THE
DREAM BIG
set goals
take action!
WINTER 2109
SPRING
infogenrermal ation
MISSION STATEMENT CITY HOLIDAYS
The City of Kennesaw Parks & Recreation Department is committed Our administrative office, including the Ben Robertson Community
to providing public parks, facilities and recreation experiences that Center, will be closed in observance of the following holidays:
enrich the quality of life for area residents and visitors through Monday & Tuesday, December 24-25 | Christmas
dedicated staff, sound management and community involvement. Tuesday, January 1 | New Year’s Day
Monday, January 21 | Martin Luther King, Jr. Day
CITY STAFF Friday, April 19 | Good Friday
City Manager.........................................Jeff Drobney
PROFESSIONAL MEMBERSHIP
[email protected] The City of Kennesaw Parks & Recreation Department is a member of
Parks & Recreation Director................Doug Taylor, CPRP the Georgia Recreation and Park Association (GRPA) and the National
Recreation and Park Association (NRPA).
[email protected]
Assistant Director.................................Billy Warren CUSTOMER SATISFACTION
As a valued customer, you are our highest priority. Our goal is to be the
[email protected] premier provider for all your recreation and leisure services needs. If you
Recreation Manager.............................Amanda Glass experience something at one of our parks or facilities, special events or
recreation programs that doesn’t meet your expectations, please notify
[email protected] us promptly and we will do our best to assist you.
Parks Supervisor...................................Rolando Pardo
INTERESTED IN TEACHING?
[email protected] The City of Kennesaw is committed to providing quality programs for
Special Events Coordinator.................Brittani Farmer all ages, abilities and interests. Programs offered strive to foster new
skills, promote health and well-being and expand cultural and artistic
[email protected] development. In order to provide these programs, the Kennesaw Parks &
Office Assistant....................................Missy Sebree Recreation Department seeks contracted instructors to share their special
talents, skills or knowledge with others in a class, camp or workshop
[email protected] format. For more information on how to submit a proposal, e-mail
Office Assistant....................................Trici Styles Amanda Glass at [email protected].
[email protected] LOCAL INTEREST
Kennesaw Business Association | www.kennesawbusiness.org
MAYOR AND CITY COUNCIL Kennesaw City Hall | www.kennesaw-ga.gov | (770) 424-8274
Mayor.....................................................Derek Easterling Kennesaw Police | www.kennesaw-ga.gov/police | (770) 422-2505
Council Post 1........................................Jim Eaton Smith-Gilbert Gardens | www.smithgilbertgardens.com | (770) 919-0248
Council Post 2........................................Tracey Viars Southern Museum | www.southernmuseum.org | (770) 427-2117
Council Post 3........................................Pat Ferris Swift-Cantrell Park Foundation | www.swiftcantrellpark.org
Council Post 4.......................................Chris Henderson
Council Post 5........................................David Blinkhorn LEAGUE SPORTS
Kennesaw Baseball Association | www.kennesawbaseball.com
FOLLOW US ON SOCIAL MEDIA! Kennesaw Girls Softball Association | www.kennesawsoftball.com
Kennesaw Futbol Club/SSA North | www.ssaelite.com
#KennesawParks
ADMINISTRATIVE OFFICE THE playbook
City of Kennesaw
Parks & Recreation Department iRsKepecurnbenlaiestshioaewndirntehAsreeprervitel,ismAtuehgseuprseitgrahyntedtaoDr mbeycaekKmeecbnhneaer.nsTgahewesPtCaoirtakynsoy&f
2753 Watts Drive | Kennesaw, GA 30144 information contained in THE playbook.
Administrative Hours............................Monday to Friday 8:00am-5:00pm
Telephone..............................................(770) 422-9714
Fax..........................................................(678) 460-3373
Internet & Online Registration............www.kennesawparksandrec.com
cotablne oftents speceivaelnts
2General Information
Sat, JAN 12
4-5Parks & Facilities Book, CD & DVD Swap
See below for more info
Youth & Teen Programs
sceoevbear cfokr
6-15
Sat, FEB 9 | 6pm - 9pm
Adult Programs Valentine’s Dance Party
16-21 Tue, MAY 7 | 2pm - 7pm
Community Blood Drive
See page 5 for more info
Sat, MAR 9 | 10am - 2pm
Touch-A-Truck
See page 5 for more info
Sat, APR 13 | 10am - 6pm
Sun, APR 14 | Noon - 5pm
Kennesaw/Big Shanty Festival
www.kennesawbusiness.org
INTERNET IN PERSON 22-23Registration Info, Policies & Form Sat, APR 20
Seatings at 8am & 10am
Bunny Breakfast
See page 11 for more info
Tue, APR 23 | 5:30pm - 7:30pm
Summer Camp Expo
See page 13 for more info
BOOK, CD & DVD SWAP BEN ROBERTSONspeceivaelnt
COMMUNITY CENTER
Drop off items: THU & FRI, JAN 10-11 from NOON - 8pm
Open swap: SAT, JAN 12 from 8am - NOON
Clear out your bookshelves and swap your old stories for new adventures! Kennesaw Parks & Recreation’s Book, CD
& DVD swap is a fun, FREE and easy way to freshen up your library! Here’s how it works: drop off your gently
used hardcover or paperback books, music CDs and DVD movies on Thursday and Friday to receive a ticket
redeemable for the same number of items during “open swap” time on Saturday. Books must have their
front and back covers intact and be in good condition. CDs and DVDs must be in their original cases and
be fully operable. Magazines, software, record albums, VHS or cassette tapes, adult content, unauthorized
or illegal material will not be accepted. After the event, all unclaimed items will be donated to charitable
organizations. This is not a book sale. It is a FREE media swap. Items will not be available for purchase.
Assistance is needed during the event with receiving, sorting, counting and bagging items. Volunteers must have the ability to bend, stoop,
stand and lift up to 20lbs. To sign up for a volunteer shift, visit www.kennesawparksandrec.com and click on “Volunteers.”
parks & facilities
BEN ROBERTSON COMMUNITY
Acres CENTER, 2753 Watts Drive
Ball Fields
Batting Cages Whether you’re planning a business meeting for
Soccer Fields
Play Fields 200 guests or a small event with a few relatives,
Tennis Courts
Basketball Courts the City of Kennesaw invites you to experience
Trail
Park/Facility Name Skatepark the value, convenience and simplistic style of the
Dog Park Ben Robertson Community Center.
Playgrounds
Pavilions
Picnic Tables
Grills
Benches
Wi-Fi
Wellness Station
Drinking Fountains
Splash Pad
Community Parks
Adams 33.0 10 • 1L 2L • Interior accommodations include a 1,687 sq ft
• • • • • • pre-function lobby area, a 3,952 sq ft banquet
Swift-Cantrell 42.0 • • 1L • • • • • • • • • • hall and two 840 sq ft meeting rooms that can
Neighborhood Parks be joined to form a large meeting room. There
is ample parking, and the entrance features
Deerfield 5.0 1• ••• • a porte-cochere with interior vestibule to
Pine Mountain 4.7 provide shelter for arriving guests.
Woodland 3.5 Small Urban Parks The banquet hall can accommodate theater-style
seating for 250 and banquet-style seating for
Butler Ridge 0.5 ••••• approximately 200. More intimate settings
City Hall 0.5 ••• are available for smaller groups in the
meeting rooms.
Chalker 2.25 •1 ••• Rental rates start at only $20.00 per hour
Fairfax 2.0 (Kennesaw city resident) for a small
Kennesaw Station 0.2 ••••• meeting room. For more information
McCollum 0.5 call (770) 422-9714 or visit
••• • www.kennesawparksandrec.com.
••• •
Shillings 0.25 •••••
Tara 0.5 ½ ••• ADAMS PARK, 2600 Park Drive
Terry Lane 0.5 • ••• Adams Park, a 33 acre community park
Winchester Forest 1.2 ••••• located near the intersection of Watts Drive
Wrens Ridge 0.5 ½• ••••• and US-41/Cobb Parkway, offers a unique
blend of active and passive recreation.
Special Use Areas Adams Park features:
City Hall — 0.4 • • C ommunity center building
Big Shanty Spring
• S ix lighted baseball fields
Commemorative 0.5 •
• • ••• • F our lighted softball fields
Depot 4.5
• L ighted soccer field
Smith-Gilbert 16.0 ••
Gardens • Two lighted tennis courts
Indoor Facilities • P layground
Ben Robertson 2.0 • • P icnic pavilions and shelters
Community Center
• Half mile concrete trail
Community Wide Trail
Deerfield Park – • • • Indoor and outdoor batting cages
KFBC – • • • C oncession buildings
– • • • S cout hut building
Matlock – • • • Wi-Fi hotspot
Whispering Lake – ••
Winchester
Go Skate Day at
Forest Park
Swift-Cantrell Park
4
SWIFT-CANTRELL PARK, 3140 Old 41 Highway speceivaelnt
Swift-Cantrell Park serves as one of the premier recreation, relaxation
and central gathering places for area residents. Park hours of operation Community
are from 7:00am to 10:00pm. At 42 acres, the City of Kennesaw’s largest
community park features: BLOOD DRIVE
• T wo age-appropriate playgrounds • One mile perimeter asphalt trail TUE, MAY 7 | 2pm -7pm
• Open turf for passive recreation • Half mile inner-loop asphalt trail Why donate blood? Blood is a perishable product that can only come
from volunteer donors.The need is constant and your contribution is
KENNESAW SKATEPARK important for a healthy and reliable blood supply. And you’ll feel good
The 40,000 sq ft, all-concrete skatepark consists of a Street League knowing you’ve helped save lives. Visit www.redcrossblood.org and enter
Skateboarding Foundation Certified Skate Plaza, flow course and sponsor code KP&R or call 1-800-RED-CROSS to schedule
bowl. There is no charge to use the facility. Helmets are required an appointment. Walk-ins are also welcome.
for skaters ages 15 and under. Visit www.skatekennesaw.com for
more information. BEN ROBERTSON COMMUNITY CENTER
LIFE UNIVERSITY WELLNESS STATION speceivaelnt
The Life University Wellness Station at Swift-Cantrell Park is a
complete fitness and body-weight training system designed to deliver TOUCTHruAck
a synergistic workout connecting your body’s major anatomical systems
and exercises to nearly all of your bones and muscles. The system SAT, MAR 9 | 10am - 2pm
consists of five Energi® Prime stations, 120 exercises and can accommodate
up to 14 users at once.Two additional LifeTrail® Advanced Wellness Imagine a playground that allows families to get up-close and personal
stations feature low-impact, functional exercises to help older, active with big trucks, heavy construction and public safety equipment, cool
adults stay fit, prevent injury and maintain an independent, healthy lifestyle. cars and specialty vehicles... that’s Touch-A-Truck! Have a blast watching
your kids touch levers, flip switches and shift gears that make their
FRANK BOONE DOG PARK favorite vehicles whir and rumble at this one-day-only “museum” of local
The 1.4 acre off-leash dog park, located along the western edge of transportation. Admission is FREE. Food and beverages will be available
the property, has 6-foot-high perimeter fencing, two separate run for purchase.
areas (for large and small dogs), a watering station, dog wash area Touch-A-Truck is an exciting and educational annual community event
and disposable plastic waste bags and receptacle stations. hosted by Kennesaw’s Parks & Recreation , Public Works and Police
Departments. If you or your company has a unique vehicle that you would
PICNIC PAVILIONS like to bring, please contact our Special Events Coordinator Brittani
Reserve a picnic area for your next social gathering! Swift-Cantrell Park Farmer at [email protected].
has three 1,320 sq ft open-air pavilions, each with enough picnic tables
and charcoal grills to accommodate 60 people. Pavilions can be reserved DEPOT PARK IN DOWNTOWN KENNESAW
in advance, or may be used at no charge on a first-come, first-serve basis.
Rates start at only $20 per hour for a Kennesaw city resident. For more
information, call (770) 422-9714 or visit www.kennesawparksandrec.com.
SPLASH PAD
Swift-Cantrell Park’s splash pad offers cool, wet fun for area families.
Splash pad hours are seasonal and subject to change based on weather
conditions. The 3,200 sq ft amenity offers water play options controlled
by motion sensors. Elements include a fountain spray,
ground geyser, jet stream, magic mist and multiple sea silhouettes.
Visit www.kennesawparksandrec.com for more information.
&ytoeuetnh CLAY FOR KIDS
arts & crafts
Playing with clay is messy, but fun! Students will explore basic hand
building techniques using the coil, pinch and slab methods. No class
on Mon. 2/18, 4/1 & 4/15. Materials: A separate fee of $20 is payable
to the instructor on the first day of class for clay, glazes and kiln supplies.
Attire: Wear old clothes and bring a towel (you will get dirty). Instructor:
Pamela Coronado. Location: Ceramic Studio located behind the Ben
Robertson Community Center. Parking is available on the front and
west side of the Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41230.005 5-8 M 1/14-3/11 4:00pm-4:45pm 7 $84/$104
41230.006 5-8 M 3/18-5/13 4:00pm-4:45pm 7 $84/$104
POTTERY: CAREGIVER & ME YOUTH POTTERY
Expose your little one to the arts. Caregiver and child will work together Kids are encouraged to explore and express their creativity in this class
to hand build a clay project you can both treasure forever. One registration designed to teach hand building and sculpting techniques using the coil,
fee covers the adult and child. Come ready to get dirty! Materials: pinch and slab methods. Each student will also have an opportunity
A separate fee of $10 is payable to the instructor on the first day of to use a pottery wheel. No class on Mon. 1/21, 2/18, 4/1 & 4/15 and
class for clay, glazes and kiln supplies. Attire: Wear old clothes and bring Thu. 2/21, 4/4 & 4/18. Materials: A separate fee of $20 is payable to
a towel (you will get dirty). Instructor: Pamela Coronado. Location: the instructor on the first day of class for clay, glazes and kiln supplies.
Ceramic Studio located behind the Ben Robertson Community Center. Attire: Wear old clothes and bring a towel (you will get dirty). Instructor:
Parking is available on the front and west side of the Ben Robertson Pamela Coronado. Location: Ceramic Studio located behind the Ben
Community Center. Robertson Community Center. Parking is available on the front and
west side of the Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41230.007 7-13 M 1/14-3/11 5:00pm-6:00pm 7 $84/$104
41230.009 7-13 Th 1/17-3/7 3:30pm-4:30pm 8 $84/$104
41230.010 7-13 M 3/18-5/13
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res 41230.011 7-13 Th 3/21-5/16 5:00pm-6:00pm 7 $84/$104
3:30pm-4:30pm 7 $84/$104
HANDPRINT HEART DISH 10:00am-11:00am 2 $20/$20 WE ARE
41230.001 3-7 W 1/30-2/6 10:00am-11:00am 2 $20/$20 KENNESAW PARKS & REC
10:00am-11:00am 2 $20/$20
HENRY THE HIPPO
41230.002 3-7 W 3/6-3/13
EASTER BUNNY
41230.003 3-7 W 4/3-4/10
MOTHER’S DAY LADYBUG 10:00am-11:00am 2 $20/$20
41230.004 3-7 W 5/1-5/8
aTmtfs homuryeoctaymhhsz’epviaenme tcgimgegia. .roeTleWnhaneweeet yaeesadbudasromerrvdeivemb–aeklCeaeuisarnhgnsdhrwDdbfecawki,mmtwsdeobeaKasebectrecoemraaeyiaeeatetittn.dpmhyonhhdkrptSeiWntoeieniliobyynaohtnotreegnheugelendcsexde5tgseaehhowppxi-tahiiswfnswneaeCycadnrrmCirediaadtahiittfeeitapaeenyeleynlnrrcrgsrsgmolodispciueofesgwmidesoafmpnnfniro..laddaghnuairnmKTlKeyosidimnchdmsacesfeeehaeacnonorclfaymoanrnuncwprrocngdeeoreoermhpeaemsdlhdsmriaegaeaamiumtnnmvkfreopnwwieoateptrpaeihtontstt.ythldneydiotepianTsianeasrntghnw.tonttotegihgdrremCletaoeeaibarpthsaescesatacesthhkyothcotm.naowio,efqtavoSsdfarhfuniienhtCtnfcssaefoiigentegaartaeoilresnoiocfrnnmerhf.tntolsugsroengapdsidevsee
ptlhaisyisbmoyok6
&ytoeuetnh STEAM CAMP
camps
Explore all that science has to offer! These camps are full STEAM ahead
-Science, Technology, Engineering, Art and Math activities to spark
the imaginations of any camper. Each day will be packed with awesome
mixed media visual arts activities along with engaging STEM-certified
science and technology experiments! These camps are specifically
designed to keep your camper entertained, engaged and having fun
all day! Materials: A separate fee of $25 is payable to the instructor
on the first day of camp. Supplies: Participants should bring a brown
bag lunch, beverage and two snack each day. STEAM Camp is a
peanut-free environment. Attire: Wear old/play clothes. Instructor:
Terrific Scientific. Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
WINTER BREAK M-F 2/18-2/22 9:00am-4:00pm 5 $205/$220
M-F 4/1-4/5 9:00am-4:00pm 5 $205/$220
41290.002 6-13
SPRING BREAK
41290.001 6-13
JUMP START SPORTS MULTI-SPORTS CAMPS WINTER WONDERLAND WITH LEGO® MATERIALS
Jump Start Sports Camps are fun-oriented and highly instructional. The Power up your engineering skills with Play-Well TEKnologies and tens
relaxed and nurturing atmosphere enables children to learn, grow, make of thousands of LEGO®! Join us as we apply engineering, architecture,
friends and have a meaningful camp experience. The focus of these camps creativity and fun to create a magical Winter Wonderland. Build
is on the fundamentals of the sport for beginners and advanced concepts motorized contraptions like snowmobiles and gondolas. Create a hilltop
for the experienced player. Kids will be coached at their ability and village complete with slopes for LEGO skiers and sledders. New and
level of understanding. Camp games and activities will include capture returning campers will explore the endless creative possibilities of the
the flag, tag, relay races, Wiffle ball, kickball and more. Children will LEGO building system with the guidance of an experienced Play-Well
be separated into age groups for all competitive activities. Join anytime instructor. Materials: Campers should bring a peanut-free snack and
during the week (fee will be pro-rated). Supplies: Campers should bring water each day. Instructor: Play-Well TEKnologies. Location:
a packed lunch with a beverage, snacks and plenty of water each day. All Ben Robertson Community Center.
campers should arrive at camp with sunscreen already applied, as well as
with additional sunscreen, as needed. We recommend a sunscreen with Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
an SPF of at least 30. Attire: Active wear and athletic shoes. Instructor: 41290.003 7-11 M-F 2/18-2/22
Jump Start Sports. Location: Ben Robertson Community Center. 9:00am-12:00pm 5 $179/$194
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res speceivaelnt
NEW YEARS EXTRAVAGANZA
41290.006 5-12 M-F 12/31-1/4 9:00am-3:00pm 4 $145/$160
WINTER BREAK
41290.005 5-12 M-F 2/18-2/22 9:00am-3:00pm 5 $145/$160
SPRING BREAK
41290.004 5-12 M-F 4/1-4/5 9:00am-3:00pm 5 $145/$160
EARLY CARE
Under the supervision of Jump Start Sports, children can independently choose and
engage in a variety of activities including games, puzzles, reading, drawing or simply
socializing with friends. Fees will not be pro-rated for partial attendance.
41290.010 5-12 M-F 12/31-1/4 7:30am-9:00am 4 $15/$15
41290.012 5-12 M-F 2/18-2/22 7:30am-9:00am 5 $15/$15
41290.015 5-12 M-F 4/1-4/5 7:30am-9:00am 5 $15/$15
EXTENDED CARE
After camp, children will attend Extended Care under the supervision of Jump Start SPECIAL
Sports staff. Children can independently choose and engage in a variety of activities
including games, puzzles, reading, drawing or simply socializing with friends. Children VoluEnVteEeNrTs
must be picked up by 5:00pm.
41290.011 5-12 M-F 12/31-1/4 3:00pm-5:00pm 5 $30/$30
41290.013 5-12 M-F 2/18-2/22 3:00pm-5:00pm 5 $30/$30
41290.016 5-12 M-F 4/1-4/5 3:00pm-5:00pm 5 $30/$30
Kennesaw Parks & Recreation seeks willing hearts and helping
hands to assist with a variety of special events, programs and community
service projects throughout the year including: Valentine’s Dance,
Touch-A-Truck, Bunny Breakfast and more! We invite your to explore
our list of volunteer opportunities and sign up for a volunteer shift at
www.kennesaw-ga.gov/parks-and-recreation/volunteers/.
BEN ROBERTSON COMMUNITY CENTER
GYMNASTICS: GYM MONKEYS LEVEL I
This beginning-level class is designed to introduce children to the world
of gymnastics. Basic skills will be taught on the floor, bars, beams, vault
and Tumbl Trak. Prerequisite: Must have completed Mini Monkeys.
The last class is the recital.
&ytoeuetnh Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
fitness & health 41250.032 5 & up M 1/7-2/25
41250.033 5 & up M 3/4-4/22 4:00pm-4:40pm 6 $48/$63
41250.034 5 & up Tu 1/8-2/26
41250.035 5 & up Tu 3/5-4/30 4:00pm-4:40pm 6 $48/$63
41250.038 1/9-2/27
41250.039 4-8 W 3/6-5/1 5:45pm-6:25pm 7 $56/$71
41250.036 4-8 W 1/11-3/1
41250.037 4-8 F 3/8-5/3 5:45pm-6:25pm 8 $64/$79
41250.030 4-8 F 1/12-3/2
41250.031 5 & up Sa 3/9-5/4 6:00pm-6:40pm 7 $56/$71
5 & up Sa
6:00pm-6:40pm 8 $64/$79
10:30am-11:10am 7 $56/$71
10:30am-11:10am 7 $56/$71
11:30am-12:10pm 7 $56/$71
11:30am-12:10pm 6 $48/$63
GYMNASTICS: CAREGIVER & ME GYMNASTICS: GYM MONKEYS LEVEL II
This playful class is centered around age-appropriate activities with an
emphasis on socialization, basic motor skills and quality movement The emphasis of this fun, fast-paced class is to increase strength and
experiences; and caters to the growing independence of young children flexibility, while learning more intermediate gymnastics skills and
as they explore and move in a safe environment with their parent or routines. Prerequisite: Participants must have previous gymnastics
caregiver (as directed by a class instructor). Participants will develop experience in a structured environment and be able to do a cartwheel,
listening and social skills as they’re introduced to basic gymnastics roundoff, handstand and be able to do a backbend with straight arms,
apparatus. The last day of class will be the recital. chin up pull over with little help; or have been evaluated by an instructor.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.012 2-4 Tu 1/8-2/26 41250.040 5-8 M 1/7-2/25 4:45pm-5:25pm 6 $48/$68
41250.013 2-4 Tu 3/5-4/30 41250.041 5-8 M 3/4-4/29 4:45pm-5:25pm 8 $64/$84
41250.019 2-4 Tu 3/12-4/30 41250.042 5-8 Tu 1/8-2/26 6:30pm-7:10pm 7 $56/$76
41250.018 2-4 W 1/9-2/27 41250.043 5-8 Tu 3/5-4/30 6:30pm-7:10pm 8 $64/$84
41250.016 2-4 F 1/11-3/1
41250.017 2-4 F 3/8-5/3 9:30am-10:00am 7 $49/$69
41250.014 2-4 Sa 1/12-3/2
41250.015 2-4 Sa 3/9-5/4 9:30am-10:00am 8 $56/$76 GYMNASTICS: HOT SHOTS/LEVEL III
5:00pm-5:30pm 8 $49/$69 This class is geared for kids who can already perform cartwheels,
handstands, back bends, roundoff on the floor, are able to do chin up
5:00pm-5:30pm 7 $49/$69 pullovers on the bars with little help and are ready to TUMBLE! We’ll
work with all the gymnastics equipment including bars, beam, vault,
9:30am-10:00am 7 $49/$69 trampoline, parallel bars, rings and floor exercise. Participants will be
conditioned and challenged while having a blast learning advanced skills.
9:30am-10:00am 7 $49/$69 Team leotard is required. Participants will participate in a mock meet
on May 1.
10:30am-11:00am 7 $49/$69
10:30am-11:00am 6 $42/$62
GYMNASTICS: MINI GYM MONKEYS Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.044 7 & up Tu 1/8-2/26
Independence, coordination, body awareness and basic gymnastics 41250.045 7 & up Tu 3/5-4/30 5:00pm-5:45pm 7 $56/$76
skills are all concepts that will be explored in this class designed for
children without the caregiver being directly involved. Caregivers may 5:00pm-5:45pm 8 $64/$84
be asked to provide assistance, as needed. Prerequisite: Children must
have completed the Caregiver & Me class or have been evaluated GYMNASTICS FOR CHILDREN WITH SPECIAL NEEDS
by an instructor.
This class is designed for children with special needs who are
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res independent while doing gross motor skill activities, yet require a smaller
41250.020 3-5 Tu 1/8-2/26 class size. Participants should be able to imitate gross motor activities,
41250.021 3-5 Tu 3/5-4/30 10:00am-10:30am 7 $42/$62 with minimal support when given a model to follow. Independence,
41250.028 3-5 W 1/9-2/13 coordination, body awareness and basic gymnastics skills are all concepts
41250.026 3-5 W 1/9-2/27 10:00am-10:30am 8 $56/$76 that will be explored. The class will be led by a gymnastics instructor
41250.029 3-5 W 3/6-4/24 with guidance from a certified special needs teacher. Caregivers may be
41250.027 3-5 W 3/6-5/1 4:30pm-5:00pm 6 $49/$69 asked to provide assistance, as needed. Parents or caregivers who register
41250.024 3-5 F 1/11-3/1 their child will be contacted prior to the first class meeting to discuss
41250.025 3-5 F 3/8-5/3 5:30pm-6:00pm 7 $46/$69 accommodations. Prerequisite: No previous gymnastics experience
41250.022 3-5 Sa 1/12-3/2 required. Students should be able to perform tasks without a buddy.
41250.023 3-5 Sa 3/9-5/4 4:30pm-5:00pm 8 $56/$76
5:30pm-6:00pm 8 $56/$76
10:00am-10:30am 7 $49/$69
10:00am-10:30am 7 $49/$69
11:00am-11:30am 7 $49/$69
11:00am-11:30am 6 $49/$69
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.054 4 & up Th 1/10-2/28 3:30pm-4:00pm 7 $30/$50
41250.055 4 & up Th 3/7-4/25 3:30pm-4:00pm 7 $30/$50
41250.056 4 & up Th 1/10-4/25 3:30pm-4:30pm 14 $55/$75
for all gymnastics classes:
and shorts
Attire: Leotard or T-shirt and shorts for girls; T-shirt Ben Robertson
for boys. Instructor: Lori Cooley & Staff. Location:
Community Center. No classes on Mon. 1/21, 2/18, 4/1, 4/29,
Tue. 2/19, 4/2, Wed. 2/20, 4/3, Thu. 2/21 & 4/4, Fri. 2/22, 4/5, 4/19
8 and Sat. 2/16, 3/30, 4/13, 4/20.
PARKOUR GYMNASTICS GYMNASTICS: TEAM KENNESAW EXPLOSIONS
Participants will learn to move quickly and fluidly through an area This class is designated as a team practice and rehearsal time for the
surrounded by obstacles using gymnastic techniques. Run up ramps, Kennesaw Explosions. The group will represent the City of Kennesaw at
jump, swing and leap across open areas. Learn body awareness and agility a variety of community events. This class is invitation-only by instructor.
while performing gymnastic moves. Last day of class will be the recital. Prerequisite: Participants must be able to perform a back walk-over on
Attire: T-shirt and shorts. the floor, a chin-up or pull-up on the bars and a cartwheel on the balance
beam. Attire: Participants will be required to purchase a custom leotard
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res directly from the instructor.
BOYS & GIRLS: LEVEL I
41250.046 6 & up Th 1/10-2/28 4:00pm-4:40pm 7 $56/$76 Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
4:00pm-4:40pm 8 $64/$84
41250.047 6 & up Th 3/7-5/2 4:30pm-5:10pm 7 $56/$86 GYM STAR
4:30pm-5:10pm 7 $56/$76
41250.048 41/2-7 F 1/11-3/1 41250.066 6 & up Tu, Sa 1/8-3/2 See below 14 $170/$190
41250.049 41/2-7 F 3/8-5/3 41250.067 6 & up Tu, Sa 3/5-5/11 See below 16 $170/$190
BOYS: LEVEL II Classes will meet Tue. 6:00pm-8:00pm and Sat. 8:30am-10:30am
41250.050 6 & up F 1/11-3/1 5:15pm-5:55pm 7 $56/$76 GYM STARS EXCEL
6:00pm-6:40pm 7 $56/$76
41250.052 6 & up F 1/11-3/1 5:15pm-5:55pm 7 $56/$76 41250.068 6 & up M, Th 1/7-2/28 See below 13 $175/$195
6:00pm-6:40pm 7 $56/$76
41250.051 6 & up F 3/8-5/3 41250.069 6 & up M, Th 3/4-5/16 See below 18 $245/$265
41250.053 6 & up F 3/8-5-3 Classes will meet Mon. 6:00pm-8:00pm and Thu. 6:00pm-8:30pm
EXCEL SILVER
GYMNASTICS AND CHEER TUMBLING CLINIC 40250.051 6 & up M, Tu, Th 9/4-10/18 See below 17 $175/$195
This clinic is for those who want to learn how to do a back handspring or 40250.052 6 & up M, Tu, Th 10/22-12/27 See below 25 $250/$270
front or back tuck, or just want to tumble better. Bring your whole cheer
group or come alone. We have excellent staff who are safety certified and Classes will meet Mon. 5:15pm-8pm and Tue. & Thu. 6pm-8pm.
can help you with floor skills wherever you are.
EXCEL GOLD
41250.072 6 & up M, Th, Sa 1/7-3/2 See below 20 $300/$320
41250.073 6 & up M, Th, Sa 3/4-5/11 See below 24 $345/$365
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Classes will meet Mon. 6pm-8pm, Thu. 6pm-8:30pm and Sat. 9:00a-12:00pm.
41250.061 6 & up Sa 3/2-3/23
41250.062 6 & up Sa 12:00pm-2:00pm 4 $75/$95 USA LEVEL 4
41250.063 6 & up Sa 3/2
41250.064 6 & up Sa 3/9 12:00pm-2:00pm 1 $30/$50 41250.070 6 & up M, F, Sa 1/7-3/2 See below 20 $300/$320
41250.065 6 & up Sa 3/16
3/23 12:00pm-2:00pm 1 $30/$50 41250.071 6 & up M, F, Sa 3/4-5/11 See below 23 $370/$390
12:00pm-2:00pm 1 $30/$50 Classes will meet Mon. 6:00pm-8:00pm, Fri. 6:00pm-8:30pm and Sat. 9:00am-12:00pm
12:00pm-2:00pm 1 $30/$50
GYMNASTICS: PRE-TEAM EXPLOSIONS TRAINS,
TRAINS,
This class is for the gymnast who is interested in competing on a TRAINS!
gymnastics team. Emphasis will be on preparing participants for
competition with advanced training and working on higher skill levels.
Participants will not compete in competitions, but will be working
towards joining a gymnastics team. The group will represent the City of
Kennesaw at a variety of community events. This class is invitation-only
by instructor. There will not be a recital, there will be a mock meet on
May 1. Attire: Participants will be required to purchase a custom leotard
directly from the instructor.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.059 6 & up M, Th 1/7-2/28 5:30pm-6:15pm 13 $85/$105
41250.060 6 & up M, Th 3/4-4/25 5:30pm-6:15pm 14 $91/$111
GYMNASTICS: JUNIOR TEAM EXPLOSIONS Join us for our annual
extraordinary train event!
This class is for children who have an interest in working towards Preview several new and
competing one day. The group will represent the City of Kennesaw at expanded train layouts, including
a variety of community events. This class is invitation-only by instructor. model railroad layouts of different
Prerequisite: Participants must be able to perform an exceptional scales and gauges, from regional groups. Speak with staff
cartwheel, roundoff, back bend and have the strength to do a pull over about our many railroad artifacts on display. The General
on the bars. Attire: Participants will be required to purchase a custom Emporium gift shop has expanded with new shirts, toys and
leotard directly from the instructor. interactive layouts for kids to explore! This Southern Museum
Event is fun for the whole family!
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.057 6-7 Th 1/10-2/28 4:45pm-5:30pm 7 $56/$76 Jan 26-27 | 9:30am-5:00pm
41250.058 6-7 Th 3/7-5/2 4:45pm-5:30pm 8 $64/$84
SouthernMuseum.org W• I7NT7ER0/S-P4RIN2G7|-22011817
&ytoeuetnh LITTLE DRAGONS KARATE
fitness & health
Karate is much more than just kicking and punching. Students will
learn about respect and courtesy, as well as concentration skills and
how to follow directions. The emphasis will be on building patience
and inner strength, rather than being competitive and combative. The
parent or caregiver is welcome to observe the class. Join anytime during
a session (fee will be pro-rated). No class on Tue. 4/2. Sibling Discount
Available: Register two or more siblings for any Little Dragon Karate
class and receive a 50% discount off the registration fee for the second
and each subsequent child. Attire: Karate uniform (see instructor).
Instructor: Phil Robinson, Seventh degree Black Belt in Tang Soo Doo.
Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
WHITE TO ORANGE BELT $117/$137
41250.010 4-11 Tu 1/8-5/14 5:30pm-6:00pm 18
GOLD BELT & UP
This traditional karate class will focus more on advanced techniques. Students who
reach the advanced level, set by the instructor, will be asked to stay an additional 15
minutes after class for sparring practice.
SWIFT KIDS RUNNING PROGRAM 41250.011 4-11 Tu 1/8-5/14 6:15pm-7:00pm 18 $117/$137
This running club serves as a 5K training program to empower SPECIAL WARRIORS
children with the knowledge they need to make smart lifestyle choices.
Participants will enjoy time outside playing games, doing drills and This class is designed for students with special needs and their caregivers,
running on the trail; and learn that health and fitness can be easy, adapting traditional Taekwon-Do training to meet the needs of each
fun and rewarding. The class finale will be running as a group in the student. The benefits of traditional Taekwon-Do are for everyone.
Swift-Cantrell Classic on Sat. 5/11. The race application fee is included Taekwon-Do can be used to help develop balance, focus and self-defense,
with your registration fee. Parent Meeting: All parents will be required as well as self-control and self-esteem. The techniques taught in this class
to attend a meeting at the Ben Robertson Community Center on will also help improve hand-eye coordination. Parents and caregivers are
Tues. 3/26 at 6:00pm. Supplies: Participants will need to bring plenty welcome and encouraged to attend the class each week. Join anytime
of water. Attire: Loose, comfortable clothing that allows for movement, during a session (fee will be pro-rated). No class on Thu. 2/21. Attire:
running shoes and Swift Kids T-shirt (provided). Instructor: Swift Kids Taekwon-Do uniform (see instructor) or comfortable gym clothing;
Running Club Coaches. Location: Classes will meet at Swift-Cantrell flip-flops, sandals or sneakers. Instructor: Omar Welch, Certified Second
Park under The General picnic pavilion. Degree Black Belt. Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
$40/$60 Th 1/10-1/31 6:15pm-6:45pm 4 $28/$43
38250.006 5-12 Tu, Th 3/28-5/9 6:00pm-7:00pm 13 41250.005 6 & up Th 2/7-2/28 6:15pm-6:45pm 3 $21/$36
Th 3/7-3/28 6:15pm-6:45pm 4 $28/$43
41250.006 6 & up Th 4/11-4/25 6:15pm-6:45pm 3 $21/$36
Th 5/2-5/16 6:15pm-6:45pm 3 $21/$36
41250.007 6 & up
MARTIAL ARTS FOR TOTS 41250.008 6 & up
This class teaches Taekwon-Do and Karate techniques to young 41250.009 6 & up
children in a dynamic, energetic format. The physical focus of the class
is developing balance, endurance and coordination. Students will also BSD TAEKWON-DO
be introduced to martial arts etiquette and respect. No class on Wed.
2/20, 3/20, 4/3. Instructor: Natalie Stickney. Location: Ben Robertson This class is designed to teach students both children and adult
Community Center. traditional Taekwon-Do. Both beginner and experienced students are
welcome in this class. In addition to learning an effective form of
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res self-defense, students will develop balance along with focus, self-control
W 1/16-2/27 $36/$56 and self-esteem. The techniques taught will help improve hand
41250.002 3-5 W 3/6-4/24 5:30pm-6:00pm 6 $36/$56 eye-coordination and confidence. Students in this class range from 10th
Gup Low White Belts through Black Belts. Students can eventually earn
41250.003 3-5 5:30pm-6:00pm 6 their Black Belt. All training in this class will follow a syllabus that is
accepted by the United States Taekwon-Do Federation. Join anytime
during a session (fee will be pro-rated). No class on Mon. 1/14, 1/21,
2/18, 4/1 and Wed. 2/20, 4/3. Prerequisite: Students who are promoted
to a high Yellow Belt will be required to become a member of the United
States Taekwon-Do. Attire: Taekwon-Do uniform or comfortable
gym clothing; flip-flops, sandals or sneakers. Instructor: Omar
Welch, Certified Second Degree Black Belt. Location: Ben Robertson
Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
$184/$204
41250.050 6 & up M, W 1/9-5/15 6:00pm-7:00pm 31
black belt
frenzy
10
&ytoeuetnh BreakfastBUNNYspeceivaelnt
general interest
SAT, APR 20
SING-SONG CHINESE
SEATINGS AT 8am & 10am
Sing-Song Chinese will expose toddlers and young children to native
Chinese speaking and culture through conversation, songs, nursery Treat your family to a buffet including hot pancakes,
rhymes, games and activities. Students will also learn basic greetings and scrambled eggs, sausage and an assortment of fresh fruit and
simple Chinese words. The parent or caregiver is welcome to observe the sweets. Everyone’s favorite Easter Bunny will be making his
class. Join anytime during a session (fee will be pro-rated). Materials: way from table to table say hello. Be sure to bring your camera
Students will need to bring pencils and crayons, or colored pencils. for family pictures! Seatings are available from 8am–9:15am
Instructor: Diana Dowd. Location: Ben Robertson Community Center. or 10am–11:15am.Tickets are only $6 per person and can
be purchased online at www.kennesawparksandrec.com
or at the Ben Robertson Community Center.
Advance purchase is required.Tickets are
non-refundable after April 5th.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
F $238/$258
41260.001 3-7 1/11-5/10 5:00pm-5:45pm 18
COOKING & ETIQUETTE FOR KIDS
Have fun in the “kitchen” preparing delicious dishes! Turn your food into
cool creations and enjoy tasting them. A different dish will be prepared
each week, with young chefs taking a hands-on approach to preparing the
food. Table setup, manners and etiquette will also be taught. All cooks will
receive their very own chef ’s hat and recipe cards. Please indicate on the
registration form if your child has any food allergies or dietary restrictions.
No class on Mon. 2/18. Instructor: Sheila Bozeman, owner of Excellence
In Etiquette. Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
M $75/$90
41260.012 4-14 1/28-2/25 5:45pm-6:45pm 4
BEN ROBERTSON COMMUNITY CENTER
&ytoeuetnh HIP-HOP
performing arts
Rhythm, energy, confidence and style—that's what Hip-Hop is all
about! Learn challenging steps and choreography as you connect with
other dancers. This energetic and vibrant class will not only teach
Hip-Hop dance movements and technique, but also help to instill
rhythm and precision in the dancer's muscle memory. Professional
instructors will use pre-screened and edited music and teach movements
that are age-appropriate. Dancers will showcase what they've learned
for family and friends during an in-class performance on the last day
of class. Join anytime during a session (fee will be pro-rated). No class
on Tue. 2/19 and Tue. 4/2. Materials: A separate costume fee of $60
is payable to Great Gig DANCE Co. for students who wish
to participate in any scheduled performances. Attire: Loose, comfortable
clothing that allows for movement (no jeans) and sneakers with a flat
bottom (no treads). Instructor: Great Gig DANCE Co. Location:
Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Tu 1/8-5/21
41250.002 7-10 5:30pm-6:15pm 18 $198/$218
SOUTHEAST ACTORS: WHITE DIAMONDS DANCE TEAM
YOUTH ACTING FOR THE CAMERA
The White Diamonds Dance Team is a majorette style dance team that
Focusing on techniques specific to the camera, the Acting for the incorporates Hip-Hop, Jazz, lyrical and step routines. Participants will
Camera Class incorporates both the performance and technical work learn the art of historically black colleges and university dance team
for film acting (in TV and Feature Films). In addition to the intimacy styles in a positive environment that encourages self-confidence. This
film acting requires, the class covers the technical aspects of how the team is ideal for dancers who enjoy fast paced moves. Music used during
actor fits into shot composition, lighting, camera blocking, marks, eye class and performances will be pre-screened and edited, and movements
lines and nuance. This class covers both practical and theoretical material will be age-appropriate. Get ready to shine bright like a diamond! No
designed to help an actor's internal and external work in front class on Mon. 1/14, Sat. 4/13 and Fri. 4/19. Family Discount Available:
of camera. Instructor: Southeast Actors Academy. Location: Ben Register two or more family members and receive a $20 discount off
Robertson Community Center. the registration fee for the second and each subsequent family member.
Materials: A separate fee of $25 is payable to the instructor on the first
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res day of class for a White Diamonds practice T-shirt and black leggings.
W 1/9-1/30 6:00pm-8:00pm 4 $85/$100 Attire: Team T-shirt, black shorts, pants or leggings and black Jazz shoes
41240.009 6-17 W 2/6-2/27 6:00pm-8:00pm 4 $85/$100 or black dance sneakers (for girls); Team T-shirt, shorts and black Jazz
W 3/6-3/27 6:00pm-8:00pm 4 $85/$100 shoes or black dance sneakers (for boys). Instructor: Lauren White,
41240.010 6-17 W 4/3-4/24 6:00pm-8:00pm 4 $85/$100 Head Coach of White Diamonds Dance Team. Location:
W 5/1-5/15 6:00pm-8:00pm 3 $85/$100 Ben Robertson Community Center.
41240.011 6-17
41240.012 6-17
41240.013 6-17
BALLET & TAP Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
M, W, F, Sa 1/7-5/18 See below 73 $225/$245
This combination dance class is for your energetic and expressive 41240.004 6-18 M, W, F, Sa 1/7-1/30 See below 12 $50/$65
dancer. Young dancers will explore ballet and tap in a positive learning M, W, F, Sa 2/1-2/27 See below 16 $50/$65
environment with professional instructors. Ballet, the foundation of all 41240.003 6-18 M, W, F, Sa 3/1-3/30 See below 18 $50/$65
dance, will include proper terminology and technique, helping to develop M, W, F, Sa 4/1-4/29 See below 15 $50/$65
grace and poise. Tap will include detailed technique exercises and 41240.005 6-18 M, W, F, Sa 5/1-5/18 See below 11 $50/$65
combinations to develop rhythm, musicality and coordination. Dancers
will showcase what they've learned for family and friends during an 41240.006 6-18
in- class performance. Join anytime during a session (fee will be
pro-rated). No class on Tue. 2/19 and Tue. 4/2. Materials: A separate 41240.007 6-18
costume fee of $60 is payable to Great Gig DANCE Co. for students
who wish to participate in any scheduled performances. Attire: Leotard, 41240.008 6-18
tights, pink ballet shoes and black tap shoes (for girls); T-shirt, shorts,
black ballet shoes and black tap shoes (for boys). Instructor: Great Gig Classes will meet Mon., Wed. and Fri. 6:30pm-8:30pm and Sat. 10am-12:30pm
DANCE Co. Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Tu 1/8-5/21
41240.001 3-5 4:45pm-5:30pm 18 $198/$218
Rhythm, energy,
confidence and style
12
birthday speceivaelnt
parties
CSAUMMPMEEXRPO
Kennesaw Parks & Recreation offers themed birthday party packages on select WWHYEOIESRRUHEE!
Saturdays at the Ben Robertson Community Center. Parties include one hour
of structured activities and one hour in a party room. Parties must be scheduled IT'S TIME TO PLAN AN
at least two weeks in advance and are limited to a maximum of 20 children. AMAZING SUMMER!
To schedule a party, visit the Ben Robertson Community Center during
regular office hours (Mon.-Fri., 8:00am-5:00pm). Fees are due at the time of Check out all the different summer camps we offer! This event
registration. All children attending the party will be required to bring a signed is a sneak-peek showcase of all our wonderful summer camps.
Waiver of Liability form (provided at registration) on the day of the party or An early-bird discount will be offered for on-site registration.
they will be unable to participate. Only the child’s parent or legal guardian may
sign the form. A “party planner” will contact you at least one week before your TUE, APR 23
scheduled party to discuss details. 5:30pm - 7:30pm
TERRIFIC SCIENTIFIC BIRTHDAY PARTIES (4-13) Acting • Dancing • Baseball • Soccer • Flag Football • Cheerleading • Pottery
STEM • LEGO • Cooking • Tennis • Karate • Painting • Arts & Crafts
✶ One hour of science fun based on chosen theme: Printing • and Many More!
Rocket Science, Chemical Reaction Lab, Gross Science or Physics Master
✶ The fee is $225 for up to 10 children; or $275 for 11-20 children BEN ROBERTSON COMMWIUNTNERIT/SPYRINCGE|N20T18ER
✶ Each child will leave with a take-home experiment
✶ Science supplies included
✶ Each child will receive a theme-specific goody bag
✶ Party blocks available from 11:00am-1:00pm, 2:00pm-4:00pm and 5:00pm-7:00pm
GYMNASTICS BIRTHDAY PARTIES (4 & up)
✶ One hour of regular gymnastics or parkour
✶ The fee is $150 for up to 10 children, or $175 for 11-20 children
✶ Party blocks available from 2:00pm-4:00pm, 4:00pm-6:00pm and 6:00pm-8:00pm
✶ Parties unavailable on Sat. 4/2
ART A LA CARTE BIRTHDAY PARTIES (6 & up)
✶ One hour of non-stop art and imagination action based on chosen theme
✶ Choose from the following party projects: clay, textile fashion or studio drawing
✶ The fee is $225 for up to 10 children, or $275 for 11-20 children
✶ Each child will leave with their own masterpiece to treasure
✶ Art supplies included
✶ Party blocks available from 11:00am-1:00pm, 2:00pm-4:00pm and 5:00pm-7:00pm
I AM KPAERNKNSE&SRAEWC
BtIchheafieesmmmlttpceuv.a,peHma.rlyep-loDwcewaovainemsnrifge!aollErlfwetoaaarcSbyhahlseiwvphlapeeaerapikevptihyynagwodfhmaeayncdtsiiIovffpnietiirceaekstne. td
ptlhaisyisbmoyok
&ytoeuetnh
sports
JUMP START SPORTS: HUMMINGBIRDS SOCCER JUMP START SPORTS: ROOKIE BASEBALL
Children ages 6-12 will have fun as they learn the basics of soccer in A fun instruction to coach-pitch baseball for children! Players will
an age-appropriate program. Players learn dribbling, passing, trapping, receive instruction in all basics of the sport and will apply what they
shooting, defending and positioning. Each session consists of instruction have learned in fun games. The games will be non-competitive and no
in all aspects of the game, participation in fun drills designed to teach score will be kept. Players who are not able to hit the pitched ball will
skills and fun, low-key, non-competitive games. Soccer balls are provided. be able to use a tee while learning. Each session includes instruction and
All children receive a team shirt and medal. Join anytime during a game play. Jump Start Sports staff members conduct the instruction
session (fee will be pro-rated). Supplies: Participants should bring and oversee the game play while volunteer parent team coaches assist.
plenty of water and wear shin guards. Attire: Athletic attire and athletic All players receive a team T-shirt and MLB hat. Supplies: Participants
shoes (cleats are optional). Instructor: Jump Start Sports. Location: should bring plenty of water. Attire: Athletic attire and athletic shoes
Classes will meet at Swift-Cantrell Park near the main plaza. (cleats are optional). Instructor: Jump Start Sports. Location: Classes
will meet at Swift-Cantrell Park near the main plaza.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41280.035 6-12 Sa 2/16-3/23
41280.036 6-12 Sa 4/6-5/11 9:30am-11:00am 6 $85/$105 Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41250.037 5-6 Sa 3/2-4/6
9:30am-11:00am 6 $85/$105 41250.038 7-8 Sa 3/2-4/6 10:30am-11:30am 6 $90/$105
11:30am-1:00pm 6 $90-$105
JUMP START SPORTS: FLAG FOOTBALL JUMP START SPORTS: BEGINNERS LACROSSE
Children will have a blast learning football basics. Players will be Lacrosse has elements of soccer, football, basketball and hockey.
grouped by age, coached at their level of understanding and play fun, All equipment will be provided in this highly-instructional program.
low-competition games under adult supervision. Players will learn the Children will receive training on all fundamentals including passing,
basic fundamentals of offense and defense and will be introduced to catching, fielding ground balls, cradling, spacing, positioning and defense.
speed and agility training. Parent coaches can assist with instruction and Plastic sticks and soft balls will be used, which eliminates the need for
will call the plays for their teams during the games each week. Instructors helmets and shoulder pads. No checking, stick checking or poking will
will supervise all games to ensure equal playing time, a rotation of players be permitted. Join anytime during a session (fee will be pro-rated).
in various positions and to help teach context within the game. All Supplies: Participants should bring plenty of water. Attire: Athletic
equipment will be provided. Join anytime during a session (fee will be attire and shoes/cleats. Instructor: Jump Start Sports. Location:
pro-rated). Supplies: Participants should bring plenty of water each class. Classes will meet at Swift-Cantrell Park near the main plaza.
All students should arrive with sunscreen already applied, as well as with
additional sunscreen, as needed. Attire: Active wear and athletic shoes. Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Instructor: Jump Start Sports. Location: Classes will meet at 41280.034 6-12 W 4/10-5/15
Swift-Cantrell Park near the main plaza. 5:30pm-6:30pm 6 $85/$105
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41280.039 6-12 Sa 2/16-3/23
41280.040 6-12 Sa 4/6-5/11 9:30am-11:00am 6 $85/$105
9:30am-11:00am 6 $85/$105
this lax R.A.T. is
taking it
ATW
14
&ytoeuetnh TENNIS FOR CHILDREN:
tennis ADVANCED BEGINNERS & INTERMEDIATE
This class will review basic strokes, while also introducing new skills.
Participants will also begin actual play to learn positioning, rules and
scoring using the USTA Quick Start format. Intermediate-level
students will begin preparing for league play. Prerequisite: Participants
should have completed the beginning-level class and/or have some
playing experience.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41280.009 6-9 Tu 1/8-2/5 $49/$64
41280.011 6-9 Tu 1/8-3/19 5:00pm-6:00pm 5 $89/$109
41280.010 6-9 Tu 2/12-3/19 $49/$64
41280.013 6-9 Tu 2/12-4/30 5:00pm-6:00pm 10 $89/$109
41280.012 6-9 Tu 3/26-4/30 $49/$64
5:00pm-6:00pm 5
5:00pm-6:00pm 10
5:00pm-6:00pm 5
TENNIS FOR JUNIORS: BEGINNERS
The goal of this class is to introduce one or more skills necessary to play,
while keeping the development simple enough to build confidence on
the court.
TENNIS FOR TOTS Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41280.024 10-15 M 1/7-2/11 $49/$64
Tennis for Tots is a great way to start kids off on a lifetime of fun and 41280.026 10-15 M 1/7-3/25 6:00pm-7:00pm 5 $89/$109
fitness. Activities will focus on developing motor skills and improving 41280.025 10-15 M 2/25-3/25 $49/$64
hand-eye coordination. Supplies: Participants will need to bring a tennis 41280.028 10-15 M 2/25-5/6 6:00pm-7:00pm 9 $89/$109
racket and plenty of water. 41280.027 10-15 M 4/1-5/6 $49/$64
41280.014 9-15 W 1/9-2/6 6:00pm-7:00pm 5 $49/$64
41280.016 9-15 W 1/9-3/20 $89/$109
41280.015 9-15 W 2/13-3/20 6:00pm-7:00pm 10 $49/$64
41280.018 9-15 W 2/13-5/1 $89/$109
41280.017 9-15 W 3/27-5/1 6:00pm-7:00pm 5 $49/$64
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res 6:00pm-7:00pm 5
41280.003 3-5 M 2/25-5/6 $45/$65
41280.001 3-5 M 2/25-3/25 4:30pm-5:00pm 10 $24/$39 6:00pm-7:00pm 10
41280.002 3-5 M 4/8-5/6 $24/$39
4:30pm-5:00pm 5 6:00pm-7:00pm 5
4:30pm-5:00pm 5 6:00pm-7:00pm 10
6:00pm-7:00pm 5
TENNIS FOR CHILDREN: BEGINNERS TENNIS FOR JUNIORS:
ADVANCED BEGINNERS & INTERMEDIATE
The goal of this class is to introduce one or more skills necessary to play,
while keeping the development simple enough to build confidence This class will review basic strokes, while also introducing new skills.
on the court. Participants will also begin actual play to learn positioning, rules and
scoring. Intermediate-level students will begin preparing for league play.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Prerequisite: Participants should have completed the beginning-level
41280.019 6-9 W 1/9-2/6 $49/$64 class and/or have some playing experience.
41280.020 6-9 W 2/13-3/20 5:00pm-6:00pm 5 $49/$64
41280.021 6-9 W 1/9-3/20 $89/$109
41280.022 6-9 W 3/27-5/1 5:00pm-6:00pm 5 $49/$64
41280.023 6-9 W 2/13-5/1 $89/$109
41280.029 6-9 M 1/7-2/11 5:00pm-6:00pm 10 $49/$64
41280.030 6-9 M 2/25-3/25 $49/$64
41280.031 6-9 M 4/8-5/6 5:00pm-6:00pm 5 $49/$64 Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41280.032 6-9 M 1/7-3/25 $89/$109 Tu 1/8-2/5 $49/$64
41280.033 6-9 M 2/25-5/6 5:00pm-6:00pm 10 $89/$109 41280.004 10-15 Tu 1/8-3/19 6:00pm-7:00pm 5 $89/$109
Tu 2/12-3/19 $49/$64
5:00pm-6:00pm 4 41280.006* 10-15 Tu 2/12-4/30 6:00pm-7:00pm 10 $89/$109
Tu 3/26-4/30 $49/$64
5:00pm-6:00pm 5 41280.005 10-15 6:00pm-7:00pm 5
5:00pm-6:00pm 5 41280.008 10-15 6:00pm-7:00pm 10
5:00pm-6:00pm 9 41280.007 10-15 6:00pm-7:00pm 5
5:00pm-6:00pm 10
ace
advantage
for all tennis classes: WINTER/SPRING | 2018
FatsChhnooeodruewaprslt.ellesIet.nnkestSnytoenrfousisAsfcictwopolnarar.sst:1sewJe-ro.s5ie,Nt.hpAVoaatorncttniliraacdesisrp:staeaC.JnarLointossm.kc1waf(4o*tili,)rol:ttnnahJob:eeileAenwddceatalenoomkytbhtsoirimfiPnnFgaegreadkbanu.Ttd1reei8nntn-engn2niisa2nsrisasaencsdksieotn
(fee will be pro-rated).
Location: all pottery classes are located in the Ceramic Studio
behind the Ben Robertson Community Center. Parking is available
on the front and west side of the Ben Robertson Community Center.
adult POTTERY: HAND BUILDING & WHEEL
arts & crafts
Clay is a versatile material that can be used to produce ornate objects
or functional pieces. Learn the coil, pinch and slab methods of hand
building and when you’ve got the basics down, move on to wheel
techniques. No class on Tue. 2/19, 4/2, Wed. 2/20, 4/3 and Thu. 2/21,
4/4, 4/18. Materials: A separate fee of $25 is payable to the instructor
on the first day of class for 25lbs of clay, glazes and kiln supplies. Attire:
Wear old clothes and/or an apron and bring a towel (you will get dirty).
Instructors: Kristen Smith (Tue. 9am, 11am, 5pm and 7pm),
Mary Beth Fortune (Wed. 5pm and 7pm) and Pam Coronado
(Thu. 5pm and 7pm).
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41330.001 17 & up Tu 1/8-3/5 9:00am-11:00am 8 $112/$132
41330.002 1/8-3/5
PAINTING & DRAWING WITH JESSICA GEIST 41330.003 17 & up Tu 1/8-3/5 11:00am-1:00pm 8 $112/$132
41330.004 15 & up Tu 1/8-3/5 5:00pm-7:00pm 8 $112/$132
This class is designed to teach classical realist techniques for the 41330.005 15 & up Tu 3/12-5/7 7:00pm-9:00pm 8 $112/$132
contemporary artist. The session opens with a simple drawing designed 41330.006 3/12-5/7
to relay much of the groundwork of classical realism. Students may 41330.007 17 & up Tu 3/12-5/7 9:00am-11:00am 8 $112/$132
then use any medium while working from a still life or other chosen 41330.008 17 & up Tu 3/12-5/7 11:00am-1:00pm 8 $112/$132
subject. Critical feedback and technical instruction will be offered on 41330.013 17 & up Tu 1/9-3/6 5:00pm-7:00pm 8 $112/$132
an individual basis. Much like the art guilds of old, student skills range 41330.014 1/9-3/6
from beginner to advanced, so all are welcome! Supplies: Students will 41330.015 17 & up Tu 3/13-5/8 7:00pm-9:00pm 8 $112/$132
provide their own supplies (list available from instructor). Instructor: 41330.016 16 & up W 3/13-5/8 5:00pm-7:00pm 8 $104/$124
Jessica Fleming Geist. Location: Ben Robertson Community Center. 41330.019 16 & up W 1/10-3/7 7:00pm-9:00pm 8 $104/$124
41330.020 16 & up W 1/10-3/7 5:00pm-7:00pm 8 $104/$124
41330.021 16 & up W 3/14-5/16 7:00pm-9:00pm 8 $104/$124
41330.022 18 & up Th 3/14-5/16 5:00pm-7:00pm 8 $112/$132
41330.023 18 & up Th 1/10-5/16 7:00pm-9:00pm 8 $112/$132
41330.024 18 & up Th 1/10-5/16 5:00pm-7:00pm 8 $112/$132
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res 18 & up Th 7:00pm-9:00pm 8 $112/$132
18 & up Th 5:00pm-7:00pm 16 $224/$244
41320.001 18 & up M 1/7-2/25 10:30am-1:30pm 7 $105/$125 18 & up Th 7:00pm-9:00pm 16 $224/$244
41320.002 18 & up M 3/4-4/22 10:30am-1:30pm 8 $105/$125
41320.003 18 & up Tu 1/8-2/26
41320.004 18 & up Tu 3/5-4/23 6:00pm-9:00pm 8 $105/$125 POTTERY: BEGINNER WHEEL BOOT CAMP
41320.005 18 & up Th 1/10-2/28 6:00pm-9:00pm 8 $105/$125
41320.006 18 & up Th 3/7-4/25 10:30am-1:30pm 8 $105/$125 Four weeks of very small, intimate classes where you will learn to wedge,
center and pull up your clay. Class is limited to four people so that you
10:30am-1:30pm 8 $105/$125 may get as much one-on-one help as you need.
METAL CLAY JEWELRY Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Metal Clay is a crafting medium consisting of very small particles of 41330.009 17 & up Th 1/10-1/31 12:00pm-2:00pm 4 $90/$110
silver, gold, bronze or copper mixed with an organic binder and water
for use in making jewelry, beads and small sculpture which are then POTTERY: INTERMEDIATE WHEEL BOOT CAMP
fired in a kiln. During this class participants should finish four projects:
a pendant, a pair of earrings, a bracelet and one jewelry item of your Four weeks of small, intimate, intensive learning for students who can
choice using texture from nature or your home, etc. This class will build center and pull up a six-inch cylinder. We will explore shaping with
skills from one class to the next. Instructor: Rebecca Johnson. Location: different tools and multi piece projects. This class is limited to four
Ben Robertson Community Center. students to ensure everyone gets one-on-one attention.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41330.025 20 & up Th 2/14-2/28 10:00am-12:00pm 7 $70/$90 41330.010 17 & up Th 3/7-3/28 12:00pm-2:00pm 4 $90/$110
41330.026 20 & up Th 4/4-5/9 10:00am-12:00pm 6 $70/$80
POTTERY: ADVANCED WHEEL BOOT CAMP
Four weeks of small, intimate advanced wheel classes. Students should
be able to center 5lbs and pull an 8-10 inch cylinder. We will work on
throwing larger pieces, identifying problem areas for each student and
centering larger pieces of clay easier.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41330.011 17 & up Th 4/11-5/2
12:00pm-2:00pm 4 $90/$110
OPEN STUDIO POTTERY
During open studio, students who are currently enrolled in a pottery
class offered by Kennesaw Parks & Recreation are welcome to drop by
the Ceramic Studio to use the space and equipment as non-instructional
time for working on pottery projects. Availability is based on the open
hours of the Ceramic Studio. Call (770) 422-9714 for more information.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Varies 15 $60/$60
16 41330.030 18 & up M-Sa 1/7-5/18
adult QIGONG / TAI CHI
fitness
Whether you are just starting to explore Qigong or Tai Chi or have
BSD TAEKWON-DO been practicing for years, this experience in Qi will enrich you life. Let’s
enjoy practicing the traditional Chen Tai Chi Quan together! With a
This class is designed to teach students, both children and adults, blend of low-impact physical movements and calm mind, Qigong and
traditional Taekwon-Do. Both beginner and experienced students Tai Chi can be a great way to improve your well-being. Tai Chi focuses
are welcome in this class. In addition to learning an effective form on controlled motion and breath, which puts your mind and body into
of self-defense, students will develop balance along with focus, a relaxed but energized state. Tai Chi originated in China as a martial
self-control and self-esteem. The techniques taught will help improve art. It is a low-impact and mostly slow-motion exercise practiced for
hand eye-coordination and confidence. Students in this class range health maintenance, healing and increasing vitality. Qigong has been
from 10th Gup Low White Belts through Black Belts. Students can used for self-healing and rejuvenation without having to learn
eventually earn their Black Belt. All training in this class will follow a particular sequence of movements. Benefits include reduction in stress,
a syllabus that is accepted by the United States Taekwon-Do Federation. improved concentration, increased circulation and inner strength. Join
Join anytime during a session (fee will be pro-rated). No class on us and discover how to cultivate and store Qi, the vital energy of life.
Mon. 1/14, 1/21, 2/18, 4/1 and Wed. 2/20, 4/3. Prerequisite: Students No class on Mon. 1/21, 2/18, 3/25, 4/1 and Wed. 2/20, 3/27, 4/3. Senior
who are promoted to a high Yellow Belt will be required to become Discount Available: Participants age 60 and older will not be charged
a member of the United States Taekwon-Do. Attire: Taekwon-Do a non-resident fee for registration. This discount doesn’t apply to user
uniform or comfortable gym clothing; flip-flops, sandals or sneakers. (or “Non-Resident”) fees. Supplies: Participants will need to bring plenty
Instructor: Omar Welch, Certified Second Degree Black Belt. Location: of water. Attire: Comfortable, loose-fitting clothing; Athletic or casual
Ben Robertson Community Center. flat shoes. Instructor: Sachi Hirata, Certified Taiji (Tai Chi) Instructor.
Location: Ben Robertson Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.005 10 & up M 1/14-5/13 6:30pm-7:30pm 14 $92/$112
41350.006 10 & up W 1/16-5/8 10:00am-11:00am 14 $92/$112
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res TAI CHI WEAPONS
41250.004 6 & up M, W 1/9-5/15
6:00pm-7:00pm 31 $184/$204 This advanced class is for students who already have an understanding
of basic Tai Chi skills and movements. Weapons, such as straight sword,
broadsword and spear forms, utilize Tai Chi’s natural grace and poised
body positions with flexible and steady footwork. Weapons forms are
incredibly beautiful, challenging and give you a sense of awareness,
strength, balance, relaxation; and it teaches you martial art skills!
Students will use a light-weight wood sword in this class for safety
reasons. Students will also learn advanced Chen Tai Chi. Join anytime
during a session (fee will be pro-rated). No class Mon. 1/21, 2/18, 3/25
and 4/1. Supplies: A Tai Chi sword can be purchased from the instructor.
Participants will need to bring plenty of water. Attire: Comfortable,
loose-fitting clothing; Athletic or casual flat shoes. Instructor: Sachi
Hirata, Certified Taiji (Tai Chi) Instructor. Location: Ben Robertson
Community Center.
RUNNING DEVELOPMENT PROGRAM: Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
RUNNERS & WALKERS
41350.007 10 & up M 1/14-5/13 7:40pm-8:10pm 14 $46/$66
This program offers speed and agility training for runners of all levels
and abilities. Certified coaches will help you improve your quality of life QIGONG / TAI CHI & WEAPONS
through running or power walking. Whether you’re looking to decrease
weight or increase speed, the unique and fun training atmosphere This class combines Qigong and Tai Chi with weapons training.
will help you reach your goals. All participants will be encouraged to Students will get the benefits of both classes at a reduced rate. Spend
register for Kennesaw Grand Prix 5K races. Race registration fees are the evening reducing stress, improving your posture and having fun.
not included in the program registration fee. Program participants will Students will use a light-weight wood sword in this class for safety
receive incentive items, training plans, snacks and educational sessions reasons. No class on Mon. 1/21, 2/18, 3/25 and 4/1. Senior Discount
on nutrition, general health and injury prevention. Classes will not Available: Participants age 60 and older will receive a $15 discount off
meet during inclement weather conditions. A website is available the primary (or “Resident”) registration fee and doesn’t apply to user
to check about class updates and important information. Join anytime (or “Non-Resident”) fees. Supplies: A Tai Chi sword can be purchased
during a session (fee will be pro-rated). Supplies: Participants will from the instructor. Participants will need to bring plenty of water.
need to bring plenty of water. Attire: Loose, comfortable clothing that Attire: Comfortable, loose-fitting clothing; Athletic or casual flat shoes.
allows for movement and running shoes. Instructor: Balanced Running Instructor: Sachi Hirata, Certified Taiji (Tai Chi) Instructor. Location:
Coaches. Location: Classes will meet at Swift-Cantrell Park near Ben Robertson Community Center.
the main plaza.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res 41350.008 10 & up M 1/14-5/13 6:30pm-8:10pm 14 $138/$158
36 $165/$185
41350.004 12 & up Th, Sa 1/10-5/18 See below
Classes will meet Thu. 7am-9am and Sat. 7:30am-9:00am
WINTER/SPRING | 2019
adult PIYO
fitness & health
PiYo combines the muscle-sculpting, core-firming benefits of Pilates
with the strength and flexibility advantages of yoga. There are no
weights or jumps involved in this class. You will use only your body
weight and nonstop movements set to music. You’ll stretch, strengthen
and sweat-all in one class. Join anytime during the session (fee will be
pro-rated). No class on Mon. 1/21, 2/18 and 4/1. Supplies: Participants
will need to bring a yoga mat and plenty of water. Attire: Loose-fitting
exercise clothing; Athletic shoes or can be done barefoot. Instructor:
Natalie Polutta, Certified PiYo Instructor. Location: Ben Robertson
Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.001 12 & up M 1/14-3/25 7:15pm-8:15pm 9 $67/$87
41350.002 12 & up M 4/8-5/13 7:15pm-8:15pm 6 $45/$65
41350.003 12 & up M 1/14-5/13 7:15pm-8:15pm 15 $105/$125
FLOW YOGA EXECUTIVE KARATE
Flow Yoga—the movements are linked with deep breathing techniques Ready for an exciting workout? Discover Tang Soo Do, an ancient
and create an athletic, physically more challenging experience which Korean style of karate! Participants will learn martial art stretching,
allows us to experience a beautiful meditation state. Each class breathing and meditation skills, as well as all karate techniques that
concluded with deep relaxation. The ASANAS are practiced in a will help you become a Black Belt. Emphasis is placed on becoming
flowing movement. This class is for experienced yoginis and requires the a stronger, better person rather than being competitive and combative.
student to have an understanding of the postures. Join anytime during Join anytime during a session (fee will be pro-rated). No class on
the session (fee will be pro-rated). Supplies: Yoga mat or blanket Attire: Thu. 4/4. Family Discount Available: Register two or more family
comfortable clothing. Instructor: Lai Brady. Location: Ben Robertson members for this class and receive a 50% discount off the registration
Community Center. fee for the second and each subsequent family member. Attire: Karate
uniform (see instructor). Instructor: Phil Robinson, Seventh degree
Black Belt in Tang Soo Do. Location: Ben Robertson
Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.009 25-65 Th 1/10-4/25
41350.025 14 & up Tu 1/8-2/26 8:00am-9:00am 8 $80/$100 7:30pm-9:00pm 15 $165/$185
41350.026 14 & up Tu 3/5-4/30 8:00am-9:00am 9 $90/$110
41350.037 14 & up W 1/9-2/27 7:00pm-8:00pm 8 $80/$100 TAI CHI: THE MARTIAL ART WITH PHIL ROBINSON
41350.038 3/6-4/24
41350.027 14 & up W 1/10-2/28 7:00pm-8:00pm 8 $80/$100 Tai Chi, known for its slow-moving, harmonious form, has been a
41350.028 14 & up Th 3/7-4/25 8:00am-9:00am 8 $80/$100 popular exercise for years. Many have never seen the martial art and
14 & up Th 8:00am-9:00am 8 $80/$100 self-defense side of Tai Chi. In this class, you’ll not only learn the
traditional movements, but you’ll also learn how to use the moves
YOGA FOR ALL OF US for self-defense. Join anytime during a session (fee will be pro-rated).
No class on Tue. 4/2. Family Discount Available: Register two or more
Yoga for All of Us is a slow and playful practice. This class will enhance family members for this class and receive a 50% discount off the
your flexibility and strength, and reduce stress all while paving the way registration fee for the second and each subsequent family member.
for more challenging poses. Build power in your legs and core, while Attire: Comfortable, loose-fitting clothing; Athletic or casual flat shoes.
opening up areas of tightness in your hips and shoulders. Join anytime Instructor: Phil Robinson, Master of Yang Tai Chi. Location: Ben
during a session (fee will be pro-rated). Supplies: Yoga mat or blanket Robertson Community Center.
Attire: Comfortable clothing. Instructor: Lai Brady. Location: Ben
Robertson Community Center. Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.010 16-85 Tu 1/8-5/14
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res 7:30pm-8:30pm 18 $180/$200
41350.029 14 & up Tu 1/8-2/26 10:30am-11:30am 8 $80/$100
41350.031 14 & up Tu 1/8-2/26 4:00pm-5:00pm 8 $80/$100
41350.030 14 & up Tu 3/5-4/30 10:30am-11:30am 9 $90/$110
41350.032 14 & up Tu 3/5-4/30 4:00pm-5:00pm 9 $90/$110
41350.033 14 & up Th 1/10-2/28 10:30am-11:30am 8 $80/$100
41350.035 14 & up Th 1/10-2/28 4:00pm-5:00pm 8 $80/$100
41350.034 14 & up Th 3/7-4/25 10:30am-11:30am 8 $80/$100
4 1350.036 14 & up Th 3/7-4/25 4:00pm-5:00pm 8 $80/$100
harmonious
form
18
fo&r amll oemvebmoednythcelaaslsiens:g LINE DANCE FOR SEASONED DANCERS
EcaftachdocpliLnmamlollaraedoaosBwnseyrsscvshcoosesaeietneiedsutnhysfdasiyogewootlaiy.ouvyrinyinsDolio:lddcpwduaupBuaauiacwrpnwrrneanikonlclinmohatlvgiaclucnetiRitnldnoetalgleodpdhdes,aaobesf,lyccytifie.btktohhorIncreeoenuoutoeyngdssotomhsdaoitoysssuar.ntempaupvTarnlnCaecwauunaotdtkcrndofhitoceoeuimsitmrhocnnpyc:tanhm,oooiMpfsrllovycnuoierlteeelortns,.tarlamechaTihisotsreseseyhewlnsesaetaonbCsehshlftiaKbienope.tgyseolAgwnlheiopeclttloitauralsen,taiwnrsotcmr,okh.edehoefmceesewimlendaaoaclnadniiosvllsticeasdiaventchsereetgahsyesdomdteoboefaaasaeuwyrEnnrhnreagedcmmotrbaeoe.wgBoiaTfnebafndohimetudnydyertiguayensnl.edttyo Every week will be two different line dances for our seasoned dancers,
not just country, pop music, but slow music as well. Line dancing is a
dance done on your own, no partner necessary. To be a seasoned dancer
you need to have danced about two hours a week for a year or two.
Please ask us if you are not sure what level you are. Attire: Comfortable
clothing for dancing; Shoes that stay attached to your feet (no flip-flops
or athletic shoes), leather soles preferred.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.041 12 & up Th 1/10-5/6
7:00pm-8:00pm 19 $15 Per class
TAP SOCIAL
All levels, rhythmic tap. A mix of a barre warm up and a combination. A dance social is like a huge dance party. Each week there will
New combination ever week or two. Tap your troubles away! Attire: be a different style of dance. We will just dance like we are at a party!
Comfortable clothing, jazz pants and tap shoes. The Social provides a safe place to come have fun with friends and
dance the style of dance you like. First week of the month is Line
dancing/TwoStep, second week is Zouk, third week is Latin dance,
Fourth and fifth week is West Coast Swing. Please see calendar online
at www.EmBodyHMC.com for more details on what dances are being
done that particular Social. Attire: Comfortable clothing for dancing;
shoes that stay attached to your feet (no flip-flops or athletic shoes),
leather soles preferred.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.040 12 & up F 1/11-5/17 8:00pm-9:00pm 19 $5 Per class
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.020 12 & up Tu 1/8-5/14 6:00pm-7:00pm 19 $15 Per class EMPOWERMENT GROUP
ZOUK Come get to know people who are going through similar things to you
in life. This is a safe space to be supported in what you are going through
Zouk is a Brazilian dance now done all over the world. It’s a newer and to know you are not alone. We will discuss and support each other
dance, over the last 8-10 years, in the states. It resembles Bachata through all topics of life. Examples are how to live the lives we want and
(wave like body movement) and has roots in Lambada and Samba. move past the hurts and traumas we have. This is a no judgment-free
The music is unique to its style but can also be done to some modern zone to feel what you feel.
day American pop music as well as R&B. It is a partner dance but
you do not need to bring a partner in order to dance with us. Attire: Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Comfortable clothing for dancing; Shoes that stay attached to your
feet (no flip-flops or athletic shoes), leather soles preferred. 41350.023 18 & up Sa 1/12-5/18 10:00am-11:00am 19 $10 Per class
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res BODY MOVEMENT
41350.043 12 & up Tu 1/15-5/14
6:00pm-7:00pm 18 $15 Per class Learn how to use (isolate) every part of your body individually in dance
and movement as well learning to use different parts together. This
LATIN class will teach you coordination and get you comfortable in your own
skin on and off the dance floor. This is an all levels group class. Attire:
Every week will be two different Latin (ballroom American Comfortable clothing for dancing; Shoes that stay attached to your feet
Latin dances) types of dance. Each class will be a mix of Finesse (no flip-flops or athletic shoes), leather soles preferred.
(aka Technique) and one or two different steps. The goal of this class
is to get people moving and feeling good with a partner. The dances Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
can be Rumba, Salsa, Bachata, East Coast Swing, Night Club, Two-Step
and hustle. You do not need to come with a partner to do this. Please see 41350.024 12 & up Sa 1/12-5/18 11:00pm-12:00pm 19 $15 Per class
calendar online at www.EmBodyHMC.com for more details on what
dances are being done. Attire: Comfortable clothing for dancing; Shoes
that stay attached to your feet (no flip-flops or athletic shoes), leather
soles preferred.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41350.022 12 & up Tu 1/8-5/14
7:00pm-8:00pm 19 $15 Per class
WINTER/SPRING | 2019
adult ge&npeerrafloirnmteinregstarts
PHOTOGRAPHY BASICS SOUTHEAST ACTORS:
ADULT ACTING FOR THE CAMERA
Learn the basic skills and techniques of photography. This class is for
the beginning level photographer who wants to improve their skills and Focusing on techniques specific to the camera, the Acting for the
understand the functions of using their camera. In this class you’ll learn Camera Class incorporates both the performance and technical work
about the equipment, exposure settings, composition and how to save for film acting (in TV and Feature Films). In addition to the intimacy
and process your images. Whether you use a point-and-shoot camera, film acting requires, the class covers the technical aspects of how the
DSLR or a mirrorless camera, this class will guide your way to creating actor fits into shot composition, lighting, camera blocking, marks, eye
beautiful images. Supplies: Participants will need to bring a camera, lines and nuance. The class covers both practical and theoretical material
instruction manual (if available), paper and a pencil or pen for taking designed to help an actor’s internal and external work in front of camera.
notes. Instructor: Mark Chandler. Location: Ben Robertson Instructor: Southeast Actors Academy. Location: Ben Robertson
Community Center. Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41360.001 15 & up Th 1/10-1/31 7:00pm-8:30pm 4 $55/$70 41340.003 17 & up Th 1/3-1/31 7:00pm-9:00pm 5 $85/$100
41360.002 15 & up Th 4/4-4/25 7:00pm-8:30pm 4 $55/$70 41350.004 17 & up Th 2/7-2/28 7:00pm-9:00pm 4 $85/$100
41350.005 17 & up Th 3/7-3/28 7:00pm-9:00pm 4 $85/$100
41350.006 17 & up Th 4/4-4/25
HEARTSAVER® FIRST AID CPR 41350.007 17 & up Th 5/2-5/16 7:00pm-9:00pm 4 $85/$100
7:00pm-9:00pm 3 $85/$100
This course offers skills for community members in First Aid, CPR,
automated external defibrillator (AED) and relief of choking. This
combination CPR with basic first aid training meets Occupational
Safety and Health (OSHA) requirements. A two-year certification is
given upon completion. The cost of this program is $60 (Heartsaver First
Aid portion only—Cost: $25) and pre-registration and pre-payment
is required. To register, please call 770-956-STAR(7827). Attire:
Comfortable clothing. Instructor: WellStar. Location: Ben Robertson
Community Center.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
Call 770-956-STAR(7827) 11 & up Sa 3/23 9:00am-11:30pm 1 $60/ $60
learn first aid
to save a life
20
adult OUTDOORspeceivaelnt
sports
SeriesMOVIE
SAT
MAY 4
SAT
JUN 1
SAT
JUL 27
TENNIS FOR ADULTS: BEGINNERS It doesn’t get much better than FREE, family-friendly movies in the park!
Movies will be projected onto a giant inflatable screen after sundown.
This class will review basic strokes, while also introducing new skills. Arrive early for pre-movie entertainment, giveaways and outdoor fun.
Participants will also begin actual play to learn positioning, rules and For your comfort, bring a blanket or low-back chairs. Pop-up tents,
scoring. Intermediate-level students will begin preparing for league play. canopies or beach umbrellas that can obstruct the view of others are not
Sessions with an asterisk (*): Join anytime during a session (fee will permitted. Concessions will be available for purchase. Cancellations may
be pro-rated). Supplies: Participants will need to bring a tennis racket occur due to weather conditions.
and plenty of water. Attire: Comfortable clothing and tennis shoes. Visit www.kennesawparksandrec.com for updates.
Instructor: Josef Vondra. Location: Adams Park Tennis Courts.
BEN ROBERTSON COMMUNITY CENTER
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
We loved the All Star summer
41380.006 15 & up W 1/9-2/6 7:00pm-8:00pm 5 $49/$64 camp at Kennesaw Parks
41380.008* 15 & up W 1/9-3/20 7:00pm-8:00pm 10 $89/$109 and Rec. My children enjoyed
2/13-3/20 7:00pm-8:00pm 5 $49/$64 having a new theme each
41380.007 15 & up W 2/13-5/1 7:00pm-8:00pm 10 $89/$109 week and the field trips.
41380.010 15 & up W 3/27-5/1 7:00pm-8:00pm 5 $49/$64 My kids love the staff,
41380.009 15 & up W
especially Mrs. Missy at the
TENNIS FOR ADULTS: ADVANCED front desk and Ms. Trici.
-Brooke Ritt
This class is designed for players looking to improve their mental
toughness and physical fitness. Instruction will focus on developing the playbookthis is my
individual player’s skill sets in different areas needed to succeed on WINTER/SPRING | 2019
the court. Sessions with an asterisk (*): Join anytime during a session
(fee will be pro-rated). Supplies: Participants will need to bring a
tennis racket and plenty of water. Attire: Comfortable clothing and tennis
shoes. Instructor: Josef Vondra. Location: Adams Park Tennis Courts.
Code Age(s) Day(s) Date(s) Time Sessions Fee Res/Non-Res
41380.001 15 & up Tu 1/8-2/5 7:00pm-8:00pm 5 $49/$64
41380.003* 15 & up Tu 1/8-3/19 7:00pm-8:00pm 10 $89/$109
Tu 2/12-3/19 7:00pm-8:00pm 5 $49/$64
41380.002 15 & up Tu 2/12-4/30 7:00pm-8:00pm 10 $89/$109
41380.005 15 & up
I AM
KENNESAW PARKS & REC
registration
information & policies
All City of Kennesaw Parks & Recreation activities are open to the public.
We offer two convenient ways to register for activities:
INTERNET: Register online 24 hours a day, seven INTERNET IN PERSON IN PERSON: Drop off your completed registration
days a week at www.kennesawparksandrec.com. form and payment at the Ben Robertson Community
It’s fast, easy, convenient, environmentally-friendly Center, 2753 Watts Drive. Our regular office hours
and free (no online transaction fees). We only are Monday-Friday, 8:00am to 5:00pm. We accept
accept credit card payments over the Internet. cashier’s checks, money orders and credit card
payments in person.
REGISTRATION INFORMATION • In lieu of a refund, you may request a Resident vs. Non-Resident
Activity fees are due at time of registration. credit to your account which may be used • You are a considered a city resident
Cashier checks or money orders should be by any immediate family member towards
made payable to the “City of Kennesaw”. registration for another activity offered by if you live within the incorporated city
Visa®, American Express®,and Mastercard® the City of Kennesaw Parks & Recreation limits of Kennesaw.
credit cards are accepted. Cash or checks Department.
are not accepted. • You are considered a non-resident if you
The City of Kennesaw Parks & Recreation live outside the incorporated city limits of
Age Requirements Department reserves the right to cancel, Kennesaw. A Kennesaw postal address does
Age requirements have been established to postpone or modify programs and activities due not, in itself, determine residency.
safely facilitate age-appropriate activities. to weather conditions, insufficient enrollment
Participants must be the appropriate age by or other unforeseen circumstances. • Non-resident user fees are $20 per activity,
the first day of the activity in order to register. or $15 if the activity is one month or less in
If you withdraw from an activity: duration. Non-resident user fees are not
Priority Registration • For class cancellations, your registration fees assessed for one-day workshops.
Two (2) weeks advance registration is
offered to Kennesaw city residents before less a $5 cancellation fee will be refunded for • Non-resident participants who are
registration is open to non-residents. Priority all requests received prior to the start of the 65 years or older are exempt from paying
Registration for Kennesaw City residents second class. No refunds will be given after non-resident user fees. To receive this
begins November 30. Registration for the start of the second class. exemption, registration must be made in
non-residents begins December 14. person at the Ben Robertson Community
• For workshop cancellations, your registration Center. Proof of age is required at time
Registration Deadline fees less a $5 cancellation fee will be of registration.
Registration is accepted on a first-come, refunded for all requests received prior
first-serve basis until the maximum number of to the start of the workshop. No refunds Inclement Weather Policy
participants is reached, or seven days prior to will be given after workshop concludes. If inclement weather is forecast, outdoor
the first activity date, unless otherwise stated. activities may be canceled. Please call the
• For camp cancellations, your registration fees City of Kennesaw Parks & Recreation
Inclusion less a $30 cancellation fee will be refunded Department at (770) 422-9714 or visit
The City of Kennesaw Parks & Recreation for all requests received prior to the start of a www.kennesawparksandrec.com for updates.
Department is committed to making all of camp (unless otherwise noted in the individual
our programs, facilities and services accessible camp description). No refunds will be given When Cobb County public schools are
to everyone. If you feel that you or your after the start of a camp. closed due to inclement weather, all City of
child may require auxiliary aid or special Kennesaw Parks & Recreation Department
accommodations in order to participate, please • Failure to attend an activity does not entitle activities will be canceled. Most major media
let us know at the time of registration. We the participant to transfer, make up or receive sites are notified of Cobb County School
will work with you in order to make safe and a refund. District closings.
respectful accommodations.
• Refunds are issued to the credit card Emergency Cancellations
POLICIES charged. Please allow up to 5-7 business If an activity is unexpectedly canceled due to
If we cancel an activity: days for processing. an emergency, the instructor will make every
• R egistration fees are refundable if the City effort to contact participants and reschedule
• In lieu of a refund, you may request a the activity.
of Kennesaw Parks & Recreation credit to your account which may be used
Department cancels an activity. Refunds by any immediate family member towards
are issued to the credit card charged. Please registration for another activity offered by
allow up to 5-7 business days for processing. the City of Kennesaw Parks & Recreation
Department.
22
reacgtiviitsy tration form WINTER 2019
SPRING
Registration is accepted on a first-come, first-serve Drop off your completed Questions?
basis until the maximum number of participants is registration form and payment to:
reached, or seven days prior to the first activity date,
unless otherwise stated. Registration for Kennesaw
City residents begins November 30. Registration for
non-residents begins December 14.
Please complete one form for each individual participant. All sections of this form must be completed.
Title of Activity Activity Code Start Date Time Fee*
Total Amount Due
Waiver of Liability
Participant, parent or legal guardian signature (required): ____________________________________________________ Today’s Date: ________________________________
Staff Signature: __________________________________________________________________________________________ Receipt Number: ______________________________________________________
speceivaelnt City of Kennesaw
Parks & Recreation Department
2753 Watts Drive
Kennesaw, GA 30144
www.kennesawparksandrec.com
VLailegnhtiAntesc’!stDCiaoanncme!Pearrtay:!
SAT, FEB 9 | 6pm - 9pm
Good evening ladies and gentlemen, may I have your attention please? Join us in
Hollywood for a Night at the Movies! Step into the spotlight and dance the night
away! That’s right, nobody puts baby in a corner! Guests will be in awe as the Ben
Robertson Community Center’s Banquet Hall is transformed into a dazzling
and dreamy set of a movie premiere filled with popcorn, music and laughter.
Spend the evening with your biggest fans experiencing the sights and sounds
of the red carpet. Feast, play and dance the night away to all of your favorite
tunes spun by a professional DJ.This family-friendly event will feature an
“all-you-care-to-eat” dinner and dessert bar, as well as plenty of memorable
photo opportunities.
All adults must be accompanied by a child and all small children must
be accompanied by an adult. Seating will be open; however tables will be
reserved for parties of six or more.Tickets are only $15 per person and
can be purchased online at www.kennesawparksandrec.com or at the
Ben Robertson Community Center. Advance purchase is required.
Tickets are non-refundable after February 1.
BEN ROBERTSON COMMUNITY CENTER