NEW GET CREATING...
A PRACTICAL GUIDE TO CREATING THE ULTIMATE SCRAPBOOK
FEATURING INSIDE!
200 INSPIRING
TUTORIALS
PROJECTS
AND IDEAS Step-by-step guides to
record your memories
THINK Innovative decorations
GREEN
Ecacrnaodf-tftirnriigecnktsdiplys
PLUS!
Templates
included
Make the most of photos
Digital
Edition
SECOND Celebrate life’s milestones
EDITION
Learn all the techniques you need to get started
GET CREATING...
Welcome
SaymiklcnontoowgetostrpcerdhtiuvehicTeanoyitvtlattRapeghcuarpupohichevlgcateiaaeshedbotkeuugeputopysaavtmneeonhblslt.bolovdiatrcotietboiehiqWey3ooentguyitarlduleehkrod,ueD?sagemlooessirntetu,aennc.shktLlhuoieyataosrakWglistreeifleungnanlverlappeatsaprithgieektdd’abnrseotansmltoaei,ael,lsbgtwsdtegehoganenrfhhpahetbe,uxeoraexhlnnleaicneseosiharpn.prntweevedrttynotetImmalsaetsndnobooiwo,rywwfncs,otetpmreaoocyctrg.siiwthrghtcansohstturhWlshisoaeoapirtoiplghuocnselayrpwtipoprhtueo’rotshgfmrehbbdaoiteektteinnbeseiftaeohpoinrrteyhaeggrtuasshfeobwogortbaito!ityteenrcwolkhkcuatadaohanrrr,eoyioseelryeieindouaawonoiekdscagvlwlktgunisretsainiaci,dvkgo.eseef.
vfddd
GET CREATING...
Future PLC Quay House, The Ambury, Bath, BA1 1UA
Editorial
Editor Jacqueline Snowden
Senior Designer Adam Markiewicz
Compiled by Philippa Grafton & Madelene King
Senior Art Editor Andy Downes
Head of Art & Design Greg Whitaker
Editorial Director Jon White
Cover images
Getty Images, Alamy
Photography
James Sheppard
All copyrights and trademarks are recognised and respected
Advertising
Media packs are available on request
Commercial Director Clare Dove
International
Head of Print Licensing Rachel Shaw
[email protected]
www.futurecontenthub.com
Circulation
Head of Newstrade Tim Mathers
Production
Head of Production Mark Constance
Production Project Manager Matthew Eglinton
Advertising Production Manager Joanne Crosby
Digital Editions Controller Jason Hudson
Production Managers Keely Miller, Nola Cokely,
Vivienne Calvert, Fran Twentyman
Printed by William Gibbons, 26 Planetary Road,
Willenhall, West Midlands, WV13 3XT
Distributed by Marketforce, 5 Churchill Place, Canary Wharf, London, E14 5HU
www.marketforce.co.uk Tel: 0203 787 90011
Papercraft & Scrapbooking Second Edition (HOB4036)
© 2021 Future Publishing Limited
All content previously appeared in this
edition of 200 Scrapbooking Ideas
We are committed to only using magazine paper which is derived from responsibly managed,
certified forestry and chlorine-free manufacture. The paper in this bookazine was sourced
and produced from sustainable managed forests, conforming to strict environmental and
socioeconomic standards. The paper holds full FSC or PEFC certification and accreditation.
All contents © 2021 Future Publishing Limited or published under licence. All rights reserved.
No part of this magazine may be used, stored, transmitted or reproduced in any way without
the prior written permission of the publisher. Future Publishing Limited (company number
2008885) is registered in England and Wales. Registered office: Quay House, The Ambury,
Bath BA1 1UA. All information contained in this publication is for information only and is, as far
as we are aware, correct at the time of going to press. Future cannot accept any responsibility
for errors or inaccuracies in such information. You are advised to contact manufacturers and
retailers directly with regard to the price of products/services referred to in this publication. Apps
and websites mentioned in this publication are not under our control. We are not responsible for
their contents or any other changes or updates to them. This magazine is fully independent and
not affiliated in any way with the companies mentioned herein.
Future plc is a public Chief executive Zillah Byng-Thorne
company quoted on the Non-executive chairman Richard Huntingford
London Stock Exchange
(symbol: FUTR) Chief financial officer Penny Ladkin-Brand
www.futureplc.com Tel +44 (0)1225 442 244
Contents
GETTING STARTED 32 8
56
8 MAKING MEMORIES THAT LAST
1O TOOLS OF THE TRADE
14 SCRAP ON A BUDGET
16 THINK GREEN
18 HOW TO USE PHOTOS
22 TELL YOUR STORY
24 LAY OUT YOUR PAGE
26 PAGE DESIGN
3O SKETCHING MAPS
32 STAY ORGANISED
34 SCRAPBOOKING TECHNIQUES
38 THE ART OF EMBELLISHMENT
44 CHOOSING AN ALBUM COVER
46 USING WRITING
48 SAY IT WITH QUOTES
5O WITH THE FAMILY
52 DIGITAL SCRAPBOOKING
6
132
THEMES
78 56 HEAVENLY HOLIDAYS
64 VINTAGE WEDDING
7O CHRISTMAS MEMORIES
78 PRECIOUS ANNIVERSARIES
84 SUMMER FESTIVAL
9O PET PORTRAIT
96 BABY BOY & GIRL
1O2 CHILDREN GROWING UP
1O8 SEASONAL SCENERY
114 MUSIC LOVER
GET 12O SURF ’N SCRAP
CRAFTY WITH 126 NIGHT AT THE THEATRE
DIY PROJECTS 132 EASTER EGGS HUNT
138 HEN DO + STAG DO
54
144 ROAD TRIP
TEMPLATES
15O TEMPLATES
7O TRACE THESE TEMPLATES FOR EASIER,
QUICKER SCRAPBOOKING!
7
Making memories
that last
Use a mixture of handmade and shop-bought items to
help you create a stunning page
S crapbooking is so much more than just a people started to keep scrapbooks containing photos
hobby to pass away the time. It is the art of and newspaper clippings.
chronicling memories for future generations.
These days our photos are often stored on our phones Modern-day scrapbooks use all types of materials,
or pasted all over Instagram, Facebook and Twitter, from items you can find in your home or outdoors,
but even if they are printed out, they’re often kept such as buttons and leaves, to the latest trends in the
hidden away in drawers. Making a scrapbook is not shops, from metallic foils to glitzy stickers.
only fun and relaxing, it is a way of creating something
beautiful either for yourself, as a gift, or to share with It may look difficult, but it is as easy as you make it.
your children and grandchildren. To put it simply, it is a photo album that tells a story
and anyone can do it. Unlike some crafts, you don’t
People have been scrapbooking since the 15th have to be particularly skilled to scrapbook and even if
century when they would collect love letters, poems you’re not the most artistic person in the world, your
and recipes as keepsakes. In the 16th century, album is something personal to you so as long as
friendship albums became popular and after 1939, you’re happy with it, that’s all that matters. This book
when photography became a commercial hobby, is full of ideas to help you create the perfect keepsake.
Let’s get started!
8
Getting started
1
CHOOSING YOUR PHOTOS
Before you start you’ll need to decide which photos you
want to use. You may want to focus on a full event like
a holiday or just one aspect of it, like your child playing
on the beach. By looking at your photos laid out you can
decide how many you want on the page and what sizes
you want them to be.
2 3 FIND A THEME
5 4
Depending on what photos you choose, you will then want
to decide on a theme. If you’re using baby photos, you
could keep it simple by choosing baby blue or pink paper
and putting emphasis on the images with simple frames.
If you want a heavily themed page, you could buy baby-
themed paper or embellishments such as rattles or prams.
ESSENTIAL MATERIALS
adwltOinoekhdenpgacewpteenepthdnyayaiosonpt,uegues’rrmvcoyesinsbouscepuhohlpolrwoislswisehaaesmnnmntrdeeatynoaanotddyusuyhrssy.epepoAs,rhusiehvoawewotdsoweas,slnylymatoaontsuuuodbc’nrbhaetehuseygeiycdoomoueitneroqng,muceyithpeoaoodmkuheo’lea.lsnvneeteed
SITTING PRETTY
Before you stick or glue everything down, you’ll need to
decide on your layout. Some people like to sketch out a
plan of what the page will look like first or you can place
your photos where you think you want them on your paper
and then add in your embellishments to finalise the page.
PUT IT INTO WORDS ©Alamy; Getty; Thinkstock
The final stage of scrapbooking is journalling. Words help
tell the story as you may not remember exactly what
happened or how you felt just by looking at your photos.
You can keep it short and sweet with titles and dates or
use longer handwritten memos. Poems or quotes can
also add sentiment to the page.
9
Tools of the trade
Walking into a craft store can be overwhelming as the choice of
materials is endless, but you only really need a few essentials…
Storage Stamps
boxes
Ink stamps come in a wide selection
Stay organised of designs, from numbers to pictures.
Stamps can be used to create borders
by storing your
or patterns, too.
tools well.
Ruler
Keep lines
straight with
a ruler.
Paper Embellishments
Choosing the right paper is You can buy embellishments,
vital. Paper comes in many but items such as buttons and ribbon can be
different colours and patterns
and it sets the scene for your found at home. These are used to decorate
layout and theme. Be careful to and draw attention to your page.
buy acid and lignin-free paper
so the paper does not age.
Pens and pencils
As well as for journalling, pens and
pencils are used for stencilling,
drawing templates and making
outlines. Coloured pens, pencils and
paints can be used to draw, colour
and paint on the page.
10
Stickers Getting started
You can get stickers for every theme, from animals to Albums
sports, in every colour and from simple to sparkling.
You can even buy alphabet stickers for lettering. There are different types
of albums, from three-
Washi tape ringed to post-bound
and in a range of sizes.
Create patterns You can get patterned
and borders with albums or plain ones.
Just remember to buy
washi tape. one with page protectors
or add them to your list
Glitter to keep your layouts safe.
Add a bit of
sparkle to your
page with some
glitter.
Cutters
Die-cut machines and
punches are an easy way of
creating intricate shapes. If you
only want a few shapes, punches
are cheaper, but if you invest in
a die-cut machine you can
save time.
Lettering Adhesives Stencils
Use ready-made There is a huge range of adhesives available. If you’re not
lettering if you Photo tabs can mat photos; a glue stick is useful brilliant at drawing,
don’t like your for sticking photos to a page; and glue dots make stencils are a
handwriting. attaching embellishments like buttons easier. great way to
make your own
Scissors embellishments.
Basic shapes can
There are three main types of scissors: straight, be used to mat
detailed and decorative. You’ll use regular photos and create
scissors the most, but other types will help with borders. If you
difficult cutting and add creativity. can’t afford to buy
stencils, try making
your own!
11
Choose
your tools
Choosing the right materials is key to A CUT ABOVE THE REST
creating an album that you’ll love
caactahnnhbayzrdadadgeeodnsabnYWercmeugemuossdcaainrhgchstnluoydasesbeiisadd’slroetolfrecedraltsoiaspfirilcotnmnsfalnisreiegeavsregrcotdn(sneerogureyue.tgipeaeesrodmtsnTsneesdhdtrcurituseamnohivii’bmtssrtvtcogaaotesieeioeslzvnnlmoecuoahespsegdgaravms,fseeasusaaeuapsmrpltaepecrsscssaleyloassrelaapta,wcoersrnitloremaglyueaeweoeeerfoetdtrxplpeeilpmpa,uayoaaieanctacaoa’plupls)daslpoidntautreialblneyfdtmbisrorpoktterlemeoosyet.fhirfsrorourggoicunaddtmasraretlyussoetileopnaeenopmtraatsbedsrgderuint,.en.elirefamdtMffYawcrgfhooneolihoaosooerrdrsuaedremsrnscc’nertdnltg’irwlitrsdobstuaaiwspnhaclbptiioelgelhytaraloporroarhvniaisinonstcpntetn.toi;gffabngldottnidtswooenoer:aetoeohcsmslutsiskarcttaahsrkyeairtanaelaiarknnwtispsgpehbagcdeihbueet.irssshtosyuIu;steolozraceekinrargsindn- g,
While you don’t have to spend a lot when making
a scrapbook, you’ll want to choose your
supplies wisely. If you’re only as good as your
tools then you want to make sure you have glue that won’t
seep through your paper and stamps that won’t smudge.
You’re telling a story so you want to make sure you
have the right elements to craft it with. Think carefully
about what paper you buy, as your background sets the
scene and the colours and embellishments you choose
create the mood. If you’re framing your photos or adding
a border with stencils or decorative scissors, this can put
emphasis on certain parts of your page and may convey a
different message. Do your research, but work with what
feels right to you. After all, it’s your story.
6 SHOW YOUR TRUE COLOURS
Choosing the colour of your paper is an important job – and
the most fun! Use colour to enhance your photographs. It’s
completely up to you what colours you choose, but just like
when painting a room, a colour wheel can come in handy to
see which work together. Take your photos and the colour
wheel to the store to see what looks good. A useful tip is
matching or contrasting the colour of the paper to the colours
in your photos. Try not to use too many colours – three is a
good rule – and mat (put a paper frame around) your photos
to lighten or darken the images. Colour can be used for mood,
for example, yellow works well for a happy, sunny feel.
12
Getting started
7 A STICKY SITUATION
It can be tricky trying to choose the right adhesive for might keep at home, are not always as effective. Make sure you
scrapbooking because there are so many different types, but no know whether you want a wet or dry adhesive and something
matter what you use, make sure it’s acid-free so that it doesn’t removable, repositionable or permanent. Most shops stock
harm your paper or photos. Do not use rubber cement, even if a range of glues from spray to liquid to sticks, all of different
it is acid-free, as this will cause damage. strengths and which can be used for different materials.
Some people prefer to use glue because it is easy and saves Other options include, photo tabs and photo corners, runner
time, but glue can be messy and cheap glue sticks, which you tape and glue dots. Here are three scrapbooking favourites.
• Photo tape is an easy to use and an • Glue dots work well for sticking • Foam pads adds an extra
effective method of fixing images embellishments to a page dimension to your design
9
When
applying liquid
adhesive, use
an old credit
card to help
spread it evenly.
8 10 ©Thinkstock
eKmlesikseebetpqeobulrsliieaimsnnahgpsdamislltsllhaebafenenomtdxsb.yin owfIfuasynsceotisutcsooudbtroicutnylye’ptleost,s
smscaisllsdoerstafiolsr.
13
Scrap on a budget
Is your scrapbooking wishlist as long as your arm? Follow our money-saving
tips to get more bang for your buck when shopping for supplies
When you need scrapbook
supplies, the first thing you
should do is set a budget
and make a list of what you want. We
all tend to overspend when shopping,
but if you plan out your scrapbook
and only get what you need, you
won’t spend as much. If you don’t
want to pay a fortune, try shopping
for materials in the sales or check
out your pound or dollar shop; there
are always cheap options for what
you need. But if you can’t resist and
shopping is too much of a temptation,
why not have your friends round
for a scrapbooking party and have a
material swap? They’re bound to have
items that they’ve used countless
times that you want and vice versa.
BEAUTIFUL BARGAIN IDEAS
It’s much easier than you think to scrapbook on a budget. All you have to
do is look around you at the everyday items that could come in handy
Next time you buy a new piece 11
of clothing don’t throw away the
tag when you cut it off. Instead
of buying tags for your pages
you can decorate your clothes
tags and add them
to your layout.
Wrapping 12
paper isn’t just
for presents. Cut out Keep the front of your cards for
pictures on your wrapping your scrapbook. You can cut out the
paper to stick on your pages pictures or lettering to use on the
or use plain or patterned page, and sometimes cards even
paper as a background, have ribbon and buttons on them
photo mat or border that you can use.
element.
14
Getting started
Splurge vs steal Checkoutthesecheaperdupesfor
expensive supplies and tools!
13 Cookie cutters
Die-cutting machines stdmSharnveaaoemwkwemaofleoruamonktu.eebnIyetcdlmbolitysohahkuyemisetciaenuckngtuetttsesmtorefomorosrnreeacttoahtminimcnuabgecre,dhybuoalusounetwdmditeu’aisrgssbahesutgtadearkeglnrnaeectitaifl.ewsdJyttauooyostcwtount.
Die-cutting machines can connect to apps via Wi-Fi Paper flowers
to give you access to thousands of fonts, images and
patterns, which the machine will then cut out using any If you do a lot of scrapbooking, embellishments like flowers
type of material – so you can create a hot air balloon out – while not too expensive individually – can soon add
of felt or intricate paper snowflakes. You can even upload up. Instead, why not try to make your own paper flower
your own designs, so you embellishments? There are lots of different styles for this (see
can literally make anything page 88 for a tutorial to make flowers from tissue paper), but
you can imagine. it is as simple as coiling, crumpling or cutting and layering
card into different shapes.
14
Paperclip angelTAanrhilebblecbyurkooetltuaneiscrntflehsey)oreoapdmnuadtgupohcerimhrbtchbyaleioopkenbu, a.eacIabtacd’senuaaatddensodas(piwntmehgirtepehhnllaejepuuamsssstifbntrahegoplrmlaeiasapkhadnemiborncertgolnitpktothe.iesn ©Getty; Thinkstock
Flower embellishmentsCtdhftroeoaersfsytiaegosdnfltuoosor,rrwnlecaisoenyrlosgoseuuyaltlron.srude, ramldesacaytr-veamerpsiaab(ldopseoiacknfltuodprraesagidlze)eesimsn.abTanehdwlelaiissddehedmaivnraeegrnipettesetyxrliftkoeuecfret
attach it to the paperclip.
15 Silver embellishments
Metallic embellishments are one of the
latest trends in scrapbooking at the moment
and it is easy to see why. You can buy packets of
small, intricately designed silver decorations, like
this angel charm (pictured).
They are an easy way to
make something look really
special, and worth spending
on as it’s not something you
could easily make yourself.
15
Think green
Save money and the environment by recycling
your old items to use as scrapbooking materials
Go green with your scrapbooking you can turn into scrapbooking as many supplies, but by turning trash
by re-using old items in your art. Cut up old magazines to make your
house instead of throwing own stickers, use old playing cards to into treasure, you’ll be helping the
them away when you’re finished create stencils or put together a mosaic environment by recycling items you may
with them. You’ll be surprised to see for your page using small scraps of have otherwise chucked in the bin.
how many things that you consider leftover paper. Not only will this save
junk can be transformed into beautiful you money as you won’t have to buy
embellishments. From using tea bags in
the kitchen to create paper that looks old You’ll be surprised to see how many things that you consider
(see page 70), to making an old button junk can be transformed into beautiful embellishments”
in your bedroom into an embellishment,
you’ll find something in every room that
GO NATURAL 16
It’s not only old items in the house that can be
re-used for scrapbooking; the best place to pick
up new materials is nature. Go outdoors and see what you
can find that could be used as an embellishment. Instead of
using your puncher to cut out shapes with card, why not try
cutting shapes out of leaves? And if the theme of your design
is autumn, you could stick autumn leaves directly on to the
page using Mod Podge to glue and seal them. We’ve looked
at silk and paper flowers, but you can also press real flowers
using wax paper to preserve them so they last. If you’ve been
on holiday at the beach, you could collect small seashells to
use as embellishments, or put sand into a plastic envelope as
part of a beach-themed layout.
17 Use pages from old Ceunetohsoalpdnsueeccct aeaipaslheylolooynndutiaofarlstrothshfneretoeyommsa.eres,
books you no longer
If you ever find that want to create vintage
you have run out of
paint, why not use nail black-and-white
polish to add colour flowers or hearts.
and texture?
16
Getting started
18 19 20
DON’T SCRIMP THINK BEFORE LESS IS MORE
YOU THROW
aYsuyrfsocrosoueUuriunuraeepnmgpbpcdbysbuayaooctyiycphtuorsleawceikndrpah,aghoonbetnohdnnooatue’poltbatdsyokbopebmwuwbesuiasynsoadilvstalnotgeehb’anegtramenitraltt,aedhlroybssaueotnnutianouaetcwnenynhmdfad,di-enyaba.aydckutpooeitd.ui-fr Wa theenndyeonucysttaortgsectreaxpcbioteodkianngd, there is
beeflbbaaomOonetrebreynudrte.cyhselReoleirinsedufyhgomoftmroahuewyrre’mvoonlaeewubtytsrcet.eausPprnrotaatinyogpostgeehutao,ritalnwrdnsaegcoadstrynahhassw’pmatetpasmthhayecilnrlfaaoeooknsrwrrit overdo
could be of use!
it with the use of embellishments,
but it’s best to keep the design of
your page simple. This way you won’t
waste money buying items you don’t
need and your layout will look cleaner
and more sophisticated. Less really is
more when it comes to arranging
your embellishments!
21 USE REAL-WORLD ITEMS ©Thinkstock
One of the best materials to use as embellishments on a
page and to save money is souvenirs. From maps of the places you’ve
visited, to postcards, entrance tickets and pages from your old passports,
souvenirs really enhance a travel theme. You can also use keepsakes
from day-to-day events and memories like theatre or cinema tickets from
your first date, to beer mats from epic parties. Because your scrapbook
is a form of storytelling, these mementos not only make the page pop,
but they add to the story and lend themselves to some unique ideas.
For instance, if you’ve taken a road trip, you
can sew your route on a map with a red
piece of thread to highlight where
you’ve been instead of writing out a
journal of your travels.
An old pair of jeans Mlbeatythiktnpeeefsiarmnteiieninmsagothdibunetoetgodlwflboyisthoorhhetuarmtnodrleweddynciorinniatnugsgpk’vs.e Ysouaueemcummchsaabibaznnoesignslmslgskiiselaivhmtdkcemehertateessagnotnlasltmifrs,cos,beioly.r
is the perfect item to
cut into pieces and
transform into a retro
denim album cover.
17
How to use photos
Photos are a vital element of a scrapbook. From taking the shot, to choosing
how to use and look after them, here’s everything you need to know
W hen creating a scrapbook, the photos often don’t want an overcrowded page. Try to have one focal
dictate a theme; for example, if you’ve decided point; choose the photo you want your eye to be drawn
on photos of you and your best friend, you to when you look at the page and emphasise that one. You
could choose a ‘two peas in a pod’ theme. That’s why may decide to enlarge a photo and use it alone on a single
it’s useful to decide on the photos first. How many you page to highlight it even more. The best tip, however, is to
need will depend on how many spreads you’re creating. work with the photos you have instead of trying to create
Three or four pictures are a good starting point as you something the pictures simply don’t lend themselves to.
22 Don’t start scrapbooking with old photos. DO THIS...Mscbtftaaoaehskrreteeh.innaYsmsnaootduamucylntrdeiocipfotephlyen,pion’aetcugdowpwgphpaoionaheenttosostttoootwofofcoryouuyofonstutehugyreo,rtphbusdheouroontosgtcaora’simosgnpeidbenxieeaphpsflriohspecrohsdeatsonooiyotgoaotn,wluss.aoiincnde,
Make your first layouts using recent ...BUT NOT THIS!yaootfwuofDyciohtwo,uiucnalsirkhn’topetbpnhoyehooangotuoiftanuorsplscyllaaoheygiiuovdlederuonsapwuctnlatrladiaykynpiewontbughatooacohotuaonksnsliuietzdhdn.eaeeYtsyicolbtoihyudeoreeamujycuhhanshoy.teawBoevwyendmaeldntoaoetaoncstbkyopiiedne.egcdt
photos that can be easily replaced if
something goes wrong. Once you feel confident,
you can then try using old black-and-white photos. If
you want to use the original photos to get a vintage
look, use photo corners to insert your pictures so
that you can remove them at any point.
18
23 HONE YOUR PHOTO SKILLS Getting started
To make scrapbooking easier, you should
perfect your photography skills first 24 TAKING
because the better the images, the better your layout. CARE OF
Ideally you want a good camera or camera phone,
but the main thing is to make sure you’ve always got a YOUR PHOTOS
camera with you wherever you go as it’s little moments
that make the best memories. Always try and shoot in Once you damage your photos, those
natural light to ensure the best quality and colour in are memories lost forever, so you want
your shots and where possible, try to fill the frame to to make sure you look after them. Both
avoid having to crop too much out of the final photo. negatives and printed photos should be
stored somewhere dark and dry. Fingerprints
are more noticeable on photos over time,
so don’t forget to wash your hands regularly
when handling your images to avoid the
build-up of oil, but make sure your hands are
dry afterwards as liquid will harm the photos.
To protect your photographs, make sure
all the materials you use for scrapbooking
are acid-free. Look after your photos by
keeping them organised and writing
the date on the back of them, but
don’t write in ballpoint pen. And
finally, keep your albums
upright instead of lying
them down.
25 ADDING PHOTOS
Choose your pictures Decide how many Mat your photos
Choose what pictures you want to use, Decide on the number of photos per Mat your photos by adding a paper frame
but also try think of your layout. Don’t spread and then lay them out on the behind them to enhance the pictures.
just pick smiling faces. Focus in on a page to see which ones you’ll need to If you’re using patterned paper, matting
newborn baby’s toes or your kids’ feet crop. A variety of sizes makes for a much your photos with a solid colour will help
kicking leaves in the autumn. more aesthetically pleasing page. make them pop on the page.
19
yosutMarnapdkheooutotsYouyor sucrrjaopbbiosotokbprhinogtotsheteslltoarsytotoryliafend M ake your photos the star of the show by
cropping them in varying shapes and
26 sizes, giving them a frame and using
embellishments that add to the story. Once you’ve
Crop picked your photos and theme you’ll want to enhance
out excess them. Decide which aspect of the photo you want
background like to focus on and put emphasis on this so it’s not
too much sky or competing with other elements on the page.
any objects that
you didn’t mean If you’re scrapbooking a page about your grandma,
to capture. your first thought might be to crop out her face as
the focal point, but if you crop out her hands knitting
a pattern, you can create a knitting theme. This way
you can still use photos of her, but the focus of the
story becomes how much she loves to knit and you
can add to this by making embellishments from wool.
Try to think from a different perspective and you can
create something truly special.
27 29
For more CREAM OF THE CROP
impact, focus
on one part of When cropping, basic shapes like oval, square and
an image by
cropping out rectangle work well. If you want to try new shapes, use
the rest. them to highlight a theme. For example, if your photos
20 are from a visit to the aquarium, try cropping one of
your photos in the shape of a fish and make this the
focal point. Another fun way to use cropping is to layer
28 your pictures. If you have photos of a boozy party, crop
Cropping out the image as usual, but on one side
tcoanenbheaunsceed
vaornyaintlhageytohpueatgsbeiyz. es cut around a bottle so you have
three straight sides and one While
with the bottle sticking out. cropping can
Have the bottle of wine help strengthen a
overlap another photo for layout, don’t cut old
extra dimension. photos. You’ll probably
want to use the originals
in your scrapbook but
keep them intact.
Getting started
30 aHopwhottoo cmreaatte
STEP 1: CHOOSE PAPER STEP 3: TRIM
First you need to decide whether to mat The easiest way to cut the paper border
your photos with patterned paper or a solid is to use a paper trimmer, but if you don’t
colour. This will depend on the colour of own one you can draw the border using a
your background paper and your photos. If ruler and pencil and then cut around the
you’re using patterned paper, choose one of photo and paper border with scissors or a
the colours and mat your photos with this craft knife and mat.
solid colour to make your photo stand out.
White matting can help lighten dark photos. STEP 4: DOUBLE UP STEP 5: ATTACH
STEP 2: ADD ADHESIVE Once you have finished matting When you are happy with your
your photos, see what they look matting, add some more adhesive
Once you’ve chosen your paper, add like on the page. You may decide to the paper matting at the back
adhesive to your photo. You can use any to add more impact to one of the of your photo and attach it to
type of adhesive, but a tape runner or photo images by double matting. Simply your page. Your matted photos
tabs are the most efficient. Then attach your repeat the process by sticking the should now stand out against the
photo to the paper and create a paper border matted photo to a second piece background paper. You’ve just
by leaving a ¼-inch to 1/8-inch of paper of paper and then cutting out a learnt a quick and easy way to
around the photo. To make life easier, place second border. create a focal point for your page!
the photo in the corner so you only have to
trim two sides. ©Getty; Thinkstock
21
Tell your story
Journalling gives meaning to your scrapbooking pages by adding
context and emotion to your photos
I n scrapbooking, journalling helps convey the Handwritten journals add a personal touch, but if you
story behind the photo. Adding words is a way of don’t like your handwriting you might decide to type
reminding yourself how you felt when the photo it up on the computer and use different fonts. Some
was taken. It can help set the mood and add depth to people write poems or quotes that set the mood; others
the page. You may choose to keep your journalling short attach love letters or holiday journals detailing their trips.
and simple by only writing a title or names and dates, Ideally, you want to stick to feelings instead of facts, but
or you could decide to write longer pieces. This is very writing an anecdote is often a good way of keeping a
personal as you’re telling your story so it is up to you. memory alive.
“Anecdotes are a good way of keeping a
memory alive”
DON’T WRITE ON YOUR PAGEAmsomtbhvoriaoasaacktpitdateketakgaewsepcrpoarhiaieynutnicotdnnhdeugdeertomhdpfsfueiatrbpolnpelearceliylepetlroiltessybtuhreieonrmrafn.ponoeAadrrtneolgtpwteeasotrrhnwnoeiteymaueitltphtliovbationnoegefgleyttprhh,euaaawelipssnterepeyoitraodiersga.ucndesIrntm.dieursYeaciwtogcetkeuhrtalidyttdeceom,noawcovnnarennekatl.oeoatlhstpaoeyeeomsu,r
22
Getting started
DO THE ACID TESTiddaaeoddwnaoedidswsintfilanalroterIwoeAdifhbgel?nresshryeead.wiTotcehpwsTseahhsouaaaasliienadtrpvmkfdhdyseodoeemootseywrrttynujootoouayroon’uturonswuuegtlharydueroseaoloyorsernatnsoeuwtjrcooy’haautrleoiotpudedygnsewnuprryoc-aebnfglsrrruresykoaaidcettedalopaeftireneseoaarbktdptgenppoyoejwoloedob.adtorwhnuoiueT.tkyjehsrroomh,nonpkueaatuyaetyilnnhrohn’llmlnpldloieyugwneahobtalgeomwha,oeud.asvwerhf’ahY.lsenletpthioeehehreysiureertainivnvjavcwo,seeeloomspusartmtarnaysoasnpntooeltaleadaesulyrrlcrittpongaiodhugno-ordtos, TURN TO LIGHT READING
31 GETTING IDEAS nIoof tryfloloiupo’vktheartgoosuotgnwhgryiltoyeruri’crshsobigloldohnclmliigknaheagtntayodzoisnnueeeresethdiffoeaymrobfeuoit?ncotasfnainnfisndpdiwrawrtiitooinrndg,swstthhyalyets
STEP 1 STEP 2 STEP 3
If you find it difficult to decide what it Decide whether you want your The most important thing is to keep
is you want to write on your page, go journalling to be handwritten or typed writing, both while you’re scrapbooking
through the five w’s: who, what, where, and how you want to attach it to the and while making memories. You’ll soon
when and why. Write them down to help page. You can experiment with different come to learn what you want to write
add context to your photos. fonts and styles by hand or online. about and how you want it written.
32 33 USE TECHNOLOGYItLffutartehfybiornretonrioW’edonstuyhntudsipo’ftredgrsaheuiihtehyrottenihnppyuscyoodoohothotumouurnfqrmege’troureyolahetupolotlo?tihachtssugaebIiichotnnrbyortncggboaohfueopooufatittuhbrytatfy’oylfeosyydorworyoooiceuu’boruuvkoni’etealirvrmnddefejpwtsgrote–,eaageuhyariroxwfdrtaorytnyptothuotmaaoaomyyulgcolrerriyneoneuthsofohugaisraorutedal.sbbdwgtsynoepe-edeuseymasatxotrrtstacueodhr.ne ©Getty; Thinkstock
in the photo.
COMING UP 23
WITH TITLES
When it comes to writing titles,
keep it simple. Some people prefer
to have a title on every spread, but it
is not always necessary. Using the
location of photos, like ‘Trip
to Paris’, is a tried and
tested method.
Lay out your page
Choosing a theme and deciding on a layout is how your
story takes shape, but where should you begin?
Because photos are at the heart of scrapbooking, Once you have a theme, it’s time for the layout. Decide
they will usually help you decide your theme. It where to place your photos and which ones to crop, how to
might be obvious, like a seaside theme for a beach arrange embellishments on the page and where journalling
holiday, or you could decide to pick out a theme will fit in. The idea is to enhance your photos, not detract
from elements in your photos. So, for example, from them, so choose paper and photo mats that look good
if your pictures are of your daughter playing and convey the right mood. This is important because you
dress-up in a princess costume, the page could want your layout to be eye-catching and to keep people
be princess-themed, using paper decorated with interested. After all, you’ve worked hard on your scrapbook
crowns or a big castle embellishment. so you want it to be noticed!
LEAVE SPACE PHOTOBOMB 34
The first basic rule of laying out a page, is When laying out your
to leave space for journalling! When laying photos, look at what the people
out photos and embellishments, it can be
easy to forget about adding words to give in your images are doing and
context to your images. Journalling is a where they’re looking. If their eyes
great way of filling in awkward spaces. Just are facing outwards, you won’t want
remember you don’t always need a title the picture sitting on the edge of the
and you can keep your writing as long or page as it’ll look like the person is
as short as you want it.
looking away from the page,
which will draw your eye
there too.
24
35 TOP LAYOUT TIPS Getting started
PRIME PLACEMENT 37
The key to a good layout is a clear focal point. Try THE MAGIC NUMBERS
to choose one photo that you want people’s eyes
to be drawn to straight away and place it slightly eyeslIamofuyyueycbosrhoeupuslaleatiswsegyhtameohmnurwteteroeyintdoh,tbisffueiftverhoedrrpreeraasaneegnwtvedgdnerlesonatesuyoibvogpeotnushnwtio.estsFfloetotybmoarputesemtttornooaamtncfsktseedi,nmeirftiseovoimagedrsendoof.lraonnDetwutoesemetucnrroribtkiroeianrntgse,.
off-centre. You can emphasise it even more by
enlarging it or double or triple-matting it. Another CHOOSE A THEME38 Your theme will heavily
trick to try is tilting your main photo a bit.
influence the design of the
STEADY FLOW page and so it can be useful to help you
plan your layout. You can use the theme
It is also important for your layout to have good as a guide to what to use on the page, so for
flow and balance. This means that when someone example, if you’ve taken photos over Christmas
looks at the page, their eye moves seamlessly from with your kids, you can use cheerful accents such as
one photo to the next because of the way the baubel embellishments made out of glitter or velvet lettering
visuals have been arranged. Lay out your photos to build your title. Take the Christmas theme and roll with it.
on the page and find out what works best through You might want to lay out your photos on a snowy hill by
trial and error. cutting out white paper and sprinkling some fine glitter or
white sand on it, or create a border using Santa’s belt. You
KEEP YOUR EYE ON THE SIZE can have lots of fun with it – just don’t go overboard.
Cropping is essential for creating a clean, balanced
layout. If there are too many photos to fit on the
page you can crop them in various sizes or you
can crop them to overlap. Photos can also be
cropped into shapes to add emphasis, for example
a heart-shaped photo, matted with red paper on
a light background, would stand out on a page
themed for Valentine’s Day.
36 ADD SOME BORDERScbibdnsLrpo(locaeolaauetrmraryywhdetndtee’eeisapncenrrrtlhirsbgeenot?taoasaogonayItfoeuhybiyfbsyolt,fTooefooolwauawhnruowrudlredhsrhswaeeolrhenaytloelrehrnpraescenrteapcaethafofomorpfeedolaeetvehtrferyctearlreoaaooaatdrsilordmvtauodsdatsrdehtrpdwieasisonerlfdoaaiagfyenrynoynrutotxogeoethtdbtaouhuxuriptsbnraethrbttyaueg.orpepooprrOsartmehrueeoddgynorrteueeoaoettt)cr.onohu.aoYtksdeUhncuyofmaesasdsutpreeehneelaaeceaatdyoastisooefnepf rautuytnimhstoonbe,euacopdythrrochdpecphaearhvprati.leoedr BE AN OPEN BOOK 39
dimension to the page.
Your layout should be attractive and emotive. By choosing
the right background paper, matting and colours for the
page, you can set the mood and bring your memories
to life. Colours evoke certain emotion: blue is often
associated with the sea and sky, but is also a calm colour,
whereas sunshine yellow represents happiness.
25
Page
design
Whether you’re following the
rules or breaking them, design a
layout that speaks to you
W hen it comes to deciding on a layout,
you don’t have to be a design expert.
While there are some basic design
principles that you can follow to help you along
the way, your design is how you communicate
your feelings and should therefore be personal
to you. With this in mind, you’ll want to start by
asking who your scrapbook is for and what its
purpose is. If you’re making a scrapbook for your
friend’s wedding and she hasn’t given you much
detail, you might want to keep the theme simple
and elegant. On the other hand if it’s your own
hen do album, then you can go wild with colours,
anecdotes and embellishments.
You’re telling your story so while we’ve got tips
on how you should design the page, don’t forget
it’s your scrapbook so you can break the rules.
“Your design is how you communicate your feelings
and should therefore be personal to you”
oCbmupartaocainkokppefgepasarrionluatpguonyhnoiaquoduusttoee. 40 BREAKING THE RULES
If you’re a bit of a rebel you may not
want to follow the tried and tested
design principles, and that’s okay! Scrapbooking is
all about experimenting so if it works for you, but
doesn’t exactly follow the rules, go for it!
Instead of choosing colours that match for a
page layout, try layering clashing prints and over-
the-top embellishments if you’re scrapbooking
photos from an event like a mad hatter’s tea party.
If you’ve been to Disneyland, your first thought
would be to choose bright, cheerful colours to
express the fun mood of the trip, but why not try a
black-and-white theme to bring out the magic?
A blurry photo from a concert doesn’t have to be
thrown away. Blow up part of it as a background
to underpin a ‘psychedelic’ theme and don’t align
your photos to jazz things up.
26
Getting started
41 Design principles
Create the perfect design with this quick and simple checklist
TITLE
TITLE
STEP 1 STEP 2 STEP 3
If you want to get it right from the There are a number of ways to create The rule of thirds is a design principle
start, make sure you’ve drawn out a a focal point. As well as increasing that can be used to compose a
sketch for your layout. This will help give you the size of your main image and placing balanced layout. Imagine your page divided
a guide before you start as to whether or not it off-centre, you can add colour and into nine equal parts by two equally spaced
what you’ve got planned will work, because embellishments to draw attention to it. vertical lines and two equally spaced
you’ll be able to see if your photos and Vertical photos work well as the main image; horizontal lines. Make sure your main photo
embellishments will look good once placed zooming in and separating it from a group of is placed in one of the four points where the
on your paper. smaller secondary photos adds impact too. lines meet in the centre of the square.
TITLE 42
STEP 4 STEP 5 USING LINES
Another design principle you can Make sure there is visual unity in your Alignment is a useful
use is the visual triangle. Imagine an layout. This means that the different method for organising
invisible triangle of any size anywhere on elements on the page look like they belong
your page. The theory is that three of the together, so choose your colours wisely and unifying the
same elements should be placed on the and make sure they work well together. elements on your
points of the triangle. Use embellishments, Match your embellishments to your papers page. It’s as simple as
texts or colour in a triangular shape on the and check that they blend in well with your finding a strong line
page to make a statement. photos. Group similar items together. and using it to make
the lines on your page
stronger. Then place
each different element
in line with another for a
balanced composition.
27
oTuthhtisneikdbienoxgof I f you’re running short of ideas, there are lots of
places you can go to find inspiration. Listen to music
Fbinitddiinffseprieranttiothnattosetrtys syoomureltahyionugtaalpitatlret lyrics, flip through magazines or take a trip down
memory lane to get your creative juices flowing. If you’ve
taken photos from an aeroplane that you don’t know how
to use, why not re-create the moment and crop your
photos into small windows which you can place on to an
aeroplane cutout? It would make the perfect image for
the first page in your holiday album.
Quotes often lead to great layout ideas. Take the saying
“shoot for the moon!” for example. If you’re making
a scrapbook for your daughter going off to college,
you could crop and overlap lots of small photos of her
growing up and attach them to the page in the shape of
a moon. Think about any element in the photos and the
feelings they evoke and go from there.
Keep the glue
stick at bay
until you’re
happy with
every element
on your page.
43 DESIGN YOUR OWN CLOUD BACKGROUND
STEP 1 STEP 2 STEP 3
You’ll need a sheet of white paper for Cut the sponge into a small round piece Wait a few minutes for the paint to dry
your background, some scrap paper, blue and dip it into the paint. Dab it slightly on and then move the cloud template down
paint and a sponge. Cut the top of the some scrap paper to remove the excess slightly and repeat the process. Do this
scrap paper into cloud shapes and place paint and then gently dab it over the until you reach the bottom of the paper
it about two centimetres away from the top of the clouds, creating a blue cloud and there you have it – a cloud
top of your white paper. outline on the paper. background ready to go.
28
44 LAYOUT IDEAS Getting started
If you aren’t great at visualising and need help with 45
your layout ideas, there are lots of scrapbooking
websites that offer free layouts for you to use. An HELPFUL HINTS
easy design to start with is devoting a single page
to one photo. This way you can try your hand at Dycoohuan’n’vtgegepluylaeoneunvreemdryitnthhdeinafgut ladl odlawetsenirgasnstalyagoyeou. ugtoin. Wcaasiteuynotuil
other skills like matting, journalling and embellishing Ltyoeotbuyeofrtuoormoderbisgeiigidnngaebcvoroeulavtteyivooeu.rgrInalasnytieocaaudltl,ya.sseYeothuwisdhwoeinrlel’tsttwhoeapnt
without too much to work with. page takes you.
tdhrWinrfesyaoYeknrsowtoirycLootgu.eieueinmneIrfassfgiagdtslreplysnaoioteatoeeri’nmnsrnhyvuo’eddtoaiienwfnrrnlwslsyacyieatoawoeiigtnetaboulaildtiyoonspsotetnguaokb.humgteWesitdntitatbtdthcrokthlrraeeeheeeatirtsghconhphiitngheeniohasintytppo,sekiocnpetpatevroondnagyyeetsmcdcropwtc.yeihletrTi.iyoeepttwsihYotaaslttohteutigihoimtitiusnrlcee.eygphp.adpotSralolheeyauigonno.agremoe’tuetlnsacy.ehclyoaoytaaoinumrvnuebetes
From there you could try one larger photo on
the right-hand side and three smaller photos placed 29
vertically to the left of your focus point which
support your main theme. After this you can move
on to cropping different shapes and moving your
photos around. Once you’ve got a bit of practice you
can start to experiment with your layouts and have
some fun. Follow the sketches below if you want to
try break the rules, but still have some guidelines to
follow so you don’t go wrong.
Focus on
a single
moment and
devote the
whole page
to it.
Forget about
white space!
Instead,
create a
photo grid
for impact.
If you have a
lot of photos,
overlaying
them can help
you get more
on the page.
Skmetcahpisng J ust like when building a house, before you begin working
The rolauytoeuttoisdienstighneinpglananbienagutiful on your layout it’s a good idea to create a sketch of
where you want your design to go. Your sketching map is
a like a blueprint; it’s a guide on where to place your photos and
embellishments, but unlike a blueprint it is not set in stone. You’re
free to change it whenever you like. The main purpose of drawing
a sketch is to see what the page will look like before you start
cropping photos and making accents. You might even sketch it
before making your shopping list so you buy the right materials.
46 STEP 2: EXAMINE PHOTOS
STEP 1: PAGE COUNT Take a look at the photos you’ve decided
to use. If there are too many you will
The first thing you’ll need to have to crop them. Choose how many
decide is whether your layout photos to use, what sizes you want them
will have one or two pages. If to be and if you want to mat them. Then
you’re starting out, a two-page draw out the photo boxes and place the
or double-spread design works size in the centre.
well, as matching the two
pages facing each other creates photo photo photo photo
continuity. Draw a line down 10 x 10 cm 12 x 6 cm 10 x 12 15 x 10 cm
the middle of your paper to start
your map off with two pages. photo
12 x 6 cm
30
photo photo photo
15 x 10 cm
7.5 x 10 7.5 x 7.5
cm cm
Getting started
STEP 3: ADD TITLES photo photo photo photo
10 x 10 cm 12 x 6 cm 10 x 12 15 x 10 cm
Your page will either have a title
or no title. If you want a big title photo
across the two pages, sketch this 12 x 6 cm
on to the page. You may want a
long strip with the title written on Main photo photo photo
it or separate shapes like circles Title 15 x 10 cm
for each letter. Experiment by 7.5 x 10 7.5 x 7.5
sketching it around the photos. cm cm
Your title may not be at the top,
but at the side.
STEP 4: EMBELLISH photo photo photo
10 x 10 cm 12 x 6 cm 10 x 12
Once you’re happy with how
you have sketched your photos photo photo
and title, you need to think 12 x 6 cm 15 x 10 cm
about your background and
embellishments. You may have Main photo photo photo
already thought of your theme Title 15 x 10 cm
and bought background paper. 7.5 x 10 7.5 x 7.5
In this case, sketch it on around cm cm
the photos and add in where
your embellishments will go.
photo photo photo photo
10 x 10 cm 12 x 6 cm 10 x 12 15 x 10 cm
photo
12 x 6 cm
Main photo photo photo
Title 15 x 10 cm
7.5 x 10 7.5 x 7.5
cm cm
STEP 5: ADD JOURNALLING
Finally, decide where on your sketch you want any
journalling. While you’ll sketch it out step by step, it helps
to think about all the elements to avoid too many redraws.
If you find that you are having to make lots of changes, it
might be worth arranging your photos on your paper first,
and then creating your sketch.
31
Stay organised
Learn how to avoid clutter and make the most
of your scrapbooking time
S crapbooking is fun and relaxing, but it’s not a you plan ahead, keep everything organised and practice
quick job. You’ll end up spending hours trying on improving your techniques to become quicker and
to perfect your pages and finish creating your more efficient, everything else will fall into place.
album. If you don’t keep your materials neatly stored
and you don’t organise your time well, it could begin Sketching before you start, creating material kits
to feel like a chore. You need to find the right balance and DIY storage are just some ideas that can help
between creating a routine when making your pages keep you on top of things. Follow our productivity tips
and enjoying yourself, while still being productive. If below to reap the rewards and become a bona fide
scrapbooking queen (or king)!
47 SIMPLE SOLUTIONS
Keep scrapbooking fun by being prepared; here are three easy ways to scrapbook with peace of mind
Using a page map or sketch might It is sometimes tempting to buy There are plenty of plastic storage boxes in
take you a little bit longer, but it will everything in the shop, but if you only craft shops that are easy to clean and stack.
save you time in the long run as you buy what you need, you won’t waste However, you can also use zipped bags to
can decide what will work and then time trying to choose what to use. store smaller items like beads and make
follow your plan. Make a list of what to buy and stick to it. your own storage out of cereal boxes.
Main Title
Photo Photo
Journalising
Wordstrips
32 Journalising
Wordstrips
date
Getting sSttaarrtteedd
48 Tidy desk, tidy mind
Organisation is not about perfection, it’s about efficiency
STEP 1: THINK AHEAD STEP 2: FILE YOUR PHOTOS STEP 3: USE PLASTIC SLIPS
You can start planning even before you’ve Make sure to keep your photos filed away If you’ve started an album and you’re
taken your photos. Try to think ahead so, for in order and with dates and the names of choosing your photos, try organising them
example, if it’s Halloween and you’ve got a people or subject on them. That way, when by page and keep them in a folder in plastic
young child, take a photo of your toddler it comes to looking at them, you won’t slips. If you’ve already got the paper and
next to a pumpkin for a ‘my little pumpkin’ spend hours trying to sort through a big pile embellishments, create a page kit and keep it
page theme. If you plan ahead you can and you’ll remember who the people in the all together so everything is in one place and
create fun themes. pictures are. You’ll have a reference so you ready for you to use.
can get started straight away.
STEP 4: GET THRIFTY STEP 5: DOCUMENT IDEAS 49
Organising your supplies is key to good As well as planning ahead, you’ll want to KEEP SHOEBOXES
productivity. Think of clever ways of storing keep in mind what you can do to stay
your equipment, for example, film canisters organised during the process. Collect ideas Have you just bought a pair of
are the perfect size for storing small items in a document online or if you’ve gained shoes and are about to throw away
like sequins. Make a label for what’s inside inspiration from magazine clippings, store the box? Stop! You can make your
using paper and a small piece of tape. Also them in a folder. Don’t forget to take your own shoebox ribbon organiser. Just
try to keep your materials grouped in themes journal with you everywhere you go so you make a hole at either end of the box
and by colour. don’t forget details!
and put a wooden stick through
it to hold the spools of
ribbon.
333
Scrapbooking techniques
Use a mixture of handmade and shop-bought items to
help you create a stunning page
T he art of scrapbooking can be as easy or Some techniques like paper tearing are
as difficult as you choose to make it. There inexpensive, while with others like die cutting
are lots of different techniques you can might save you time and help you create intricate
employ in order to make your pages stand out: patterns, but you will need to invest in the
basic ones such as matting photos, embellishing equipment. However, in scrapbooking there are
and paper craft, and more complicated ones like always tips and tricks to help create a beautiful
embossing and distressing. These techniques all product, with or without a budget. The next few
help towards enhancing your layout, as well as pages are filled with ideas for different techniques
adding personality and charm. for you to use to become a scrapbooking expert.
50 TRY QUILLING
PAPER IS VERSATILEPwicnaarpuyyeosmr.ucpTrraleyhnacpbnraeudpmsuetsrpoeelidngdiggivneebssaiottcoakmgadardiofndfueytnrdeedxinftfptueafrreeepe.nelrtor
Quilling involves cutting thin strips of
34 paper or card and rolling them tightly.
These pieces are then stuck on the
page to create different patterns.
PAPER SCENES
bbbIllfueuyeaeocwpuhaa-dtpvhoeeensrm’iotnenhtodayvoppeiauetprchepeeras,bgttureoyd. ctgereeatariftnoegr
If you don’t Getting started
have money to
spend on patterned 51 MAKE A HEART SHAPE
paper, you can
use stamps and Add a homemade feel to a love-themed scrapbook
ink to create a
background.
All you STEP 1 STEP 2 STEP 3
need is card,
Draw a heart shape on some Place the heart-shaped card Dip a pencil rubber in red paint
glue and card and then cut it out. If you cutout on your page. You and use this to dot around the
scissors to have a heart-shaped object to might want to secure it with heart outline. Make the border
cuyrepoauetreffpeahcpototfoopsr-. draw around this is ideal, but some sticky tack so it doesn’t at least 2-3 dots wide. Once
Get creative if not you should be able to move while you are working you lift the cutout, you’ll be left
with washi tape! draw it freehand. and then remove it afterwards. with a dotty heart outline.
The coloured
tape makes for
excellent borders
and striped
backgrounds.
Melt broken 52 USING CHEVRON
crayon in the
oven and then Chevron, an inverted V-shape pattern, is great for borders
swirl them around
on your page to
create a unique
colour effect.
Embossing STEP 1 STEP 2 STEP 3
involves pressing
a stamped image Chevrons can be used on Place two of the strips on your Continue this process until
borders or to add a pattern to page, starting from a corner, you have a zigzag line formed
into paper or a page. First, cut equal strips at a right angle to create a across your page. Then
card to create a of different patterned paper, v-shape. Attach the two strips create a secondary layer
three-dimensional probably about a centimetre with adhesive and then add with a different patterned
wide and all to the same another two strips joined at a paper. Three to five lines on
design. length. The length depends on right angle in order to create your chevron will help draw
where you are placing them. another peak. attention to your page.
If you know
how to sew, 35
why not use
your skills to
create a sewn
border around
your page?
Tecshhnoiqesutersinogn aevTehryertyehoeaumrecera,enbaudjutys-itfmdyoaoduite’ryeooopuntriosaenlbsf!ufodrget 56
53 RECYCLE MAGAZINESMftrmhcoabeakmaanedchekraboegeuoccrsoouyuecutlsl,aelnoefgdodfdermaemebslaexyapgmagacamareuztzpnitnoitlntiee.nfegatsshncolirysiauminlptegsaitm.tgaeAearrogcowueoranslalsdasgae TEA-AGE PAPER
STEP 1
Creating paper that looks old is a
brilliant technique for giving your page
a vintage look. Soak a tea bag in water
until the water is dark. The darker the
tea the better the effect.
CUT UP YOUR PHOTOS 54 STEP 2
ctadhwrInfeeehdyacypototeahunrgaeaoctenetpawunagthts’littuteeehaertfpnshftoaph.egraedpecph?eehomCboteuobtottsewultslehiptsreehiypnmmostsuehbernealpvtmcsehk,sotoottonos Use the tea bag to spread the tea
across your white paper until you
have covered it in the brown tea stain.
You can also use a paintbrush for this.
If you want the paper to be darker you
can use coffee.
55 STEP 3
USE WATERCOLOURSsmtcwhoIefeenantymtheeboorauofcdcoordkrwlsogoboinrutaomh’rtcukewpbngtaedahriannoipnuttuasgttnipfoauadetblssrhprsibetoserusmanautcdnleytts.om,in.uuePos’vxainnepiengegytnoastive Cover your paper with a weight so
that it doesn’t fold upwards. This
could be something like a phone
book. You can also dry your paper out
in the oven. Once dry, crumple it in
your hands to give it a vintage look.
36
Getting started
57
BUDGET DECORATION You don’t have to pay a lot for embellishments: we show
how a dress decoration can be achieved in different ways
THRIFTY EASY FANCY
bethmupwcaayubaabntrinSeyednwcillhmetotleioihlxaswlfpaihpfscndos.lemeeokeSrdontmcteos.sniiotcnnfSipiev,crkteleaslcekeoittkersrmfpereasoroaftsaerattwcfhnmraspkseoetnteatoaiaaytdgcwkrslkeoemesfeouecsldwlaonrrraosdasrisgtarpsitlehnrinbokeatogsdemonanrstwyolstpiiehnnsukitoteteieh.pmhuptsYeefneioodoamrcd-lfeurcteseussaaa.cpirnsgyseaeoyndlnnbiutsedtle fepcooxdiacPrmpouentgraeustfeolsinigrmgigttnretsiilenleradiillyvusrsmtfeo.bmhi’onTunoertrdehhrilusgooeaetsrshiw-tncceythdt’orktresiaswoemetrpauarfhaosbedntpi.cnroecgdaThssaoaragihienorgkewcdaenn,owbtyosssauewiu,utaltpihaclcrtdadleonkehyeeedsacrytoaureooessslfiait,or-tapltatcblamhldyoteaueedtutsehtdmctnsaeyahaewdoomnribtnseruiditeegth A die-cutting machine may be an
or dollars each. oiunistvnes’ttsutitmnwneionnrgtt,hpbauitt?ttewYrohnuesnclikayenotuph’urisercdahrbealsessetbocelcilnougwt ,
tsttththhecaeneeamsnscmepoobacsfesctledihnuotosigsfnlelftaesodhrtrseataomaosdlclripaerspe-ossocaterauutttesmstntoidcapnfasgdo,ndiaermebn-asecaditgtcubacnhtco.usinhB,utteewegindshhigtitdsitcoefedohlsifer,
sets may be sold separately.
MAKE YOUR OWN DRESS EMBELLISHMENT
STEP 1 STEP 2 STEP 3 ©Getty; Thinkstock
To create this paper dress you will need Fold the skirt round and attach the two Glue the waistband around the middle
card or paper, a bone folder, scissors ends at the back with adhesive. Do the of the dress and glue on the folded
and adhesive. Draw and cut out shapes same with the bodice, folding it round bow. You can then add any other
for a skirt and bodice, as well as a and adding adhesive to glue it to the embellishments you want on to the
waistband and bow. Fold the paper over skirt. You’re almost there! Just flatten dress, for example, a heart for on top of
in a fan shape using a bone folder to the skirt so it doesn’t stick up too much your bow. Your dress is now ready for
create a pleated effect around the skirt. and make sure you’re happy with it. your page!
37
The art of
embellishment
There are no mistakes in crafting, just opportunities to embellish
E mbellishments are the finishing could add little North Pole embellishments Cpoeeclrfyaimorntocdmahrebeunrmepraaeresrthwtelorpsltaosih.asyrastToheeogottihtmfeucscaeiprkosnoeoghprntyrcnonoiaootaaoestgtnutnhodre–rteshtohaoeapfenlnaypddogteuo.r
touches that you add to your page for a bit of theming and context, and to
to decorate it; they’re the bells and make it a bit more festive. If your child is
whistles that ensure it shines. Not only do in a nativity, you could make paper angel
they make your pages pretty, but they help embellishments and decorate the page with
support the theme and add meaning to gold ribbon or sequins. Embellishing a page
your layout. So, for example, if you’ve got a is the best part of scrapbooking and the
Christmas theme with photos of your child possibilities are endless! The hardest part is
visiting Santa and you’ve gone simple with deciding which embellishments you want
a red background and white matting, you to use and where to place them.
58 59 DON’T BE TOO PRECISE
TRY USING CLUSTERS Page design often includes a lot of rules about straight
lines and alignment, but scattering your embellishments
cpyctapihonoavodAayeigludrsgeocneguslelumcleuoaaottrorthsmolosaw.otlrfyodeAflefeoolofrudohelrswrcorurdoamsgootwlvkh,estrlrewooteoeaariisrnuuayntooyrpaseofagstimlntsnhat,oruicdocvesiolwrsekiohurspreiaeteinpcbhleyisrafgsl,teleoluieeynaoofysoimssttofntbtareuhaiedtuemiarrhgehnsrrdner,ase.ateegelwr.aIvefemeclKneecmnpo.yed.bloFealueaeToeoaauscpnbhultrtlrttilewirocsustae.irhhlngsaexscuemsnarstitbsenmtohtteeiheartenopdoterthsetnl,esese, can help break your page up and add a bit of fun. Try
sprinkling buttons, beads, brads or sequins for a touch
of colour and a decorative burst. Don’t think too
much about where the embellishments are going.
Just sprinkle a handful and then stick them
down. A night-time theme with a trail of gold
stars, or a white background with confetti
dotted around the layout can give a page a
completely different feel. This technique can
also help soften a page with a harsh, linear
structure and if you’ve got extra space, it
can help fill a gap.
38
STRUCTURE Getting started
Place embellishments in a 60
sequence or stack them for a
structured look. Try golf ball stickers THE A-PEEL OF STICKERS
in a line bordering golf photos, or a
stack of book stickers on the corner Stickers come in all shapes and sizes and for every
of a photo of your bookworm friend. theme. You can get footballs and cricket bats for
Rosettes work well in a series for a a sports theme, lions and elephants for an animal
show-jumping competition, or theme and everything in between. You can buy
gloss or matte and some even have foam padding
bunting for a party. for extra dimension. Everybody loves stickers. They
are a fun and easy way to decorate your page.
There’s no mess or difficulty – just peel and stick.
But it can be easy to get carried away, so don’t
overdo it. Place your stickers on the page before
sticking them down and follow the same rules
as other embellishments: stickers work well in
clusters, to enhance a photo or to act as borders.
62 ADD SOME HANDY POCKETS 61
You can create pockets and envelopes to decorate your scrapbook ADD SOME TEXTURE
page, but they also come in handy for storing mementos such as cinema
tickets, maps and letters. Keep your memories hidden inside or have them diaAttitycnofdrbtdofhidhrdeopainuuamrilrcfneentepckcge-nkelgaamhtnyt.xtnpreesotmTabervixautohaerrtatl.onenisuatenAoenyd.drdgedrLssagtpidaaartlcaeayloyillnsans.paesongdYydewraooirdnnhaschsuutldgeheasrtrlipocahnpppdparaasshmhiaepntf.oogfemeYaesdtelfro,rproboeectoucseotnatartolacrehtlnsicdnasxaitosr,hentdhdufuwxibtednmaartyrlaeugldpilspsbadru,dohelgyb,fseirineibiobadovntrguunenamsgotpy.dre
sticking out to add to the theme of the page. Make your pockets and
envelopes out of patterned paper and adorn them with ribbon and floral
motifs. It’s easy to do – all you need is paper or card, scissors and glue.
When you turn the page, you’ll be able to have a sneaky peek inside your
pocket or envelope for a surprise message from the past.
EMBELLISHING TIPS TO REMEMBER
63 64 65 66
DIE-CUTS CORNERS TAGS PUNCHES
Die-cuts are the easiest Use photo corners to Tags don’t just have to be You can easily create a pretty
way of creating intricate decorate your page. You can used for journalling. They can dotty background with a
patterns on a variety get them in different colours be decorated to match the circular punch or achieve a
of materials. and patterns and they put theme and to embellish the Valentine’s theme with a heart-
emphasis on photos. page overall. shaped punch.
39
Bells and
whistles
Learn how you can accessorise your
page with unique embellishments
W hile craft shops are full of delicate die-cuts and fancy
stickers and papers, embellishments don’t have to be
pricey. You can make lots of different decorations for
your page using items found when you’re out and about or even
from your home. For example, don’t throw out food packaging!
Rings from soda cans make great buckles and the plastic tie at
the top of the bread bag can be decorated and used to clip on to
the end of something. From your bathroom, toilet paper rolls can
be turned into decorative pockets and if there’s a toolbox in your
house, old keys, washers and small chains can all be transformed
into incredible embellishments. In your bedroom you’re bound to
find ribbons, buttons and broken jewellery that can be used, and
you can add dimension to your photos by matting them onto
old CDs that you no longer want. You may not know it, but your
house is like one big craft shop.
SCRAPS 67 69
pelDperaofftepnoce’vttretfarhossrroctmhwraeapyaks’wirneoagfy ROLL CHARMSmYvoetahuterwaaimecltittcamhybnhoeoaablukrflimuetsthyhtushmefnelfmaoieqtbrneuuasteslk. RAID YOUR SEWING KIT 71
small paper
footaYrhfnoasidndhunifadtpfcupeaatbreetneetsxen,srtroutbntrcloolseorp.uidlnaosetpeuoresrsr 70 Ribbons, buttons and beads make for
embellishments. great embellishments. Beads and buttons
come in lots of different shapes and
68 colours, but be careful not to use anything
too chunky. You don’t want to overload
BRADS(tDtittoehoifseft)eahmctreteaoaanpncrltaohsbbghnerreaeiabupdoabsesrsoesudnd. soets your scrapbook album so that the pages
are bulky and it doesn’t close! Tiny beads
and flat buttons work best. Group the
buttons in clusters around the page to
create visual flow, or line them up to
frame photos or create borders. They can
also be used to make embellishments.
Try sticking buttons to the centre of
a paper daisy or use beads for a more
detailed flower with a stamen. Group
buttons together in colours and stick them
down to create shapes such as a cupcake
made out of pink, blue and red buttons.
Ribbons can be used to create a border
for the page or to frame a photo. You can
also use them to add stripes and create a
pattern for a background or tie them into
bows to use as embellishments.
40
Getting started
72 73 74
Emboss foil or
cylouuBdeIsuteetmet’csedpeobroticveerynaekmlo’ltrytiuisypowhwrtnkmiapini,tnnahgbedtgunytetoottoo.sfu. r Atopliiosncnkapreortytechniwoecoefusieena,rltdclotfsdieeeoctsivrknortteaosigvnr,pusaetbb,tsluseofsooerk.
paper to give
embellishments an
added dimension.
Either use a
dedicated embossing
machine or a hand
stamp punch.
75 EMBRACE A NATURAL STYLE DO IT YOURSELF
Where better to find inspiration for your embellishments When you don’t want to 76
than from nature? Press leaves or flowers for an autumn or spring spend more money on
theme, or attach grasses or ears of corn for a countryside feel. ready-made decorations,
You can even create wooden embellishments, like a frame, from here are three quick and easy
small pieces of bark or wood chippings. Just make sure anything embellishments to brighten
you pick up is as clean as you can get it and free from as much up a page
moisture as possible.
CUT A BOOK FLOWER
To press leaves or flowers, flatten and dry them out between
two heavy books and then iron them between two sheets of wax Create paper flowers using newspaper or old book
paper. Finally add Mod Podge to both sides to seal and preserve
the embellishment before sticking it to your page. pages, card and buttons. Simply stick the newspaper
Create a dreamcatcher using feathers or scatter them around to the card, draw your flower and cut it out. Then
the page to put focus on a photo of someone with a free-
spirit. If you’ve been on a summer holiday, why not add sand attach a button to the centre. Slits can be made
to your layout for a beach theme? While shells make pretty
embellishments, they are difficult to stick on but you can always between the petals and the card lifted to add more
create a transparent pocket to keep them visible on your page.
dimension to the flower.
Everywhere you go try to collect anything that might work as an
embellishment. It will not only enhance the page, but it’s also an 77 MAKE YOUR OWN STICKERS
additional memory.
Why not design and make your own
stickers? All you need to do is buy a sheet of A4
sticker paper, find an image online or design your
own in Photoshop and then print it off, cut it out
and stick it on to your page.
ADD SPARKLE TO A STAR 78
Help your embellishments twinkle by
cutting a star shape out of card and
sticking on silver sequins to fully cover the card. If
you want a flashy page these embellishments can
be made in any shape or colour.
“Press leaves or flowers for an autumn or spring theme,
or attach grasses or ears of corn for a countryside feel”
41
Ema bpealgliesh E mbellishments come in all shapes and sizes, and whether
Screampbboeolliksehrtshdinogns’tinliest–eatdh!ey you buy them or make them, there is something for every
theme and mood. But just like your layout, you don’t have to
stick to the rules. Yes, you can create beautiful embellishments and
place them on your page in groups of three, but you can also try
something different. After all, creativity comes from experimenting and
having fun. Instead of using your embellishments to emphasise your
photo, why not use the photo itself by blowing it up as a background
or creating background paper with lots of Polaroids? Instead of
sticking embellishments like bows and buttons on the page, create
borders and frames with them, or even photo corners. And if you’ve
got sequins, glitter or confetti, don’t just use it on the page. Invent
something new with it like a shaker card bauble for a Christmas theme.
Follow our tips below to get started.
79
NOT ALL FABRICS
ARE ACID-FREE!
People tend to assume that fabrics
are acid-free, but they’re not and using
them in embellishments could ruin your
scrapbook in the long-term. Just remember
if you are using materials that are not acid-
free to make sure they don’t come into
contact with your photos. If you are
using acid-free fabric like silk, then
ensure there is a layer of paper or
sealant between them.
80 MAKE A SEQUIN BAUBLE
STEP 1 STEP 2 STEP 3
Start off making your Christmas bauble- Using tape runner adhesive or glue Add a foam pad to the back of the
shaped shaker card embellishment by dots, attach sequins to the bottom half cut-out rectangle to give it height.
cutting out two rectangles from a piece of the first rectangle with a wave effect. Finally stick the two rectangles together.
of white card. You can use a different Using a craft knife and mat, cut out a Decorate your card by adding a gold
colour of card, but white will help the large circle from the second rectangle. top and string to the bauble and glitter
sequins stand out. Use a glass to get a perfect circle. around the card.
42
Getting started ©Thinkstock
81 How to make a bow
All you need for the classic bow is some ribbon,
glue dots and needle and thread
STEP 1: CUT AND FOLD THE RIBBONmrfiiswbCnaidbkiauseoenhtsnteuaw.ydpsYoittotyurhhioupriasubn,orgoorfbelwwuropiebewthboada.otovbntteeh. .teTtwhDhpeioecronutewcbpteolherseemsistlsefaooniivntrgeflaterahlsatee.onmcOfdoetnhannctedttesasscytithzohreiaupttyhhowoeafuilvtlwe o
STEP 2: LAYER RIBBON
Place one folded strip of ribbon over the other in the shape of a
shallow x and attach the two pieces like this. Then, using a third
strip of ribbon, repeat step one so that you end up with two
strips attached forming an x and an extra strip folded over.
STEP 3: SEW TO FASTEN
oolsaTevefsnhewtgtrhrhe-tetshaehedwbebwoaaotwyhswnsoi.re.dBoeiSterdesitsawlcreinacpaurooerostlofionnutuuotglnorowdtththhvhtrieahseetnieabxcdluceosest.omhinnattpghrtle’asethtmttoehiteetnsniigesttsahsemtdoietln.eenTtcathohnoepedlnoomduforiidtnd’tle
STEP 4: CUT BACK THE RIBBON
Turn the bow over. Cut out two more pieces of ribbon,
this time half the size. Cut a triangle out of each end of
one piece and attach it lengthways to the back of the bow.
Then fold the final piece around the centre and attach it
with a glue dot.
STEP 5: USE THE FINAL PRODUCT
Turn your bow over and there you have it – your finished
product. Stick it on to enhance your layout, create
more bows and group them together or stick them on
the page in a shape such as a heart. This is a simple
but pretty embellishment that you can make using any
leftover ribbon you have hanging around.
43
85 JUDGING A BOOK
BY ITS COVER
There are scrapbook albums to suit
every taste; you can even buy a plain
book and decorate it yourself
Choosing an This 12”x12” Large Flower Print
album cover Scrapbook from Hobbycraft comes in
Once your pages have been created, you’ll want to green and red and has ten blank sheets
house your art in an equally attractive album in protective plastic coverings. This
makes it great if you have lots of photos
T here are lots of things to consider because you’ll have less photos. Smaller and embellishments.
when buying an album, from albums make great gifts but probably only
style to size and what you need fit one photo per page. If you want something a bit more
it for. A 12”x12” album is probably the personal, the Pioneer 12x12 Sewn
most popular choice as it is the biggest You also need to choose what kind of Scrapbook Box available at Staples is
and can be found in most craft stores. It binding you want. If your scrapbook is in ideal as you can insert one of your
is useful if you’ve got a lot of photos and double-page spreads, pick a post-bound photos into the front. It has a three-ring
embellishments. An 8.5”x11” album is for album so your pages are close together. binding and comes in different colours.
scrapbooks with one or two photos on A three-ringed album is good for bulky
a page. If you want to create an album embellishments and will give you more Turn a scrapbook into a gift by making
all about your pet, this size works well flexibility to switch pages and a strap- the cover yourself. Sara’s Surfaces 6”x6”
hinge means your pages stay flatter. Album from Paper Wishes is great. The
post-bound album can be personalised
HOW TO CHOOSE YOUR BOOK to match the theme of the book.
82 83 84
Decide what the theme onwlaiohymnefwf1dairp2tLeegyhe”oolaoexlmoosn1uiptfk2ebaoehy”neasgoraa,ltol8vuplijtbsooe”ahhhxuudget8mamro-e”vnms.eeumaiwznalslletatooeiensdy.rt,rgksAiasls Aedwcilpnabihbfaawsfuoinpeginlmooyotredercstssegksoneltoriopctn,barsrobgbefoeeomsuipaurnotrtldyntedanaolisdcefiwngd3et.yagheoi-Iotlpfsetrubhuh,iaynbupseogaglmoareeure.ge-ssdessit
and purpose of your
album is. A 12”x12”
album works well for
general family albums,
whereas a smaller
album is better for a
more specific theme like
a graduation or as a gift.
44
DIY cover Getting started
86 Learn how to make your own decoupage
album cover with these five steps
STEP 1: PREPARE YOUR MATERIALSsYiudnyoYiiotfuoyafu’oeubllrulcenedraneognvteneludpb’rteyhuph.oyohatwavooentsno,tossofra,tdybbfalierunbi.cyarSsriacytaafaanranltdbndbucpyympapapsrpcaeenerrpasrdp,atsrdboicneoicgcsorsokeyoraoaartsulteb,eruasminmot dwmactiseetoohrtvihmaeilnsre;.g
STEP 2: CUT THE SHAPES
Cut the paper, photos and fabric you want to use into the
right sizes and shapes. Empty your album, taking out any
page protectors or pages and open it up. Lay it out with the
pages facing down, so you can work on the back and front.
Then arrange your photos and shapes in the order you
want them on the cover.
STEP 3: ASSEMBLE THE PHOTOSyaYytUohoogsueuueirn’nclwplgeowharavoonaeptutnroasttahsintnleaodtdymbomesrw.urtaiDsncokhok.fe,aotssdhpnuhirrspeeeuhasynidovotteiguol lttsuwoheaeoenorafdkunclsihlnthhaaaselrbepefuceiartmssibotinenissfsetochcaroetenivodogenrlraudeopiednfpr.gly
STEP 4: APPLY EXTRA COAT
Once your photos and shapes are stuck on to the cover,
apply another coat of glue. Once this layer is dry, apply
another one to three layers. This will not only seal and
preserve the images, but it will add a glossy finish to your
personalised cover.
STEP 5: LET IT DRY can turn your
it’s now ready!
Once your final layers of glue are dry you ©Shutterstock; Thinkstock
album over and fill it with your designs as
Don’t forget to store your album upright because this
will help to maintain the quality of the pages. Plus you’ll
want it to be upright on a bookshelf so that everyone
can see your hard work!
45
Using writing
From stickers to handwritten writing,
your letters should make a statement
Whether you are adding a title or
writing out a poem, the letters on
a page not only enhance it with
colour and texture, they add meaning to
your layout. It doesn’t matter if you are writing
by hand or creating embellishments for your
words or letters, there are lots of ways to
create journalling that will engage the reader.
Don’t forget the basic rules, though. You’ll
want to use acid-free paper and pens so that
your words last. It is preferable not to write or
paint straight on to the page, but
if you have to, write in pencil first
and then erase this once you’ve
gone over it in pen or paint. It is
easier to write on to paper or card
first and attach this to the page
either directly or by adding it into a
pocket or envelope. Just like with
your layouts and embellishments,
however, it’s all about experimenting
and having fun.
87 FAKE IT Follow these simple tips for calligraphy without a calligraphy pen
STEP 1 STEP 2 STEP 3
Calligraphy is all about pressure: less Where a line has been created in a The final step is filling in the parts of your
for upward thin lines and more for downward movement, add a line beside letter that have a line drawn next to them.
downward thick lines. To fake it, write out the letter to make it appear thicker. Do Once you have done this you will have
your word in normal cursive. this for all the letters in your word. achieved the calligraphy look.
46
88 Getting started
Try to match PRESENT YOUR TEXT 89
one of the colours
in your photos to the If you want to make your own journalling
lettering to emphasise embellishments, the key is using different materials.
the chosen theme You can draw and cut out your own letters using
paper, card, fabric or even items found around the
or mood. house, like foil. If you like to sew, why not sew your
letters on to a piece of card and attach this, or use
buttons to create the shapes of your letters? If you’re
more artistic, you could try your hand at calligraphy
or use watercolour paints for your titles.
Different materials can be used to help your letters
match the theme and mood. For example, you can
create old-looking paper using tea bags or coffee
for a vintage page with old photographs of your
grandparents; create glitter letters for a disco theme;
or add a tiger print if you’ve been on a trip to the zoo.
Try these three techniques to get you started.
Use washi
tape in all
different
colours
for your
journalling.
90 Make your
own folded
USE ONLINE FONTSsMimtnOeamoqsaemrdsjiurfsoeYazttaoiyeIiifoapIfoxetuecoffncwleptesysukrrluyethi,nxorlchsoaoosoecapacuoen.rourtnnanleaoevTlldcnnwtdiennwenthhoskorsarbtgweebaahinyihnnpvum,rncnuaoieleetbttfyiatgpyhnotrbtoierliaesesnoeerdtoldadoetresmteefserase,tommardsaxtnanofrenfmeinarnvncsedml,odfrmedeeigtoasiilmnhitnstctnnttepltttciceierhwtnoetmvletbloltseraugeuhothsa,suetedndmef,lttisftsocriheiwaectac.nsgshaoranrnkhyhgedkoavnacedoyoiemipefsclierolueepbyesthcsawurtrhc,sototu,tlt.ysueoroieucoesttehYotrhtwntaraksaoiihiiunnnecnl,ondluaplegk.gyeacryuvhetlEltcaeestopwpstabrmeanteteshoubiemtinrcrtebatsedecteshkoorbfemtyoenoieia,innenlocmlelnrnt,elitgdesouuosidomtet.yahrrsahthrwantehmonibterentaodmooadewermsetaurlwwsbninlysdaolispltsoettrosainolseshsicleutnrltashneiekcdterhsd.ntadsdeohneeosdep,r,mmcrasuleotfsffirhrtl.usetetfooestylnfaoml.rrotneesudeirtso pbaapnenretrooguitvoef
your words
emphasis.
Make
embellishments
by cutting out
shapes for your
scrapbook
lettering.
47
Say it with quotes
Use a quote to get your message across
W hile journalling can help add context and meaning to your
photos, if you’re not particularly good with words, you may
find it hard. Often scrapbookers enjoy the creativity of laying
out their photos and embellishments, but get writer’s block when it
comes to adding text. They say a picture speaks a thousand words, but
the right text can add depth and emotion so if you’re lost for words,
quotes are the perfect way to use someone else’s to help tell the story
behind a photo.
Quotes can be witty, nuggets of wisdom, or inspirational. Whether
they are from something a famous person has said, lyrics to a song,
words from a poem or direct from the mouth of someone you know,
they can influence the theme and style of the page. Just as with other
types of journalling, keep a notebook and whenever you hear a funny
anecdote or inspirational quote, write it down.
dpaaamluoregUennhagstntisnepiindgrlageotyhntaionisapgtqhshwuwoeotiitointhmegotahafgdeaeidr. s 91
“They say a picture speaks a thousand
words, but the right word can add
depth and emotion”
USING QUOTES 92
Quotes can enhance your page in a number of 93
different ways. Depending on how you embellish
the letters, the colours you use to create your eQleumoetenst ctoanyoaudrdlaayfouunts
quote can act as a unifying colour for the page,
improving the overall feel and design. If you want Inspirational quotes add depth
to make a statement, you can use a quote across to a photo
the page as a big, bold title or enlarge the first
letter of the first word to make it a focal point. 94 peqlfoorunforoeickSacteioenntlmygscepadempanteacipmsgbetiegyeef-nistlehleader
If you would prefer your quote to fade into the
background, for example a subtle inspirational
quote, write it on to vellum using light pen and
adhere it to the page.
Quotes can be stamped on repetitively to
create background paper accentuating the
theme. And if you have a specific theme for an
entire scrapbook, you could use the quote as a
title on the album cover.
48
Getting Started
95 PLACING YOUR QUOTE you Gdkoononod’twfartliwehneadyyssaarsereeealltwikheaeymsst,atrbhsue…treyou thShauepcpckeiensyesstsios; snhuoacptcpetsinhseesskeiys to
Once you’ve thought about what quotes A baby is
you want on your page, you’ll need to cuddles and
decide how to use them in your layout. tickles on toes,
Begin by asking yourself where you want the sweet scent
to place your quote. Is it the page title, a of powder, a
central focus beside your main photo, is it
the background or are you writing it on an kiss on
embellishment like a tag? the nose!
How do you want to present your quote?
Are you going to buy stickers with quotes
already written on them, will you use
alphabet stamping or are you going to make
quote embellishments? You could punch
out paper in shapes like circles and hearts to
write your letters on or use stencils to create
your own lettering.
Similar to other embellishments, you don’t
want to overdo it. You may get carried away
looking at inspirational quotes but it’s best to
stick to just one quote on a page.
96 SCRAPBOOKING
AS THERAPY
After a long day, sitting down to make your IIf’dfripeincdksywouere flowers,
pages is not only fun, but it allows you to
express yourself creatively and can be quite fDoroegvserleoanveyopuarwheparritnts
therapeutic. Use quotes to help de-stress or
motivate you. bEuvteryoulrosveisstmoryy fiasvobueraiutetiful ©Thinkstock
If you lead a hectic life, sorting through 97
your photos and organising your pages can
help you make sense of your life. If you’re
angry or stressed you can re-direct that
energy to produce something beautiful. And
if you can’t quite shake the issues bothering
you, take them and use them on your
pages to work through your thoughts and
emotions. For example, if you’re struggling
with your diet, take your frustration out
on the page by creating a scrapbook of
photos showing your weight loss progress
and using a quote that will inspire you to
keep going like “when you feel like quitting,
remember why you started”. Looking
through your photos and thinking of quotes
to use with them will not only remind you
of happy memories, but it will give you a
sense of achievement.
Bitrtelhldinagysusarteoneaatturme’sorwe acyakeof 49
Scrap with the family
Scrapbooking doesn’t have to be a solo activity;
enjoy it with your friends and loved ones
T he best thing about
scrapbooking is that anyone
can do it. Although it is
something you can do alone, it’s
just as much fun scrapbooking with
others, whether it is with friends at a
scrapbook party or with your kids.
Children love doing anything
creative and scrapbooking will
keep them nice and busy as it’s
not only fun for them, but it takes
time to complete. It is also a great
way of spending time together
and bonding as a family, not only
because it is a shared activity, but
because your kids are helping you
create even more memories.
What better way to create a
scrapbook documenting photos of
your child than to get them to add
their own drawings and artwork as
embellishment to the page? Ask
them to paint a background or if
they’re a bit older, they could write
a poem about the occasion.
98 POPSICLE STICK ANIMALS
STEP 1 STEP 2 STEP 3
To make your popsicle stick animals, Paint your popsicle stick the colour Time for the final details. Add on your
you’re going to need popsicle sticks, you want your animal to be, so for sticker eyes or draw the eyes freehand
different colour paints and pens, card example, yellow for a lion. For animals with a marker. Glue on ears or manes
or felt and buttons. If you can get your that have patterns, such as a cow or a made from felt or card and use a
hands on googley eye stickers for the tiger, paint the main colour and then button for noses on animals like the
eyes, this is even better! add on the markings with a black pen. pig and cow.
50
The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
GET CREATING PAPERCRAFT & SCRAPBOOKING 2nd Ed
Discover the best professional documents and content resources in AnyFlip Document Base.
Search