
avoid spreading this highly conta-
gious disease.
John Campbell is head of Large Animal
Clinical Sciences at the University of
Saskatchewan’s Western College of
Veterinary Medicine.
72 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER LIVESTOCK
PED | CONTROL
Biosecurity
measures
control PED
70 positive sites |
Disease spread said
to be under control
in Canada
BY MARY MACARTHUR TOP: Judge Brandon Sparrow looks over the senior
members’ animals at the Canadian Junior Limousin
CAMROSE BUREAU Association’s National Conference Impact Show held
July 24-26 in Saskatoon. | TARYN RIEMER PHOTOS
Strong biosecurity measures by
Canadian hog producers continue ABOVE: Alexander Kozroski works with his animal
to keep the deadly porcine epi- to get it positioned just right for the judge.
demic diarrhea virus under control.
BELOW: Austin Porter gets experience grooming
Only 70 positive sites have been an animal.
reported in Canada in the 26 weeks
since it was discovered on a south- BELOW LEFT: Jayden Payne, left, and Brandon
ern Ontario hog farm in January. Hollingsworth set up their animals and keep an eye
The last reported case was July 21 on on the judge during the senior showmanship event.
a farm near Perth, Ont.
LEFT: Jayden Payne, left, helps Cadence Haaland
“We’ve had very little new move- with grooming techniques. Riley Keller and Ashley
ment,” Egan Brockhoff, an Alberta McConnell work on boning the animal’s legs.
swine veterinarian with Prairie
Swine Health Services, said during LIMOUSIN SHOW | NATIONAL CONFERENCE
a conference call on the PED virus.
East and West reunite at cattle show
A new strain of PED was reported
July 30 on a farrow to finish farm in Cows and kids | Junior members hone judging, grooming and showmanship skills at annual show
Ontario that had previously report-
ed a positive case of the original BY TARYN RIEMER have been involved in the association CASSIDY Hollingsworth placed fourth in his
PED virus. for a few years, while Payne has been a MATTHEWS class in senior showmanship and
SASKATOON NEWSROOM member for close to 14 years. INTERMEDIATE first in oral marketing. He also placed
No one is sure how the new strain MEMBER second in the heifer calf open divi-
of PED made its way to the farm, but Three of the leaders at this year’s They all said their favorite part of sion with B Bar Urban Girl 2B.
the theory is that it was likely there Canadian Junior Limousin Associa- the show is the people. print marketing and first in industry
during the initial outbreak but only tion conference in Saskatoon took quiz. The Saskatoon show wasn’t the end
recently became active. different strategies into the show “Just seeing everyone,” said Hol- of the season for these members.
ring. lingsworth. Payne also won reserved supreme
The first 25 cases of PED in Ontar- champion and the purebred division Payne will be taking part in Stock-
io have been traced to porcine pro- “Make sure my animal is well “Like being from Ontario, you don’t reserve champion with the cow-calf ade Roundup, Farm Fair and Agribi-
tein plasma in piglet feed. The behaved, watered, filled up nice,” see the western families as much, so pair Greenwood Young & Restless. tion, Matthews has Bashaw All
plasma is made from pigs and is said Brandon Hollingsworth of Oro- coming out is great. It’s like a big Breeds, Canadian Western Agribition
believed to be highly digestible for no, Ont., a senior member. reunion with all the cattle people. It’s Matthews and Hollingsworth were in Regina and Farm Fair in Edmonton
young piglets. always nice to see everyone again.” together on the team that finished lined up and Hollingsworth plans to
Added Cassidy Matthews, an inter- third in grooming. attend eight fairs as well as the Royal
Eighty-three percent of the pro- mediate member from Olds, Alta.: The three members also said they Agricultural Winter Fair in Toronto.
ducers on the conference call said “Just make sure I’m clean, brush my enjoy helping the younger members. Matthews placed third in interme-
they had stopped using porcine hair.” diate showmanship overall and first The conference, which was held
plasma in feed. The other 17 per- Payne, Matthews and Holling- in print marketing. Matthews was July 24-26, was attended by people
cent said they continue to use it, Jayden Payne, a senior member sworth competed in photography, also the 4-H division champion with from Ontario, Alberta, Saskatchewan
despite the risks. from Lloydminster, Sask., probably team judging, print and oral market- Pinnacles Alls Excited. and Manitoba.
took the most laid back approach. ing, team grooming, industry quiz,
Callers were also asked if animal- showmanship and the conformation Show chair Lee Carpenter said
based proteins should no longer be “I have a lucky show stick, but that’s class. there was a good turnout with almost
fed to pigs. About three-quarters of about it.” 60 cattle at the show.
the callers believed feeding animal Payne was on the team that finished
byproducts to pigs should be All three members have each been first in team grooming, second in Thirty-five young people partici-
stopped. showing cattle for more than a dec- senior team judging, third in senior pated.
ade. Matthews and Hollingsworth showmanship overall, second in
Brockhoff said he is heartened to
hear producers have rejected offers
of low-priced pig feed containing
porcine plasma. A sample of feed
from Alberta that contained por-
cine plasma tested positive for PED,
but it did not enter a pig barn and
was destroyed.
Brockhoff discourages producers
from using feed containing porcine
plasma products because feed was
a major contributor to PED in
Ontario.
“Our recommendation continues
to be minimum or no use of porcine
animal proteins,” he said.
Alberta officials have taken 3,259
samples at eight major sites in the
province to test and monitor dis-
ease.
In Manitoba, officials have
launched a major research project
to allow producers to sample the
manure in their pits for PED. It will
also work with custom manure
applicators to help prevent the
spread of PED and understand how
long the disease will survive in soils.
In the United States, 100 new PED
cases a week are reported, most in
major pork producing states.
73THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
CONTEST ALERT
And the winner is ...
Congratulations to Andrew Brehaut, Visit us online at www.producer.com/contest
winner of the Western Producer’s $14,000 to see the video of our prize winner being
John Deere Gator™ giveaway contest! presented with his brand new Gator™.
The Wawota, Sask., farmer couldn’t believe his luck when we pulled into his driveway with
Nelson Motors salesman Jeff Engle on July 30 to present him with the keys to a John Deere
Gator, the grand prize of our year-long anniversary contest.
Andrew and his wife, Danielle, farm 6,000 acres in the Wawota area and will put their prize
to good use on their farm.
“We received entries from all across Canada,” said Western Producer
publisher Shaun Jessome. “We would like to thank John Deere, 4-H Canada,
our print and online readers, and our followers on social media. It is
Canadian farmers who made our 90th Anniversary and this contest such a
huge success.”
1-800-667-6929
www.producer.com
powerful partnerships
74 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER NEWS
CROP REPORT
ALL CONDITIONS AS OF AUG. 1. VISIT WWW.PRODUCER.COM REGULARLY FOR UPDATED CROP REPORTS
MANITOBA Many fields have wet spots, but responding well to warmer and Rain and humidity have delayed baling. Quality is averaging 80 per-
haying operations have progressed drier conditions. Rainfall was three some producers, but haying is cent good.
SOUTHWEST well. Yields are average to above to 35 mm. Standing water is quickly advancing well with half to three-
average with average quality. dissipating. quarters of the crop baled or put Most crop damage was caused by
Crops continue to improve as a into silage. More has been cut and wind, localized flooding and hail
result of mild and drier weather, but CENTRAL Desiccation of advanced winter ready for baling. More than three- damage. Producers continue spray-
long-term yields are expected to be wheat crops has begun. Some fun- quarters of the hay crop is good ing for sclerotinia, fusarium head
average. Crops are looking good, other than gicides were applied on later seeded quality. blight and leaf spots.
in areas with excess moisture. Rain canola and cereals, and applica-
Precipitation was five to 15 was generally welcomed and varied tions have continued for soybeans. Cropland topsoil moisture condi- ALBERTA
millimetres, while temperatures were from 10 to 50 mm. Days were sunny Soybeans have also received final tions are rated more than 75 per-
at ideal levels for crop development. and warm, but low overnight tem- applications of glyphosate. cent adequate while hay land and SOUTH
peratures slowed crop growth. pasture topsoil moisture conditions
The drier, less humid conditions There are reports of grasshopper average 75 percent adequate. The region experienced hot, dry
are helping keep disease levels for Irrigation has begun on potatoes, flare-ups with producers spraying. weather and most crops are rated
most crops at low to moderate levels. and cereals are fully headed. Canola Scouting for insect populations are Some producers continue to spray in good condition.
is from full flower to full pod, while ongoing but generally have not war- for fusarium head blight, sclerotinia
There’s evidence of fusarium head most soybeans are flowering. Edible ranted insecticide applications. and leaf spots. Others are spraying Spring cereals are in the late pol-
blight in winter wheat, root rot in field beans are showing iron chlorosis for grasshoppers in lentil and flax lination stage and winter cereals in
peas and brown girdling root rot in in areas of excess moisture. Corn INTERLAKE crops. Root rot is prevalent, particu- soft dough. About three-quarters of
canola caused by excess moisture early growth varies but is improving. larly in lentils and peas. canola is podding while most field
in the season. Warmer and drier conditions have peas are podding.
Wild oats can be seen in many helped crop development, but crops CENTRAL
Spraying for sclerotinia stem rot in cereal crops. Green and yellow fox- vary from very poor to good. Less Most of the sub-soil moisture is
canola has declined. tail and barnyard grass are evident, than average yields in certain areas Warm and dry weather is advanc- rated as good to excellent.
as is volunteer canola. are expected. ing crops and haying operations,
Wheat midge is on the increase, but but crops are still behind their nor- The first cut of hay on dryland and
concern is decreasing because many Fungicide applications are nearly Rainfall amounts were three to 10 mal stages of development. irrigated land is almost complete
wheat fields are flowering. complete for cereals with reports of mm. with most hay and pastures rated
more acres treated, but many later Livestock producers have baled good to excellent.
Soybeans are flowering and in the seeded canola fields did not require Winter wheat will soon be desic- half of their hay crop or put it into
R1 to R4 stage. Corn growth varies fungicide treatment. Spraying for cated, and most spring cereals have silage, with an additional 25 percent CENTRAL
because of excess moisture. white mold in dry beans continues headed and flowered. Sunflowers cut and ready for baling.
in some fields. Sunflowers will begin have started flowering and corn is Fifteen to 50 mm of much needed
Forage crops are yielding aver- receiving fungicide applications for tasseling. Soybeans are flowering However, recent rain and high precipitation fell. Spring cereals are
age to above average, while quality head rot. with pods starting to form. Forage humidity have slowed haying in the mid-pollination stage and
varies from above average to below grass seed will soon be ready for operations and reduced quality, winter cereals are in early dough.
average. Native hay pastures remain Some fusarium head blight is evi- swathing. Some earlier grasses have which is rated more than 80 percent More than half the canola is pod-
in good condition. dent in spring wheat. Blasting and already been cut. good. ding and three-quarters of field peas
wild oats have been found in all oat are podding.
NORTHWEST varieties. Blackleg lesions are on SASKATCHEWAN The Kindersley area topped the
leaves in many canola fields. Brown region for most rainfall at 92 mm Most sub-surface soil moisture is
Crops are improving thanks to girdling root rot and other root rots SOUTH while the Foam Lake area leads with slightly down but still rated in good
warmer and drier conditions but are reported in some fields. Some 529 mm since April 1. or excellent condition.
are about two weeks behind normal bacterial blight is evident in soy- Crops are progressing well in the
development for this time of year. beans and edible bean fields. east, but storms caused havoc in the Topsoil moisture conditions on Almost all the first cut of dryland
Rainfall amounts varied from trace west. Heavy rain, strong winds and cropland, hay and pastures are rated hay is complete. More than half of
to more than 76 mm. Insect activity remains low for hail caused crop loss, blew around at more than 80 percent adequate. hayland and pastures are in good or
most fields and crops. hay swaths, overturned bins and excellent shape.
Most cereal crops are in the head- damaged homes and vehicles. Many producers continue to spray
ing and flowering stage with the rest Tame forage yields are average for diseases such as leaf spots and NORTHEAST
in the milk stage. Almost all canola to above average. Good yields are Rainfall varied from small sclerotinia as well as for wheat
is flowering. More than half of all expected with alfalfa silage. amounts to 42 mm in the Glenavon midge and grasshoppers in lentils. Moisture ranging from light show-
soybeans are flowering. Three-quar- area. The Maryfield area leads the There are also reports of high plant ers to 50 mm was beneficial for
ters of field peas have podded. EASTERN region with 469 mm of cumulative loss in pulse crops caused by root yield and maturity. Most crops are
precipitation since April 1. rot. in good to excellent condition and
Fungicide applications are mostly Crops, particularly soybeans, are much higher than the five year aver-
done. Wild oats can be seen in some NORTH age.
cereal crops.
Crops continue to trail normal Spring cereals are in late pol-
Insect pressure remains low. development, and warm, dry condi- lination and winter cereals in soft
tions are needed to mature crops. dough. About 70 percent of canola is
Saskatchewan Canola Development Commission podding while more than 90 percent
The Frenchman Butte area led the of field peas are podding.
Call for Nominations: region with 64 mm of rain while the
Hafford area has received the most Almost all of the sub-surface soil
Election for SaskCanola Board of Directors rain since April 1 with 421 mm. moisture is rated in good to excel-
lent condition.
Four SaskCanola Board positions will be open for Haying continues despite the wet,
nominations beginning August 7, 2014. Only registered humid conditions, and producers Most of the first cut of dryland hay
canola producers may nominate, vote, and/or be elected to have either baled or put into silage is complete. Hayland and pastures
half of the crop. One-quarter of the are in good to excellent condition.
the SaskCanola Board. hay crop has been cut and ready for
NORTHWEST
Registered producers, who wish to be elected to the Board Landmark Feeds
of Directors, should contact SaskCanola via email at Precipitation was 25 to 50 mm with
a Nutreco company most crops now entering the kernel
[email protected] or toll free at 1-877-241-7044 for a filling stage.
Director Nomination Package. WE ARE
BUYING Spring cereals are in the early
Nomination forms must be returned to the Returning Officer milk stage while more than three-
no later than 12:00 PM, noon, October 1, 2014. FEED quarters of canola and field peas are
GRAINS podding.
The Returning Officer will be Ann Smith of the Agriculture Council
of Saskatchewan at 104-411 Downey Road, IN About half of the sub-soil moisture
condition is rated good or excellent,
Saskatoon, SK, S7N 4L8 or fax at 306-975-6850. Strathmore, AB. while almost all of the surface soil is
excellent.
Medicine Hat, AB.
PEACE
Rosenort, MB.
Much of the region received 15 to
Otterburne, MB. 35 mm of rain. Most crop conditions
are 50 percent good to excellent.
Email:
[email protected] Spring cereals are in the early milk
stage. Most canola and field peas
or Phone: 866-607-3575 are podding.
Sub surface soil moisture remains
unchanged from the previous week
with more than half rated good to
excellent.
First cut of hay is almost complete.
Hayland and pastures are more than
50 percent good or excellent.
NEWS THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014 75
FERTILIZER | MANAGING NITROGEN LOSS ANIMAL WELFARE | FUNDING
Nitrogen stabilizer comes to Canada Poultry funding
to help finish
Nitrapyrin-based product | Branded as N-Serve and eNtrench, it has been used in U.S. for 35 years codes of practice
BY ROBERT ARNASON cess,” said Cindy Grant, an Agricul- Dow AgroSciences is introducing Grant said. BY MELANIE EPP
ture Canada soil fertility specialist in nitrapyrin in Canada for use on “That means the microbes have
BRANDON BUREAU Brandon. canola, as well as corn and wheat. FREELANCE WRITER
| FILE PHOTO slowed down.”
Dow AgroSciences is introducing a “The key niche for its usefulness in Loessin said nitrapyrin allows pro- GUELPH, Ont. — The Canadian
nitrogen stabilizer product in Cana- other areas seems to be with fall “Our recommendation is to put Animal Health Coalition has re-
da that has been used in the United banding…. I think it is quite com- your nitrogen on after the soil tem- ducers to apply anhydrous earlier in ceived more than $2.2 million in
States for 35 years. monly used in Minnesota, those perature has fallen below 10 C,” the fall. federal funding to update two animal
kinds of areas.” care codes for poultry and develop
Dow announced in June that nitra- “It widens out that window,” she new codes for three additional sec-
pyrin, which reduces the likelihood Grant said nitrapyrin is distinct said. tors in the future.
of nitrogen loss through leaching and from urease inhibitors such as Agro-
denitrification, is now approved for tain because it acts at a different stage “It gives you the opportunity to Executive director Mark Beaven
use in Canada. of the nitrogen cycle. basically apply ammonia after har- said the funding is welcome.
vest, any time, and you get that pro-
“It’s been sold in the U.S. for about Nitrapyrin maintains nitrogen in tection of your fertilizer source all the “To develop the welfare codes of
35 years (and) used primarily on the ammonium form longer, while way to the next spring.” practice is no small feat,” he said.
corn,” said Jeff Loessin, Dow AgroSci- urease inhibitors keep nitrogen fer-
ences Canada’s portfolio marketing tilizer in the urea form. Dow’s fact sheet says nitrapyrin “In fact, the National Farm Animal
leader for crop protection. slows the activity of the nitrosomo- Care Council has developed a very
A 2004 study, which was pub- nas bacteria for up to 10 weeks in unique process. It brings together all
“In Canada, we’re bringing it for- lished in Nutrient Cycling in Agro- warm soil, which is defined as soil of the stakeholders and develops a
ward for use on corn, canola and ecosystems, evaluated data from the temperatures higher than 10 C. science-based code that is practical
wheat, our high-use nitrogen crops.” U.S. Midwest and concluded that and effective.”
nitrapyrin does reduce nitrogen Manitoba Agriculture said on its
Nitrapyrin, branded as N-Serve and losses through leaching and deni- website that products such as nitra- Coalition chair Jennifer MacTavis
eNtrench, hinders the activity of a trification. pyrin are effective when soil condi- said the work is important.
soil bacteria called nitrosomonas, tions are wet or warm.
which converts ammonium to Grant said nitrapyrin is a proven “The enthusiastic uptake by the
nitrate. technology in the U.S., but Canadian “If the placement and timing is not industry to update and implement
research isn’t as conclusive. optimum and conditions are exces- their Codes of Practice is a clear dem-
N-Serve can be used with anhy- sively wet, causing loss of nitrate- onstration of importance that live-
drous ammonia and eNtrench is “Part of the reason they never had it nitrogen, the cost of the products stock producers place on the care
designed for use with liquid fertiliz- registered here before is partly due to offering nitrification inhibition or and welfare of their animals,” she
ers and dry products such as urea. the fact that with our cold soils and slow release are beneficial,” the said.
relatively dry conditions … we didn’t website said.
Nitrapyrin keeps fertilizer in the get an economic advantage.” “With this funding, we are able to
form of ammonium longer, prevent- “The dilemma for the grower is that finish codes that are currently in pro-
ing losses that occur when nitrogen The nitrosomonas bacteria are when application timing and place- cess, print and circulate completed
fertilizer is in the nitrate form. not active and nitrogen losses are ment are optimum and the weather codes and expand the number of
less likely if a grower applies anhy- is not conducive to loss, these livestock commodities that are
“It’s an established product…. It drous later in the fall when the soil enhanced products will provide no developing and updating their
does what it’s supposed to do. Basi- is cooler. yield advantage over traditional N codes.”
cally it slows the nitrification pro- sources. Yet they all add cost.”
STC Parcel Express
PARCEL TO SHIP? SEND IT BY BUS. STC ships on weekends too!
CALL 1.800.663.7181 OR VISIT STCBUS.COM/SHIPPING
76 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER
AGFINANCE CDN. BOND RATE: CDN. DOLLAR:
1.51% $0.9183
1.70% 0.950
1.60% 0.940
1.50% 0.930
1.40% 0.920
1.30% 0.910
6/27 7/7 7/14 7/21 7/28 8/1 6/27 7/7 7/14 7/21 7/28 8/1
Bank of Canada 5-yr rate Aug. 1
AGFINANCE EDITOR: D’ARCE MCMILLAN | Ph: 306-665-3519 F: 306-934-2401 | E-MAIL: [email protected] | TWITTER: @DARCEMCMILLAN
CANADA, U.S. TRADE | MINNEAPOLIS CONSULATE AG STOCKS JULY 28 - AUG. 1
Consul trades field for factories Uncertainty over Argentina’s debt default and
the U.S. Federal Reserve’s interest rate stance,
Canada’s consul general | Former soil conservation specialist now deals with trade issues as well as some weak corporate quarterly profits
knock stocks down hard. For the week, the TSX
composite fell 1.6 percent, the S&P 500 fell 2.7
percent, the Dow fell 2.8 percent and the Nasdaq
fell 2.2 percent.
Cdn. exchanges in $Cdn. U.S. exchanges in $U.S.
GRAIN TRADERS
BY ED WHITE “I was out meeting people, sitting NAME EXCH CLOSE LAST WK
around the kitchen table, being in
WINNIPEG BUREAU somebody’s field talking to them. ADM NY 46.57 48.12
This is the same kind of thing. I may 20.81 21.75
MINNEAPOLIS, Minn. — Jamshed not be in a field with somebody, but Alliance Grain TSX 80.80 74.42
Merchant might work in a glass and I’m in their factory or their office.” 30.39 31.08
steel tower in the downtown core of a Bunge Ltd. NY
great American city, but he isn’t The Minneapolis consulate covers
afraid to get down and dirty with Minnesota, Iowa, Nebraska and the ConAgra Foods NY
farmers’ issues. Dakotas, which are tightly connected
to the western Canadian farm econo- PRAIRIE PORTFOLIO
It’s something he’s been doing both my, especially Manitoba.
literally and metaphorically for NAME EXCH CLOSE LAST WK
decades on both sides of the border. That brings the consulate into fre-
quent agriculture-based discussions Assiniboia FLP OTC 0.394 0.394
Merchant is Canada’s consul gen- and consultations, dealing with 0.25 0.19
eral in Minneapolis, overseeing an issues as varied as country-of-origin Ceapro Inc. TSXV 22.31 22.52
office that promotes Canada-U.S. labelling and beefed-up border secu- 2.45 2.48
trade in the region and assists Cana- rity controls. Cervus Equip. TSX 23.20 23.08
dians living in and travelling to the
region. The consulate has a dedicated agri- Input Capital TSX 10.80 10.79
culture commissioner who special-
His former career as a soil scientist izes in farm and food-based trade Ridley Canada TSX
might not at first glance have been a and investment questions, but Mer-
good background for the consul job, chant’s agriculture background Rocky Mtn D’ship TSX
but he says the two positions are a allows him to also get intimately
good fit. involved. FOOD PROCESSORS
“In many ways it’s not that differ- Issues can be farm-based or large NAME EXCH CLOSE LAST WK
ent,” said Merchant. scale, such as those faced by major
companies like Cargill and General Hormel Foods NY 45.01 47.72
“This job is the same kind of thing.” Mills, both of which are based in Min- 19.48 20.5
Merchant, who became consul gen- neapolis. Maple Leaf TSX 22.02 21.25
eral in 2012, was educated in Britain, 37.05 39.54
began his Canadian career as a profes- Merchant said farmers who have Premium Brands TSX
sor of geography at Montreal’s McGill questions,needinformationorarefac-
university in 1979 and became an ing problems with cross-border trade Tyson Foods NY
Alberta environment department soil can directly contact his consulate.
reclamation specialist in 1983. FARM EQUIPMENT MFG.
He expanded that role as a soil con- “Our job is to know who’s who, who
servation specialist in Alberta and to talk to, when to talk (to them), what NAME EXCH CLOSE LAST WK
Saskatchewan for Agriculture Cana- kind of things would be affected.”
da from 1985 to 2001, worked for the Ag Growth Int’l TSX 48.45 48.74
federal Treasury Board and in 2008 With $44 billion in two-way Cana- 48.23 52.33
became assistant deputy minister of da-U.S. agriculture and food trade, AGCO Corp. NY 6.18 6.36
Agriculture Canada’s Agri-Environ- there are lots of places where prob- 100.52 104.85
ment Services Branch. lems can occur. Buhler Ind. TSX 8.94 9.22
As a soil conservation specialist, he 84.96 86.17
worked mostly in extension, taking However, Merchant said the simi- Caterpillar Inc. NY 10.25 10.55
what in the 1980s and 1990s was still a larity of the Canadian Prairies to the
new and novel concept to farmers U.S. Midwest helps make resolving CNH Industrial N.V.NY
across the Prairies. them easier.
Those years of working one-on-one Deere and Co. NY
with farmers in their own local areas “Talking to people in small com-
are something he believes helps him munities in the Midwest is very much Vicwest Fund TSX
deal with the nitty gritty of complicat- like talking to people in small com-
ed trade and investment issues that munities in the Prairies,” he said. FARM INPUT SUPPLIERS
emerge in Canada-U.S. relations.
“For me as a (soil) conservationist, I Visit us online at NAME EXCH CLOSE LAST WK
couldn’t stay in my office and do my www.producer.com
job,” said Merchant. to see a video about Agrium TSX 98.97 99.61
this story.
BASF OTC 101.78 108.28
Bayer Ag OTC 128.74 132.83
Dow Chemical NY 50.97 53.71
Dupont NY 64.21 64.93
BioSyent Inc. TSXV 7.56 7.81
Monsanto NY 113.59 115.79
Mosaic NY 46.04 47.1
PotashCorp TSX 38.23 39.42
Syngenta ADR 70.94 71.44
TRANSPORTATION
NAME EXCH CLOSE LAST WK
CN Rail TSX 72.11 74.02
CPR TSX 204.63 210.43
Canada’s consul general Jamshed Merchant says his agricultural List courtesy of Ian Morrison, financial adviser with the
background helps him deal with farm-based or large-scale ag issues and Calgary office of Raymond James Ltd., member of the
cross-border trade problems. | ED WHITE PHOTO Canadian Investor Protection Fund. The listed equity
prices included were obtained from Thomson Reuters
and the OTC prices included were obtained from PI
Securities Ltd., Assiniboia Farmland LP. The data listed
in this list has been obtained from sources believed to
be reliable, but accuracy cannot be guaranteed. Within
the last 12 months, Raymond James Ltd. has undertaken
an underwriting liability or has provided advice for a fee
with respect to the securities of Alliance Grain. For more
information, Morrison can be reached at 403-221-0396
or 1-877-264-0333.
MOSAIC | FINANCE RESULTS
Drop in potash prices send Mosaic profits down; demand expected to improve
(Reuters) — Mosaic has reported a sharply lower prices and profits since share, a year earlier. global pipeline inventory, prices LARRY STRANGHOENER
42 percent slump in quarterly profit last summer’s breakup of one of the The lower prices have lately rekin- should remain firm. MOSAIC INTERIM CEO
as average realized prices of potash world’s biggest potash traders,
fell by more than 25 percent. Belarusian Potash Co. dled demand, said Larry Strang- Mosaic’s sales of phosphate and
hoener, Mosaic’s interim CEO. potash were at the high end of its
The company also said chief execu- Potash Corp reported lower second forecasts.
tive officer Jim Prokopanko, who has quarter profit last month, but the “We have long said we expected to
been on leave since May to undergo results topped the company’s forecast. see volumes increase before prices, Net earnings attributable to the
surgery to treat cancer, would re- and that scenario is playing out as company fell to $248.4 million, or 64
sume his duties Aug. 4. Potash Corp net earnings fell to anticipated,” he said. cents per share, in the quarter, from
$472 million, or 56 cents per share, $429.8 million, or $1.01 per share, a
Potash producers have faced from $643 million, or 73 cents per “We expect demand to remain high year earlier.
throughout the year, and with low
AGFINANCE THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014 77
FARM MANAGEMENT | NO ONE IS INDISPENSABLE
Business owners should work to avoid ‘doing it all’ trap
THE BOTTOM LINE the workload being passed out, and have to go on to another person.” Vander Waal doesn’t claim his sys- Stepping back from the day-to-day
so at 4:30 you can go home and not But overall, it’s been a success. tem is best or that it will work for allowed Stan Vander Waal to focus
GLENN CHEATER think about it. But when you ask Stepping back from the day-to-day everyone. But one thing is for sure. on growing Rainbow Greenhouses,
people to take on a higher role, it’s including piloting a recent $8.5
Stan Vander Waal knew he amazing how much of that work goes allowed Vander Waal to expand the “If you say, ‘I could have done it million expansion. | DAVID SCHMIDT/
needed a new management home with them in their head.” business, including piloting a recent faster or better myself,’ then you’re
style by the time he had hired $8.5 million expansion and making stuck in an endless trap,” he says. COUNTRY LIFE IN BC PHOTO
more than 70 employees at his green- To get over that, Vander Waal put his company a leader in the use of
house. them into a position where they had robotic technology. “You’ll simply be doing it yourself
to make decisions. forever. That’s an absolute.”
“Even 15 years ago, I was quite There is also time to volunteer,
involved in every function of the busi- “That’s how they start building including serving as chair of the B.C. And that’s OK if that’s how you want
ness — maybe not in a completely experience,” he says. Agriculture Council and vice-chair of to run your farm business. Just don’t
controllingway,butvery,very active- United Flower Growers. use the excuse that no one can take
ly involved,” he said. “And then you have an opportunity your place. Usually, if you step aside
to build on that. Let’s say, it’s a less- The surprising part is how person- to make room, someone can.
“I can remember saying to my wife than-perfect decision, then you’ve ally rewarding it’s been.
that my next 10 year goal has to be to got the chance to have a conversation Archived columns from this series can be
find a way to run this business with- and say, ‘hey, have you ever thought “I really enjoy it when you find found at www.fcc-fac.ca/learning. Farm Credit
out Stan being here.” about doing it this way?’ ” someone who is keen and wants to Canada enables business management skill
find a better way that takes less time development through resources such as this
Vander Waal and wife, Wilma, It’s not a quick process and some- or results in a better outcome,” he column, and information and learning events
started Rainbow Greenhouses in times it doesn’t work out and “you says. available across Canada.
Chilliwack, B.C., 30 years ago and
now have more than 200 mostly year- Need a Quick and Smooth Delivery?
round employees, three locations in We’ve Got You Covered.
two provinces and 2.5 million sq. feet
of greenhouse space that produces The Complete Storage Solution Under One Roof. With demand for on–farm grain storage at an all
flowers and potted plants for the time high, Meridian can help.
country’s leading big box retailers. ;VÄUKHUH\[OVYPaLK4LYPKPHUKLHSLYULHY`V\]PZP[ www.MeridianMFG.com/locator.
The production and infrastructure BUILT TO MOVE. BUILT TO STORE.
side mostly happens “without Stan.”
His method for empowering employ- BUILT FOR YOUR FARM.
ees is simple and can work for any
farm business of any size, even those 4LYPKPHU4HU\MHJ[\YPUN0UJ9LNPZ[LYLK;YHKLTHYRZ<ZLK<UKLY3PJLUZL
where the employees are family
members.
However, simple doesn’t mean
easy. Personnel management never
is.
In fact, it was a fairly basic thing that
held Vander Waal back for many
years.
“I had to start recognizing that the
people around me did have skills, and
sometimes they were better than
mine,” he says.
“But they didn’t have the experi-
ence, and in order to get that experi-
ence, I had to learn to give up some
control and give over the responsibil-
ity to them.”
It’s a tricky distinction.
At the time, Vander Waal ran his
business with a couple of supervi-
sors, but he was the one who made
most of the decisions, from fertiliza-
tion regimes to building mainte-
nance schedules. He couldn’t just
hand off those jobs because his staff
didn’t have the experience.
So he tried to look at people with
fresh eyes. Did they show an aptitude
in certain areas? And just as critically,
how much did they care?
“I look for a person’s attention to
detail and a willingness to look for a
better way,” he says.
The next step was to spend time
with the prospects: walking through
the greenhouse, asking their opinion
on how to deal with a problem and
discussing options.
Then came a gentle handing over of
authority.
For example, one employee showed
good potential but was “used to fol-
lowing the day’s orders and just fol-
lowing a work list.” So Vander Waal
asked him to create his own work list
to prioritize what needed doing and
how it should be done.
This is another tricky bit.
“Sometimes a person can be over-
whelmed,” says Vander Waal.
“People get very comfortable with
78 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER MARKETS
CATTLE & SHEEP GRAINS
Steers 600-700 lb. Slaughter Cattle ($/cwt) ICE Futures Pulse and Special Crops
(average $/cwt) Canada
Grade A Live Previous Year Rail Previous Source: STAT Publishing, which solicits bids from Maviga N.A.,
Alberta July 25-31 July 18-24 ago July 25-31 July 18-24 Barley (Oct.) Legumex Walker, CGF Brokerage, Parrish & Heimbecker, Simpson
Steers Seeds and Alliance Grain Traders. Prices paid for dressed product
$40 Alta. n/a 164.00 n/a n/a 274.25-278.75 $145 at plant.
$20 Ont. 165.83-183.15 156.34-173.56 123.17 279.00-282.00 276.00-280.00 $140
$0 $135 Aug. 1 Avg. July 28
$-20 n/a 277.50-278.75 $130
$-40 Heifers n/a n/a n/a 278.00-281.00 275.00-279.00 $125 Laird lentils, No. 1 (¢/lb) 21.50-23.75 22.43 22.43
Alta. 151.47-171.50 121.01 Laird lentils, Xtra 3 (¢/lb) 15.00-17.00 16.25 16.25
6/26 7/4 7/11 7/18 7/25 8/1 Canfax 6/27 7/7 7/14 7/21 7/28 8/1 Richlea lentils, No. 1 (¢/lb) 19.00-20.00 19.50 19.50
Ont. 155.73-177.54
Saskatchewan Durum (Oct.) Eston lentils, No. 1 (¢/lb) 15.50-17.00 16.36 17.14
*Live f.o.b. feedlot, rail f.o.b. plant. Eston lentils, Xtra 3 (¢/lb) 12.40-13.00 12.85 12.85
$470 $260 Sm. Red lentils, No. 2 (¢/lb) 23.75-28.00 25.61 25.14
$460 $250
$450 Feeder Cattle ($/cwt) Cattle Slaughter $240 Sm. Red lentils, Xtra 3 (¢/lb) 18.50-19.00 18.88 18.88
$440 $230
$430 $220 Peas, green No. 1 ($/bu) 8.80-10.00 9.16 9.26
6/26 7/4 7/11 7/18 7/25 8/1 Sask. Man. Alta. B.C. To July 26 Fed. inspections only 6/27 7/7 7/14 7/21 7/28 8/1 Peas, green 10% bleach ($/bu) 7.80-8.00 7.96 7.96
Manitoba Steers Canada U.S. Milling Wheat (Oct.) Peas, med. yellow No. 1 ($/bu) 6.00-6.50 6.38 6.38
900-1000 1,546,513 17,311,096 6.43
$210 800-900 no sales Report 190-206 181-205 To date 2014 1,468,995 18,422,557 $220 Peas, sm. yellow No. 2 ($/bu) 6.00-6.50 6.43 8.27
$200 700-800 185-228 not 198-221 185-215 To date 2013 $210
$190 600-700 201-240 211-230 196-225 % Change 14/13 +5.3 -6.0 $200 Maple peas ($/bu) 8.00-8.40 8.27
$180 500-600 231-258 available 230-251 no sales $190
$170 400-500 246-269 - 240-278 no sales $180 Feed peas ($/bu) 4.25-4.35 4.28 4.28
Heifers no sales - 259-300 no sales
6/26 7/4 7/11 7/18 7/25 8/1 800-900 - 6/27 7/7 7/14 7/21 7/28 8/1 Mustard, yellow, No. 1 (¢/lb) 38.00-40.75 39.38 39.00
700-800
600-700 Chicago Futures ($US/cwt) Cash Prices Mustard, brown, No. 1 (¢/lb) 32.30-34.00 33.58 33.58
500-600
400-500 Close Close Trend Year Canola (cash - Nov.) Mustard, Oriental, No. 1 (¢/lb) 29.50-31.00 30.50 29.50
300-400
Aug. 1 July 25 ago $470 Canaryseed (¢/lb) 23.50-24.00 23.71 23.71
Canfax $460
Steers 165-192 Report 185-204 180-200 $450 Desi chickpeas (¢/lb) 15.20-16.00 15.73 15.73
Heifers 186-213 not 196-218 185-218 $440
Cows 204-230 210-235 195-225 Live Cattle 159.10 -1.80 120.65 $430 Kabuli, 8mm, No. 1 (¢/lb) 16.00-20.00 16.13 16.13
Bulls 210-239 available 225-244 no sales Aug 157.30 159.80 -3.80 124.48 Kabuli, 7mm, No. 1 (¢/lb) 11.00-16.00 11.88 11.88
215-265 - 227-270 no sales Oct 156.00 158.78 -2.35 127.00 6/26 7/4 7/11 7/18 7/25 8/1 B-90 ckpeas, No. 1 (¢/lb) 11.00-18.75 14.31 14.31
no sales - no sales no sales Dec 156.43 156.85 -0.12 128.90
Heifers 500-600 lb. - Feb 156.73 156.35 -0.40 130.28 Canola (basis - Nov.) Cash Prices
(average $/cwt) Canfax Apr 155.95
$40 July 30 July 23 Year Ago
Alberta Average Carcass Weight Feeder Cattle +2.03 153.73 $20 No. 3 Oats Saskatoon ($/tonne) n/a 125.19 198.70
Aug 220.28 218.25 +0.65 157.00 $0 Snflwr NuSun Enderlin ND (¢/lb) 18.85 18.90 20.90
$560 Sep 219.90 219.25 +0.75 159.15 $-20
July 26/14 July 27/13 YTD 14 YTD 13 Oct 219.60 218.85 +0.08 160.03 $-40 U.S. Grain Cash Prices ($US/bu.) Aug. 1
$540 Nov 218.20 218.28 +0.80 158.73
840 869 843 871 Jan 213.00 212.20 6/26 7/4 7/11 7/18 7/25 8/1 USDA 5.61
$520 776 789 787 817 5.16
700 692 681 676 Est. Beef Wholesale ($/cwt) Feed Wheat (Lethbridge) No. 1 DNS (14%) Montana elevator 4.32
$500 966 938 920 911 No. 1 DNS (13%) Montana elevator 4.20
n/a $210 No. 1 Durum (13%) Montana elevator n/a
$200 No. 1 Malt Barley Montana elevator
$480 $190 No. 2 Feed Barley Montana elevator
6/26 7/4 7/11 7/18 7/25 8/1 $180
$170
Saskatchewan U.S. Cash cattle ($US/cwt) Montreal This wk Last wk Yr. ago
n/a 277-279 n/a 6/26 7/4 7/11 7/18 7/25 8/1
$210 Slaughter cattle (35-65% choice) Steers Heifers
$200 n/a Canfax Flax (elevator bid- S’toon)
$190 n/a
$180 National n/a n/a Sheep ($/lb.) & Goats ($/head) $560
$170 n/a $540
Kansas n/a July 25 July 18 $520 Grain Futures
6/26 7/4 7/11 7/18 7/25 8/1 $500
Nebraska n/a 3.00 Aug. 1 July 28 Trend Year ago
0.18-0.21 n/a
Nebraska (dressed) n/a Base rail (index 100) 3.00 1.50-1.90 $480 Wpg ICE Canola ($/tonne) 493.60
497.40
Manitoba Range 0.14-0.24 0.50 6/26 7/4 7/11 7/18 7/25 8/1 Nov 434.30 447.10 -12.80 502.20
504.90
$230 Feeders No. 1 (800-900 lb) Steers Trend Feeder lambs 1.50-1.90 SunGold Meats Barley (cash - Oct.) Jan 438.40 451.10 -12.70
South Dakota n/a n/a 257.00
$225 Billings n/a n/a Sheep (live) 0.50 $210 Mar 439.10 451.70 -12.60 260.00
Dodge City n/a n/a $200 267.00
$220 $190 May 435.40 448.20 -12.80
USDA 296.00
$215 July 28 July 21 $180 Basis: $43.50 Wpg ICE Milling Wheat ($/tonne) 300.00
n/a n/a New lambs 1.75-2.40 1.80-2.57 $170 Oct 188.00 190.00 -2.00 189.00
$210 65-80 lb 1.80-2.15 1.75-2.10 6/26 7/4 7/11 7/18 7/25 8/1 194.00
80-95 lb 1.80-1.91 1.80-1.96
6/26 7/4 7/11 7/18 7/25 8/1 Cattle / Beef Trade > 95 lb 1.80-1.98 1.78-1.92 Canola and barley are basis Dec 194.00 195.00 -1.00 6.6050
> 110 lb 1.00-1.80 0.85-1.88 par region. Feed wheat basis 6.7300
Exports % from 2014 Feeder lambs 1.35-1.90 1.35-1.90 Lethbridge. Basis is best bid. Mar 196.00 196.00 0.00 6.8250
Sheep 0.85-0.95 0.85-0.95 6.8750
Canadian Beef Production Sltr. cattle to U.S. (head) 411,005 (1) -3.5 Rams 0.80-0.90 0.80-0.90 Chicago Nearby Wpg ICE Durum Wheat ($/tonne)
Feeder C&C to U.S. (head) Kids Futures ($US/100 bu.) 3.3875
million lb. YTD % change Total beef to U.S. (tonnes) 232,355 (1) +40.7 65-110 65-110 Oct 250.00 250.00 0.00 3.2650
Total beef, all nations (tonnes) Corn (Sept.) 3.3250
Fed 1073.7 +3 90,972 (3) +9.6 Dec 256.00 256.00 0.00
Non-fed 163.5 -3 $480 13.3100
Total beef 1237.2 +3 126,114 (3) +9.1 $440 Wpg ICE Barley ($/tonne) 12.1275
$400 11.8150
$360 Oct 136.50 137.50 -1.00 11.8725
$320
Imports % from 2014 Dec 138.50 139.50 -1.00 42.38
6/27 7/7 7/14 7/21 7/28 8/1 42.49
Canfax Sltr. cattle from U.S. (head) n/a (2) n/a Ontario Stockyards Inc. Chicago Wheat ($US/bu.) 42.60
Soybeans (Aug.)
Feeder C&C from U.S. (head) 19,416 (2) -3.0 July 17 Sep 5.3425 5.3475 -0.0050 412.1
$1440 385.2
EXCHANGE RATE: Total beef from U.S. (tonnes) 81,168 (4) -21.6 Wool lambs, new crop >80 lb 1.55-1.70 $1360 Dec 5.5325 5.5775 -0.0450 357.2
$1280
AUGUST 1 Total beef, all nations (tonnes) 119,579 ( 4) -10.8 Wool lambs, new crop <80 lb 1.75 $1200 Mar 5.7400 5.8025 -0.0625 4.7600
$1 Cdn. = $1.0919 U.S. $1120 4.6375
$1 U.S. = $0.9158 Cdn. (1) to July 19/14 (2) to May 31/14 (3) to May 31/14 (4) to July 26/14 Hair lambs, new crop 1.50-1.55 May 5.8700 5.9475 -0.0775 4.7650
6/27 7/7 7/14 7/21 7/28 8/1 4.8425
Agriculture Canada Fed sheep 0.42-0.52 Chicago Oats ($US/bu.)
Oats (Sept.) 7.4125
Sask. Sheep Dev. Bd. Sep 3.5075 3.6650 -0.1575 7.5000
$400 7.6200
$380 Dec 3.3075 3.3750 -0.0675 7.6950
$360
HOGS $340 Mar 3.1825 3.2225 -0.0400 7.0675
$320 7.1875
Due to wide reporting and Chicago Soybeans ($US/bu.) 7.2675
collection methods, it is 6/27 7/7 7/14 7/21 7/28 8/1
misleading to compare hog Aug 12.1500 12.3650 -0.2150
prices between provinces. Minneapolis Nearby
Fixed contract $/ckg Hog Slaughter Futures ($US/100bu.) Sep 10.7350 11.3700 -0.6350
Index 100 Hog Price
Trends ($/ckg) Spring Wheat (Sept.) Nov 10.5850 11.0775 -0.4925
Alberta (Hams Maple Leaf Thunder To July 26 Fed. inspections only $720 Jan 10.6675 11.1425 -0.4750
$690
$260 Marketing) Sig 3 Creek Pork To date 2014 Canada U.S. $660 Chicago Soy Oil (¢US/lb.)
$250 To date 2013 11,180,257 59,941,000 $630
$240 Aug 24-Sep 06 Aug. 1 Aug. 1 % change 11,365,223 62,406,969 $600 Aug 35.45 36.52 -1.07
$230 Sep 07-Sep 20 n/a 207.16-215.16
$220 Sep 21-Oct 04 198.65-201.15 14/13 -1.6 -4.0 6/27 7/7 7/14 7/21 7/28 8/1 Sep 35.54 36.60 -1.06
Oct 05-Oct 18 198.79-201.29 199.65-202.14
6/26 7/4 7/11 7/18 7/25 8/1 Oct 19-Nov 01 199.79-202.23 197.12-199.12 Alta. Oct 35.58 36.62 -1.04
Nov 02-Nov 15 197.22-199.22 182.37-193.61 Sask.
Saskatchewan Nov 16-Nov 29 182.57-193.71 177.85-179.86 Chicago Soy Meal ($US/short ton)
Nov 30-Dec 13 178.05-180.06 172.33-173.34
$270 Dec 14-Dec 27 172.53-173.54 179.86-180.36 Aug 387.5 402.8 -15.3
$260 Dec 28-Jan 10 180.06-180.56 173.84-177.85
$250 174.04-178.04 171.02-171.02 Agriculture Canada Sep 355.8 375.2 -19.4
$240 171.55-171.55
$230 Index 100 hogs $/ckg Oct 345.1 360.2 -15.1
6/26 7/4 7/11 7/18 7/25 8/1 Chicago Corn ($US/bu.)
Manitoba 243.28 Man. 235.00 Sep 3.5250 3.6775 -0.1525
243.45 Que. 257.09
$250 Dec 3.6225 3.7675 -0.1449
$240 *incl. wt. premiums
$230 Mar 3.7475 3.8850 -0.1375
$220
$210 May 3.8325 3.9650 -0.1325
6/26 7/4 7/11 7/18 7/25 8/1 Minneapolis Wheat ($US/bu.)
Hogs / Pork Trade Sep 6.1600 6.2125 -0.0525
Export % from 2014 Import % from 2014 Dec 6.2675 6.3075 -0.0400
442,209 (1) -8.2 n/a n/a Mar 6.4050 6.4275 -0.0225
147,227 (2) +1.5 96,575 (3) -17.1
Sltr. hogs to/fm U.S. (head) 483,187 (2) -2.8 102,959 (3) -16.5 May 6.4825 6.5000 -0.0175
Total pork to/fm U.S. (tonnes)
Total pork, all nations (tonnes) (3) to July 26/14 Agriculture Canada Kansas City Wheat ($US/bu.)
(1) to July 19/14 (2) to May 31/14 Sep 6.3275 6.2550 +0.0725
Dec 6.4350 6.4025 +0.0145
Mar 6.4800 6.4750 +0.0050
Chicago Hogs Lean ($US/cwt) Canadian Exports & Crush
Close Close Trend Year Close Close Trend Year To To Total Last
(1,000 MT) July 27 July 20 to date year
Aug. 1 July 25 ago Aug. 1 July 25 ago
568.8
Aug 118.03 123.63 -5.6 99.25 Apr 89.55 93.95 -4.40 84.23 Wheat n/a 151.4 16835.3 13445.1
29.8
Oct 102.83 107.28 -4.45 83.95 May 89.50 93.00 -3.50 87.85 Durum n/a 20.8 4671.7 4142.5
Oats n/a 23.7 1095.7 1020.7
Dec 94.40 98.15 -3.75 80.80 Jun 91.65 94.80 -3.15 90.18 149.0
Barley n/a 20.4 1267.4 1305.7
Feb 90.60 93.58 -2.98 83.33 Jul 90.75 92.40 -1.65 88.55 Flax n/a 388.3 315.9
9.3
ELEVATOR (000 tonnes) July 27 July 20 YTD Canola n/a July 23 8485.2 6979.9
SHIPMENTS Alta. n/a 248.4 13609.6 Peas n/a 1801.6 1939.4
Sask. n/a 451.4 19522.3 155.7
Man. n/a 156.2 6460.0 Lentils n/a 363.1 n/a
(1,000 MT) July 30 to date Last year
Canola crush 169.7 6961.2 6716.8
WEATHER 79THE WESTERN PRODUCER | WWW.PRODUCER.COM | AUGUST 7, 2014
BIRD ON A WIRE | A juvenile brown-headed cowbird stretches itself on a pasture
fence near Chamberlain Sask. | MICKEY WATKINS PHOTO
PUBLISHER: SHAUN JESSOME SUBSCRIPTIONS
MANAGING EDITOR: MICHAEL RAINE
Subscriptions: 1-800-667-6929
Box 2500, 2310 Millar Ave.
Saskatoon, Sask. S7K 2C4. In Saskatoon: (306) 665-3522
Tel: (306) 665-3500
Fax: (306) 244-9445
The Western Producer is published at
Saskatoon, Sask., by Western Producer Subs. supervisor: GWEN THOMPSON
Publications, owned by Glacier Media,
Inc. Printed in Canada. e-mail: [email protected]
President, Glacier Media Agricultural Per copy retail $4.25 plus taxes
Information Group: BOB WILLCOX
Contact: [email protected] SUBSCRIPTION RATES
Phone: (204) 944-5751
Within Canada:
One year: $86.24 + applicable taxes
Two years: $160.41 + applicable taxes
Sask., Alta., Ontario & B.C. add 5% GST.
Manitoba add 5% GST & 8% PST.
Nova Scotia add 15% HST.
ADVERTISING United States $186.85 US/year
All other countries $372.52 Cdn/year
Classified ads: 1-800-667-7770 EDITORIAL
Display ads: 1-800-667-7776
In Saskatoon: (306) 665-3515 Newsroom toll-free: 1-800-667-6978
Fax: (306) 653-8750
HOURS: Fax: (306) 934-2401
Mon.& Fri. 8:30 a.m. – 4:30 p.m. News editor: TERRY FRIES
Tues., Wed., Thurs. 8:30 a.m. – 8 p.m. e-mail: [email protected]
e-mail: [email protected] News stories and photos to be submitted
by Friday or sooner each week.
Advertising director: KELLY BERG
Classified sales mgr: SHAUNA BRAND The Western Producer Online
Features all current classified ads and
TEMPERATURE TEMP. PRECIP. PRECIPITATION ADVERTISING RATES other information. Ads posted online
FORECAST MAP MAP FORECAST daily. See www.producer.com or contact
Classified liner ads: $5.85 per printed line [email protected]
Aug. 7-13 (in °C) Aug. 7 - 13 (in mm)
Much (3 line minimum) + $3.00 per paid week
above
normal online charge
Classified display ads: $6.70 per agate line Letters to the Editor/contact a columnist
Mail, fax or e-mail letters to
ROP display: $9.50 per agate line [email protected]. Include your
full name, address and phone number
Churchill Above Churchill The Western Producer reserves the for verification purposes. To contact
16 / 7 normal 21.7 right to revise, edit, classify or reject a columnist, write the letter in care of
Winnipeg any advertisement submitted to it for this newspaper. We’ll forward it to the
Normal Prince George 24.2 publication. Classified word ads are columnist.
nonrefundable.
Below
Prince George normal 14.9
21 /8 Edmonton
Edmonton Much 15.0 CANADIAN HERITAGE Coming Events/ Stock Sales/ Mailbox
22 / 11 below ACKNOWLEDGEMENT Please mail details, including a phone
Saskatoon normal Saskatoon number or call (306) 665-3544. Or fax
Calgary 24 / 10 Calgary 9.4 We acknowledge the financial support of to (306) 934-2401 or email events@
Vancouver 22/8 Regina Vancouver the Government of Canada through the producer.com
21 / 13 25 / 11 10.0 12.8 Regina Canada Periodical Fund of the Department
Winnipeg of Canadian Heritage.
25 / 12 12.4 If you’d like to buy a photo or order a copy
Return undeliverable Canadian addresses of a news story that appeared in the paper,
to Subscriptions, Box 2500, Saskatoon, call our librarian at (306) 665-9606.
Sask. S7K 2C4
The numbers on the above maps are average temperature and precipitation figures for the forecast week, based on historical data from 1971-2000.
Publications Mail
Maps provided by WeatherTec Services: www.weathertec.mb.ca n/a = not available; tr = trace; 1 inch = 25.4 millimetres (mm) Agreement ™ Printed with inks
containing canola oil
No. 40069240
Member, Canadian Farm Press Association
LAST WEEK’S WEATHER SUMMARY ENDING AUG. 1
SASKATCHEWAN ALBERTA MANITOBA
Temperature Precipitation Temperature Precipitation Temperature Precipitation
last week
last week since April 1 last week last week since April 1 last week last week since April 1
High Low High Low High Low
mm mm % mm mm % mm mm %
Assiniboia 30.6 9.6 0.0 276.7 135 Brooks 34.9 12.1 0.0 187.2 110 Brandon 28.0 7.5 0.0 459.5 199
Broadview 26.3 7.7 0.9 360.5 161 Calgary 32.2 9.7 0.0 192.8 8.5 1.8 357.7 156
Eastend 33.7 11.8 1.3 149.5 76 Cold Lake 29.4 13.2 0.4 313.0 84 Dauphin 28.7 9.8 0.0 281.7 116
Estevan 27.4 9.4 0.0 256.0 116 Coronation 32.4 10.3 0.0 199.2 10.5 0.0 379.8 173
Kindersley 30.9 11.8 0.0 267.0 150 Edmonton 30.6 9.2 0.4 195.5 147 Gimli 28.1 10.2 0.0 233.3 92
Maple Creek 35.4 10.9 4.3 130.5 70 Grande Prairie 30.0 11.8 1.6 166.2 10.1 0.2 239.4 98
Meadow Lake 28.8 9.9 0.0 299.5 148 High Level 29.6 10.4 0.0 176.2 105 Melita 27.8 9.0 1.4 318.8 132
Melfort 27.5 8.7 0.0 286.2 142 Lethbridge 32.6 10.3 0.0 303.9 7.7 0.0 258.7 102
Nipawin 27.9 7.2 0.0 308.2 142 Lloydminster 28.3 11.6 0.0 269.3 80 Morden 27.3
North Battleford 27.5 10.7 0.0 334.9 170 Medicine Hat 36.6 13.5 0.0 185.7 13.5
Prince Albert 28.5 8.8 0.3 387.0 183 Milk River 34.3 11.1 0.0 176.1 84 Portage La Prairie 27.5 9.3
Regina 28.5 11.8 0.0 300.6 148 Peace River 31.6 8.4 0.0 123.6 12.3
Rockglen 31.4 9.1 1.9 285.5 144 Pincher Creek 31.9 8.5 0.0 244.3 101 Swan River 27.8 10.4
Saskatoon 28.4 12.3 0.0 306.7 160 Red Deer 29.3 9.9 0.0 306.7 8.3
Swift Current 33.5 10.3 14.8 198.5 104 Stavely 29.4 13.9 5.8 338.4 158 Winnipeg 27.9
Val Marie 33.3 9.1 0.0 318.2 181 Vegreville 30.5 11.1 0.2 265.7
Yorkton 27.7 8.5 0.0 409.6 178 131
Wynyard 27.1 9.2 0.0 318.7 152
112 BRITISH COLUMBIA
86 78
65 Cranbrook 36.6 1.6 134.4 67
0.0 132.7 100
94 Fort St. John 30.0 0.0 116.0 100
0.0 141.9 63
118 Kamloops 36.5 1.1 125.8
147 Kelowna 35.5
130 Prince George 29.8
All data provided by Agriculture and Agri-Food Canada’s National Agroclimate Information Service: www.agr.gc.ca/drought.
Data has undergone only preliminary quality checking. Maps provided by WeatherTec Services Inc.: www.weathertec.mb.ca
Move it! in print and online next day.
Now your classified word ads will go online within one business day from when you book them to run in the Producer Classifieds.
Our team of Classified Sales Associates has the product knowledge, marketing strategies
and access to qualified buyers that is unmatched in the industry.
Place your classified ad and experience our professional service first hand.
Monday to Friday, ads will be posted online within one business day. Real Time online will be placed a maximum of 11 days prior to first print insertion.
CLASSIFIEDS.PRODUCER.COM | 1-800-667-7770
80 AUGUST 7, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER
Want to be in control of when and how you spray? The cab-forward / rear-engine configuration of
Case IH Patriot® sprayers minimizes rutting and soil compaction and allows you to get in the field
sooner. And our exclusive AIM Command® spray system technology option allows application rate
and spray pressure to remain constant, regardless of sprayer speed or field conditions. To learn
more see your Case IH dealer or visit us online at caseih.com/patriot-sprayer.
BE READY.
©2014 CNH Industrial America LLC. All rights reserved.
Case IH is a trademark registered in the United States and many other countries, owned by or licensed to CNH Industrial N.V., its subsidiaries or affiliates. www.caseih.com
The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Western Producer 2014-08-07
Discover the best professional documents and content resources in AnyFlip Document Base.
Search