Preventives
Tongue Cleaners
Tongue Cleaner
Plasdent
Plastic Tougue Cleaners, Assorted Colors.
48 per Pack ........... (SUN0200)..........$15.64
GUM 2-in-1 Tongue Cleaner Reach Advanced Design Firefly Hello Kitty
Sunstar Americas Dr. Fresh Dr. Fresh
GUM® Dual-Action Tongue Cleaner has Raised rubber ridges on handle for better This Hello Kitty® themed travel toothbrush
two ows of soft, sturdy bristles on one side control, tapered head, bi-level bristle design encourage any child to brush their teeth
and two rows of scalloped scrapers on the with polished, rounded ends. Tufted end anywhere they might be.
other. Both work together to gently dislodge, to access areas of the oral cavity that are Children’s - Soft - 48 Per Box
remove and clean the tongue of harmful difficult to reach. (DRF81005)....................................... $24.46
bacteria known to cause bad breath, tooth Adult - 72 per Box.............................. $51.90
decay and gum disease. Extra Soft Compact...................... (DRF7213) Oral-B CrossAction Pro-Flex
6 per Box .............. (SUN760)................$7.80 Soft Compact............................... (DRF7219)
Soft Full....................................... (DRF7212) Proctor & Gamble
Oral-B® CrossAction Pro-Flex Toothbrush
sides adjust to the unique contours of teeth
and gums to remove plaque and deliver an
outstanding, gentle clean.
Adult - 38 Soft - 72 Per Box
(P&G1112)......................................... $93.06
Tongue Cleaner Reach Barbie Kids Oral-B CrossAction Pro-Health
Vista Dental Dr. Fresh Proctor & Gamble
Multi - tier cleaning ridges enhance the REACH® Kids toothbrushes are designed to Oral-B® CrossAction Pro-Health®Toothbrush
removal of surface plaque and odor causing easily clean hard-to-reach places. Suitable for reaches the tight spaces where plaque builds
bacteria. Effectively treats halitosis. ages 6-12. and straight-bristle brushes struggle to reach.
(VIS309001)......................................... $.98 Children’s - Soft - 72 Per Box Wtih CrissCross® bristles you can atack
(DRF9583)......................................... $67.61 plaque with an optimal 16° cleaning angle
Toothbrushes and remove surface stains from teeth.
Firefly Star Wars Adult - 35 Soft - 12 per Box
Reach Total Care (P&G1110)......................................... $14.66
Dr. Fresh
Dr. Fresh This Star War™ themed travel toothbrush
Designed with multiple benefits to remove will encourage any child to brush their teeth
plaque deep between teeth and along the anywhere they might be.
gum line. Features floss - like bristles, ta- Children’s - Soft - 48 Per Box
pered head, angled neck design, ergonomic (DRF64005)....................................... $24.46
handle, and TOUCHPOINT grip for enhanced
control.
Adult Soft - 72 per Box
(DRF9223)......................................... $36.22
www.tricountydental.com | [email protected] 251
Preventives
Oral-B Indicator Gum Classic Gum Technique Complete Care
Proctor & Gamble Sunstar Americas Sunstar Americas
The Oral-B Indicator toothbrush has inno- The GUM® Classic troothbrush is a simple, The GUM® Technique®Complete Care
vative blue bristle to inform patients when straight forward toothbrush. When used toothbrush multi-level bristle clean between
their brush has lost its optimum effective- twice daily as part of an overall oral hygiene the teeth and below the gumline to remove
ness, reminding them it’s time to change regimen that includes between-teeth clean- plaque for a complete clean.
their toothbrush. Polished, end-rounded bris- ing, the GUM® Classic toothbrush will help Adult - 12 per Box.............................. $12.25
tles effectively clean along the gumline. Oval you take good care of your dental health. Soft Full....................................... (SUN590P)
brush head enables access to posterior teeth. Adult - 12 per Box.............................. $10.74 Soft Compact............................... (SUN591P)
12 per Box......................................... $12.25 Soft............................................. (SUN411P)
30 Soft.........................................(P&G1108) Soft Compact............................... (SUN409P)
35 Soft.........................................(P&G1109) Soft Slender................................. (SUN311P)
35 Extra Soft................................(P&G1111) Small Head Soft........................... (SUN407P)
Oral-B Advantage Control Grip Gum Micro Tip Gum Technique Deep Clean
Proctor & Gamble Sunstar Americas Sunstar Americas
Oral-B®Advantage™ Control Grip toothbrush The GUM® Micro Tip® Toothbrush is de- The GUM® Technique®Deep Clean tooth-
uses Action Cup® Bristles contour to each signed for patients who brush too hard, or brush has unique tapered bristles that pen-
tooth’s unique surface. have gingival recession or sensitivity. etrate deeply between teeth and below the
12 per Box......................................... $13.23 Adult - 12 per Box.............................. $10.74 gumline to remove plaque and help achieve
30 Soft.........................................(P&G1113) Soft Full....................................... (SUN470P) better gum health.
35 Soft.........................................(P&G1116) Soft Compact............................... (SUN471P) Adult - 12 per Box.............................. $12.25
Sensitive Full............................... (SUN474P) Soft Full....................................... (SUN524P)
Sensitive Compact....................... (SUN475P) Soft Compact............................... (SUN525P)
Extra Soft Compact......................(SUN527P)
Gum Dome Trim Gum Technique Gum Technique Sensitive Care
Sunstar Americas Sunstar Americas Sunstar Americas
GUM® Dome Trim®Toothbrush has a unique, The GUM® Technique®Classic Toothbrush This premium toothbrush features unique,
raised- center Dome Trim® bristles to clean has a patented Quad-Grip® handle that helps extremely tapered bristles along with con-
below the gumline where periodontal dis- position the brush at the proper 45° angle for vention bristle ends arranged in a bi-level
ease starts. optimal subgingival cleaning. pattern and a patented Quad-Grip® thumb
12 per Box......................................... $10.74 Adult - 12 per Box.............................. $10.74 pad design to help guide the hand to hold
Soft Full....................................... (SUN456P) Soft Full....................................... (SUN490P) the brush at 45 degrees in all quadrants of
Soft Compact............................... (SUN457P) Soft Compact............................... (SUN491P) the mouth.
Sensitive Compact....................... (SUN459P) Sensitive Full............................... (SUN494P) Adult - 12 per Box.............................. $12.25
Sensitive Compact....................... (SUN495P) Soft Full....................................... (SUN516P)
Ultrasoft Youth............................(SUN221P) Soft Compact............................... (SUN517P)
252 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Gum Summit + Gum Crayola Timer Light Gum Monsterz
Sunstar Americas Sunstar Americas Sunstar Americas
The GUM® + Toothbrushes have the upper Colorful LED lights flash for 60 second Features fun, friendly monster design to
6mm of the bristle tapered to a round- intervals to help kids brush longer. Longer engage children. Suction cup base holds the
ed .01mm end, which cleans 2.8mm into brushing leads to more plaque removal and brush upright when not in use, to keep bris-
the sulcus, along the gingival margin and a healthy smile. Suction-cup base reduces tles clean. Comfortable Dome Trim® bristles
interproximally to remove plaque and other counter clutter and helps keep bristles clean- gently remove plaque, dislodge food and
bacteria. er. Available in flour assorted toothbrush message gums. Assortment of color: black,
Adult - 12 per Box.............................. $12.25 colors. blue, pink, purple.
Soft Compact............................... (SUN505P) 12 per Box ............ (SUN202R)..........$23.48 12 per Box .......................................$10.74
Sensitive Compact....................... (SUN509P) Kids........................................... (SUN901A)
Junior (Ages 5+)......................... (SUN902A)
Toothbrush Bundles
Gum Super Tip Gum Dragons Suction Cup Crest + Oral-B
Basic Solution Bundle
Sunstar Americas Sunstar Americas
The GUM® Super Tip® Toothbrush has a Dome Trim® bristle design is clinically proven Procter & Gamble
unique multi-level trim design that removes to clean below the gumline. Tongue cleaner Basic Solution comes with toothbrush, tooth-
plaque effectively from distals of molars, on back of brush head gently removes bac- paste, floss, and free patient bags, shipped
interproximal and subgingival surfaces and teria and promotes fresh breath. Ergonomic together. Valued-priced for everyday clean.
other hard-to-reach areas. handle design makes it easy for small hands 144 per Case ..... (P&G3102).......... $127.36*
Adult - 12 per Box.............................. $10.74 to hold. Suction cup base holds the tooth-
Soft Full....................................... (SUN460P) brush upright which helps keep bristles clean Contains: 144 of each: Oral-B Indicator
Soft Compact............................... (SUN461P) and reduces clutter on the counter. Toothbrush (35 soft), Crest 3D White Brilliance Toothpaste
Sensitive Full............................... (SUN464P) 12 per Box ............ (SUN4060)..........$10.74 (.85oz), Oral-B Glide PRO-HEALTH Original Floss (4m), &
Sensitive Compact....................... (SUN465P) Patient Bags.
Sensitive Subcompact..................(SUN468P)
Gum Crayola Pip-Squeaks Gum Lalaloopsy Suction Cup CCrleeastn+SoOlruatli-oBnDBauilnydle
Sunstar Americas Sunstar Americas Procter & Gamble
Specially designed for teaching and encour- The unique Dome Trim® bristle design Oral-B® Daily Clean solution bundles allow
aging healthy brushing habits for a lifetime has raised center bristles that have been patients to raise the bar on their daily
of good oral health. Childsized to fit small trimmed to form a dome shape that provides brushing. The Oral-B® toothbrush removes
mouths. Extra soft bristles provide gentle, great contact with the tooth surface and significantly more plaque, and the tooth-
effective cleaning. reaches underneath the gumline. paste protects against caries and whitens
Adult - 12 per Box (SUN232R)............ $10.74 12 per Box ............ (SUN4070)............ $8.04 teeth by gently removing surface stains and
freshens breath.
Gum Crayola Suction Cup 72 per Case ....... (P&G3105)............ $66.60* *Case goods freight charges applies
Sunstar Americas Contains: 72 of each: Oral-B Advantage Deep Clean 35
The GUM Crayola Marker toothbrush is a Toothbrush, Crest 3D White Brilliance Toothpaste (.85 oz),
colorful way to get children excited about Oral-B Glide Deep Clean Trial Floss 4m, & Patient Bags.
building healthy oral care habits early!
12 per Box ............ (SUN227P)........... $10.74
www.tricountydental.com | [email protected] 253
Preventives
Toothbrush Bundles
GCriensgtiv+itOisral-B CWrehsitte+nOinrgal-B Crest + Oral-B
Solution Bundle Solution Bundle Kids Solution Bundle
Procter & Gamble Procter & Gamble Procter & Gamble
Pro-Health Gingivitis Solution comes with The Oral-B Whitening Solution Manual Bun- Kids Solution comes with toothbrush, tooth-
toothbrush, toothpaste, floss, rinse, and free dle is designed to work together to help you paste, floss, and free patient bags, shipped
patient bags, shipped together. Helps reverse give patients the benefit of a comprehensive together. Gives young patients a magical
gingivitis in as little as 2 weeks. whitening routine. Removes surface stains start to brushing. Designed specifically for
72 per Case ....... (P&G3117)............ $78.36* for a naturally whiter, brighter smile! kids age 5-7.
72 per Case ....... (P&G3126)............ $66.60* 72 per Case ....... (P&G3108)............ $68.56*
Contains: 72 of each: Oral-B PRO-HEALTH All-in-One
Toothbrush (35 soft), Crest PRO-HEALTH Advanced Extra Contains: 72 of each: Oral-B Complete 3D White Vivid Contains: 72 of each: Oral-B Stage 3 Toothbrush, Kids Crest
Gum Protection Toothpaste (.85 oz), Oral-B Glide PRO- Toothbrush (35 Soft), Crest 3D White Brilliance Toothpaste
HEALTH Clinical Protection Floss (4m), 96 Crest Pro-Health (.85oz), Oral-B Glide PRO-HEALTH Deep Clean Floss (4m), Cavity Protection Sparkle Fun .85 oz Toothpaste, Glide Origi-
Mouthwash, & Patient Bags.. & Patient Bags.
nal 4M Floss, & Patient Bags.
*Case goods freight charges applies Crest + Oral-B Crest + Oral-B Crest + Oral-B
Sensitive PSorolu-HtieoanltBhuFnodrleMe KSoidlustSiotangBesun2d-4le
Solution Bundle
Procter & Gamble Procter & Gamble
Procter & Gamble Made for children 8+, that in-between age Oral-B Crest Kids Stages 2-4 Manual Bundle
Sensitive Solution comes with toothbrush, where the cute children’s toothpaste are not let kids express themselves and rock the
toothpaste, floss, and free patient bags, “cool” anymore but adult toothpastes are ultimate smile. All Oral-B manual solutions
shipped together. Helps with sensitivity pro- too strong. include sample bags with retail coupons. For
tection and guard against enamel loss. 72 per Case ....... (P&G3114)............ $68.56* kids aged 2-4.
72 per Case ....... (P&G3111)............ $68.56*
72 per Case ....... (P&G3126)............ $66.60* Contains: 72 of each: Oral-B Pro-Health For Me toothbrush .85
Contains: 72 of each: Oral-B PROHEALTH Stages Toothbrush
Contains: 72 of each: Oral-B Complete Senitive Toothbrush oz Crest Pro-Health Jr. Frozen Toothpaste, 4m Oral-B Glide featuring Mickey and Minnie Mouse character graphics, Kid’s
Crest Cavity Protection Toothpaste (.85 oz), Oral-B Glide
(35 x-soft), Crest Sensi-Repair & Prevent Toothpaste (.85 oz), Pro-Health Original Floss, & Kids Sample Bag with Coupons. PRO-HEALTH Original Floss (4m), & Patient Bags.
Oral-B Glide PRO-HEALTH Advanced Floss (4m), & Patient
Bags.
254 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Single-Use Toothbrushes Electric Toothbrushes
Happy Morning Oral-B Genius Oral-B
Disposable Toothbrush BGuinngdivleitSisyPstoewmer 1000 Daily Clean
Power Bundle
Hager Worldwide Procter & Gamble
Hygenic, individually sealed. Ideal for patient The Oral-B® Genius™ Gingivitis System pro- Procter & Gamble
use before treatment. Each box includes vides patients with a regimen for protecting The Crest® Oral-B® Daily Clean Power Bundle
an information display card for the waiting against plaque bacteria and improving gingi- conveniently provides patients with the tools
room. val health. This system features the Oral-B® they need to maintain good oral hygiene.
Without Toothpaste Genius™ power toothbrush with Bluetooth® 3 per Case ......... (P&G1977)........... $127.36
100 per Box ...... (HAG605403)..........$34.26 capabilities.
With Mint Toothpaste 3 per Case ......... (P&G1554).......... $225.36 Contains: 3 bundles, each bundle contains: 1 Oral-B PRO
100 per Box ...... (HAG605401)..........$34.26 1000 white handle power toothbrush, 1 (3.3 oz) Crest
With Xylitol Mint Toothpaste Contains: 3 bundles, each bundle contains: 1 Oral-B Genius PRO-HEALTH Clean Mint toothpaste, 1 (500 ml) Crest PRO-
50 per Box ........ (HAG605496)..........$18.58 power toothbrush with Bluetooth, 1 (3.5 oz) Crest PRO- HEALTH™ Advanced with Extra Deep Clean mouthwash,
HEALTH Advanced Extra Gum Protection toothpaste, 1 (15m) 1 (15m) Oral-B Glide PRO HEALTH Advanced floss, 1
Specialty Toothbrushes Oral-B Glide PRO-HEALTH Advanced floss, 1 (250 ml) Crest CrossAction refill head.
PRO-HEALTH Multi Protection rinse and 4 toothbrush heads,
1 of each: CrossAction, FlossAction, Interproximal Clean and
Sensitive Gum Care.
Gum Denture Brush Oral-B Oral-B
PWrohiPteonwinegr BSyusntdelme SGeennsiiutisvPitoywSeyrstBeumndle
Sunstar Americas
The GUM® Denture brush is recommended Procter & Gamble Procter & Gamble
by dental professionals for the daily care of Oral-B Professional Health Clean + Gum Care The Crest® Genius® Sensitivity System was
removable dentures and acrylic retainers. Provides dentist-inspired cupping action in designed with patients who suffer from
Firm, flat nylon bristles clean denture surfac- which a unique, round brush head sorrounds sensitivity in mind. The system features the
es, while tapered bristles clean hard-to-reach each tooth for a tooth-by-tooth clean. Oral-B®Genius™ power toothbrush with
places. 3 per Case ......... (P&G1551)........... $225.36 Bluetooth® capabilities.
12 per Box ........ (SUN201)................$15.64 3 per Case ......... (P&G1558)........... $225.36
Contains: 3 bundles, each bundle contains: 1 Oral-B PRO
3000 SmartSeries power toothbrush with Bluetooth technology Contains: 3 bundles, each bundle contains: 1 Oral-B Genius
and Oral-B app, 3 brush heads, 1 of each: CrossAction, ProW- power toothbrush, 1(3.5 oz) Crest Sensi-Repair and Prevent
hite™ and Deep Sweep™; 1 (4.1 oz) Crest 3D White Brilliane Smooth Mint toothpaste, 1 (15m) Oral-B Glide Pro-Health
toothpaste; 14 crest 3D White Whitestrips Professional Advanced floss, 1 (500ml) Crest Moistureizing oral rinse, and
Supreme with Advanced Seal; 1 (473ml) Crest 3D White Luxe 4 brush head refills, 1 of each: CrossAction, FlossAction,
Diamond Strong mouthwash. Interproximal Clean, Sensitive Gum Care.
www.tricountydental.com | [email protected] 255
Preventives Toothpaste
Electric Toothbrushes
Oral-B Sensonic SR-3000W Professional Crest Pro-Health Advanced Extra
Genius Power Bundle Toothbrush Gum Protection
Ortho Essential System
Waterpik Procter & Gamble
Procter & Gamble Waterpik®Sensonic®Professional Plus tooth- Crest PRO-HEALTH Advanced Toothpaste is
The Oral-B®Genius™Ortho Essential System brush provides state-of-the-art sonic tech- formulated with stabilized stannous flouride
is designed specifically for ortho patients, nology, its bristle tip speed is 25% faster than to significantly improve gingival health. It has
in an effort to provide all of the necessary Soniccare® FlexCare. Clinical research con- the highest level of antibacterial action pro-
tools for maintaining good oral hygiene while firms that the Sensonic Professional Plus is vided from Crest PRO-HEALTH Toothpaste.
in orthodontics. The system features the up to 29% more effective at removing plaque Plus, it is clinically proven to help reverse
Oral-B® Genius™ power toothbrush with and up to 26% more effective at improving gingivitis in 4 weeks.
Bluetooth® capabilities. gum health than Sonicare®FlexCare. The 0.85 oz. Tubes - Smooth Mint
3 per Case ......... (P&G1556)............. $225.36 advanced brush head design, with extra-soft, 36 per Case ....... (P&G1167)............... $11.72
end-rounded bristles, gently targets those
Contains: 3 bundles, each bundle contains: 1 Oral-B Genius hard to reach areas bwtween teeth. Crest Cavity Protection
power toothbrush with Bluetooth, 1 (3.3 oz) Crest Pro-
HEALTH™ Clean Mint Toothpaste, 1 (50ct) Oral-B Superfloss Without Toothpaste Procter & Gamble
Mint, 1 (500 ml) Crest PRO-HEALTH Tarter Protection Rinse, Crest® Cavity Protection toothpaste helps
and 2 refill heads: 2 Ortho and 1 Interproximal Clean. (WATGum Star Wars Light fight cavities, strengthen weak spots and
Saber Toothbrushes)............... $49.49 freshen breath with a wintergreen flavor.
0.85 oz. Tubes - Wintergreen Mint
Contains: Sensonic Professional toothbrush, Standard Brush 72 per Case ....... (P&G1131)............... $22.50
Head, Compact Brush Head, & Interdental Brush Head.
Replacement Standard Head
(WAT20016397) 3/Pk......................... $13.49
Replacement Compact Head
(WAT20016398) 3/Pk........................ $13.49
Gum Star Wars Light Crest 3D White Brilliance
Saber Toothbrushes
Procter & Gamble
Sunstar Americas Crest 3D White is an enamel safe flouride
Sunstar GUM® Star Wars light saber tooth- toothpaste to help prevent caries and
brushes flash for 1 minute to encourage strengthen enamel. Crest 3D White Tooth-
longer brushing and features soft, interden- paste removes up to 95% of surface stains in
tal bristles that clean between the teeth. 3 days and protects against future stains.
There is a unique light saber deisng for each 0.85 oz. Tubes - Vibrant Peppermint
character: Anakin Skywalker, Darth Vader, 72 per Case ....... (P&G1122)............... $22.50
and Yoda. 4.1 oz. Tubes - Vibrant Peppermint
12 per Case ....... (SUN4030P)............. $29.49 24 per Case ....... (P&G1125)............... $63.66
256 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Toothpaste Preventives
Fluoride Gels & Foams
Crest Kid’s Cavity Protection Gum Crayola Squeeze-A-Color Kolorz APF Flouride Gel
Sparkle Fun
Sunstar Americas DMG America
Procter & Gamble GUM Crayola Squeeze-a-color Toothpaste is a Developed in consultation with food industry
Crest® Kid’s Cavity Protection Sparkle Fun child tested, mom approved toothpaste that experts. Acidulated Phosphate formula con-
Toothpaste provides proven protection makes it fun for kids to brush their teeth! tains 1.24% Flouride ion. Thixotropic formula
against cavitis with fun color, sparkles and a One box contains three child friendly tubes will not run. Contains NO Aspartame- No Sac-
bubblegum flavor that encourage children to (1.5 oz. each). Each non-staining color has its charin. Contains Xylitol and natural non-ca-
brush. Paste also includes clinically proven own unique flavor - Blueberry Blast (blue), loric sweeteners. Gluten Free.
Fluoristat® that’s gentle on tooth enamel. Melon Blast (red) and Jazzy Apple (green). 16 oz................................................. $29.36
0.85 oz. Tubes - Sparkle Fun The small nozzle cap design of each tube Mint....................................... (DMG777301)
72 per Case ....... (P&G1134)............... $22.50 empowers kids to get creative by mixing Cotton Candy..........................(DMG777303)
and matching the colors and flavors, while Pina Colada............................(DMG777305)
helping to reduce toothpaste messes fleft on Cherry.................................... (DMG777302)
the bathroom counter. Raspberry............................... (DMG777304)
3 per Box .......... (SUN4050R)................$3.92
Crest Pro-Health For Me Kolorz APF Foam Fluoride
Procter & Gamble DMG America
Crest Pro-Health For Me Flouride Anticavity Dental hygiene never tasted so great! Patients
Toothpaste is a toothpaste designed for kids. love the smooth foam consistency of Kolorz
It helps prevent cavities and freshens bad Sixty Second Flouride Foam. Contians non-ca-
breath - all with a light herbal mint flavor loric natural sweeteners, and XYLITOL. Comes
and cool packaging kids will love. Crest Pro- in 4 great-tasting Kolorz flavros!
Health For Me Flouride Anticavity Toothpaste
protects against tooth enamel loss with 4.4 oz...........................................$34.26
the power of fluoride, fights cavities and
strengthens enamel. Mint................................. (DMG766201)
0.85 oz. Tubes - Minty Breeze Cotton Candy....................(DMG766203)
72 per Case ....... (P&G1136)............... $22.05 Cherry.............................. (DMG766202)
Raspberry......................... (DMG766204)
2% Neutral Sodium Mint..(DMG766205)
www.tricountydental.com | [email protected] 257
Preventives
Denti-Care 60 Second Taste Topex 60 Second
APF Flouride Gel APF Fouride Gel Fluoride Gel
Medicom Pascal Sultan Healthcare
Optimized Patient comfort with reduced 60 Second Taste® Flouride Gel is an in-office Topex®APF Flouride Gel is a 1.23% flouride
gagging and excessive salivation. Save time flouride treatment with an APF (Acidulated ion APF topical gel that only needs a 60-sec-
and money with an express 60 second Phosphate Flouride) containing 1.23% flou- ond application time. The thixotropic formula
application. Fast acting results due to low ride ion at pH 3.5. The gel flows easily during liquifies when tray is placed on teeth and re-
pH delivering high fluoride content. Aspar- placement with no pleasant after-flow. turns to gel once the tray is seated, reducing
tame-Free. 16 oz................................................. $16.62 gagging and ingestion.
16 oz................................................. $19.56 Mint........................................... (PAS10030) 16 oz................................................. $27.40
Mint........................................... (MED6018) Strawberry................................. (PAS10040) Mint........................................... (SUL31112)
Strawberry................................. (MED6033) Grape......................................... (PAS10025) Creamsicle.................................. (SUL31117)
Grape......................................... (MED6015) Marshmellow............................. (PAS10027) Cherry........................................ (SUL31111)
Raspberry................................... (MED6027) Bubble Gum............................... (PAS10020)
Bubble Gum............................... (MED6004) Orange Twist.............................. (PAS10022)
Cherry........................................ (MED6011)
Orange....................................... (MED6022)
Denti-Care Puff Foam Flouride TFoopamex F6l0uoSreicdoend
APF Foam Fluoride
Pascal Sultan Healthcare
Medicom PUFF®Foam 1.23% Topical Acidulated Pleasant tasting flavors eliminates patient
Optimized Patient comfort with reduced Phosphate Flouride Foam Topical Office apprehension. Light consistency remains in
gagging and excessive salivation. Save time Treatment has a unique nonaerosol delivery tray under bite pressure; eliminates patient
and money with an express 60 second system that provides better control and less gagging. Topex 60 Second Treatment is easi-
application. Fast acting results due to low waste along with minimal hazards to the en- er, faster and more pleasant for patients.
pH delivering high fluoride content. Aspar- vironment and dental staff often associated 4.4 oz................................................ $33.28
tame-Free. with aerosol foam. Mint........................................... (SUL31151)
4.4 oz................................................ $22.50 7.4 oz................................................ $25.44 Bubble-Fun................................. (SUL31152)
Mint........................................... (MED5017) Cotton Candy.............................. (PAS10300) Orange Dream............................ (SUL31154)
Strawberry................................. (MED5033) Very Berry.................................. (PAS10330) Strawberry................................. (SUL31150)
Grape......................................... (MED5013) Peppy Mint................................. (PAS10310) Grape......................................... (SUL31153)
Raspberry................................... (MED5025) 2% Neutral - Mixed Berry................... $33.28
Bubble Gum............................... (MED5001) 4.4 oz......................................... (SUL31165)
Orange....................................... (MED5020)
258 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Fluoride Varnishes
Topex Dual Arch Trays 60:60 Rinse Fluorodose 5%
Fluoride Varnish
Sultan Healthcare Pascal
Topex®Dual-Arch Disposable Flouride Tray A concentrated in-office fluoride treatment Centrix Inc.
are impression trays that offer detailed oc- two part sstem of stannous fluoride (1.64%) Clinicians love that FluoroDose is smooth,
clusal anatomy on the biting surface, forcing and APF (0.31%) fluoride ion solution. AFP not stringy or clumpy, so it reduces the
gel to contact interproximal regions for total solution 0.31% flouride ion, 1.64% stannous chance of clogging vacuum lines. Patients
vertical coverage. fluoride concentrate. 4-to-1 mixure provided love that it stays clear so there is not tooth
50 per Package.................................. $35.24 by metered pumps. Kits makes 256 patient discoloration.FluoroDose dries in seconds
Pedo (Aqua)............................... (SUL32010) treatments. Prevents the need for gel trays - upon contact with saliva and remains on the
Small (Yellow)............................. (SUL32011) patient simply swishes and expectorates. tooth for 6 to 8 hours for optimum fluoride
Medium (White)......................... (SUL32012) Complete Kit..................................$156.76*
Large (Blue)................................ (SUL32013) Mint........................................... (PAS11400) •u pPtaatkiee.nts love the taste and feel of Fluoro-
Bubble Gum............................... (PAS11360) • DUonsite-dose delivery allows for ease of use
In-Office Rinses ••• aRD5n%eridmesscaoliidenniasusnmoeucnpofltnuhdoesrtiudopeoot(hnNfacoFor)n6otartco2t28w,6hit0oh0usrpasplimva
Contains: 4 - 64oz (1.89L) Part A (APF Solution), 1 - 64oz
Denti-Rinse 2% Neutral Sodium (1.89L) Part B (Stannous Flouride), 2 - Metered Pump Dis- of fluoride
Fluoride Rinse pensers, 1 - Graduated Mixing Vial & Instructions. Unit Dose - .30mL
Medicom 120 per Box..................................... $117.56
Delivers dependable, effective performance
with a 2 minute application time (60 second Mint.........................................(CEN360086)
rinse x 2). Rinse is an easy-to-use and cost ef- Bubble-Gum.............................(CEN360087)
fective alternative to fluoride trays. Pro-Rinse Caramel....................................(CEN360137)
2% Neutral Sodium fluoride Rinse is also Melon......................................(CEN360107)
ideal for patients who have an intolerance to Cherry......................................(CEN360110)
trays and prefer an oral rinse. Dye-free. Bulk Pack Unit Dose - .30mL
64 oz................................................ $39.16*
Mint................................. (MED10044MUN) 600 per Box..................................... $489.96
Berry................................. (MED10044BUN)
Mint.........................................(CEN360078)
Bubble-Gum.............................(CEN360077) *Case goods freight charges applies
Caramel....................................(CEN360138)
Melon......................................(CEN360108)
Cherry......................................(CEN360111)
Super Bulk Pack Unit Dose - .30mL
1,200 per Box.................................. $881.96
Mint.........................................(CEN360105)
Bubble-Gum.............................(CEN360106)
Caramel....................................(CEN360139)
Melon......................................(CEN360109)
Cherry......................................(CEN360112)
www.tricountydental.com | [email protected] 259
Preventives
ProGuard 5% SZooodbiuym5%Fluoride Varnish Duraflor Halo 5%
Fluoride Varnish Fluoride Varnish
Denticator
Crosstex 5% sodium fluoride white varnish used for Medicom
ProGuard™ Varnish was designed with the treatment of hypersensitive dentin. The Lead the fight against caries and treat
needs of the patient and professional in saliva-tolerant formulation allows for easy hypersensitive teeth with Medicom Duraflor
mind. Pleasant flavors, visually clear formula, application and adherence to moist teeth. Halo 5% white sodium fluoride varnish.
quick application, and efficient and effective Dries clear and smooth. Gluten-free. This fluoride application dries to a natural
desensitization meet all of your patients’ Unit Dose white color to ensure patient compliance
needs. 50 per Box......................................... $63.66 and provides the hightest allowable fluoride
Unit Dose Grape...................................... (YOU295712) concentration for the ideal solution to
50 per Box......................................... $74.42 Melon..................................... (YOU295713) prevent and protect against cavities.
Mint........................................ (CROUFVPM) Unit Dose - .50 mL
Melon................................... (CROUFVPML) 32 per Box......................................... $54.84
Spearmint............ (MED1015SM32)
Wild Berry............(MED1015WB32)
Melon Mint..........(MED1015MM32)
Bulk Pack Unit Dose - .50 mL
250 per Box..................................... $323.36
Spearmint............ (MED1015SM250)
Wild Berry............(MED1015WB250)
Melon Mint..........(MED1015MM250)
Kolorz MI Varnish
Clearshield 5% Fluoride Varnish
GC America
DMG America GC America MI Vanish with Recaldent,
No more ugly, yellow teeth! Kolorz ClearSh- is a topical fluoride varnish with calcium
ield 5% Sodium Fluoride Varnish goes on and phosphate. It is used for treatment of
clear, with no embarrasing discoloration. patients with dentinal hypersensitivity. MI
ClearShield’s patient loving watermelon, Varnish with Recaldent, brings bioavailable
bubblegum, mint, cookie dough and caramel calcium, phosphate and fluoride to the tooth
flavors, make treatment a treat both adults surface releasing high levels of fluoride -
and children alike. working in concert with the sodium fluoride
Unit Dose - .40mL in the MI Varnish is a wiser clinical choice
35 per Box......................................... $47.00 for you and your patients. MI Varnish has
Watermelon........................... (DMG799501) excellent translucency and remains on the
Cookie Dough.........................(DMG799512) tooth surface longer than conventional
Caramel.................................. (DMG799516) fluoride varnishes.
Bubblegum............................. (DMG799503) Unit Dose - .50mL
Mint....................................... (DMG799506) 50 per Box....................................... $100.90
Bulk Pack Unit Dose - .40mL Strawberry.............................. (GCA004274)
200 per Box..................................... $235.16 Fresh Mint............................... (GCA005265)
Watermelon........................... (DMG799502)
Cookie Dough.........................(DMG799513)
Caramel.................................. (DMG799517)
Bubblegum............................. (DMG799504)
Mint....................................... (DMG799507)
260 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
DFluuroarfildoer V5%arnish E5n%aFmlueol rPirdoe Varnish Vella Varnish
Medicom Premier Dental Preventech
Highest concentration of fluoride available. Enamel Pro is a 5% sodium fluoride varnish Tired of lumps and clumps slowing down
Sets rapidly with contact to saliva. Clinically formulated to deliver ACP (Amorphous your varnish application? Try Vella, the 5%
proven to provide relief of hypersensitivity Calcium Phosphate). ACP stimulates rem- sodium fluoride varnish with Xylitol that
for up to 6 months. May be used as a cavity ineralization of tooth enamel and prevents goes on easier. With twice as many bristles,
liner. Sweetened with Xylitol. the loss of enamel. It desensitizes dentin by our brush applies more product faster. And
Tube - 10 mL Bubble Gum depositing ACP and fluoride into the tubules. our container is so sturdy, you can hold it
(MED10011)...................................... $24.46 ACP crystallizes and forms apatite, a tooth- closer to the mouth and wipe the brush tip
Unit Dose - .25 mL Bubble Gum like mineral. more easily. That means fewer trips to the
32 Per Box............ (MED3001)............ $37.20 Unit Dose - .40mL well, ensuring a smoother, less-messy, thin
200 per Box..........(MED3040).......... $161.66 35 per Box......................................... $58.76 layer application. With unsurpassed fluoride
Unit Dose - .40 mL Rasberry Strawberries n’ cream............ (PRE9007540) uptake!
32 Per Box............ (MED3003)............ $37.95 Bubblegum............................. (PRE9007541) Unit Dose - .50mL
200 per Box..........(MED3055).......... $161.66 Vanilla Mint............................ (PRE9007547) 35 per Box......................................... $60.72
Bulk Pack Unit Dose - .40mL Melon....................................(PREV770073)
200 per Box..................................... $293.96 Strawberry.............................(PREV770023)
Strawberries n’ cream............ (PRE9007543) Caramel..................................(PREV770145)
Bubblegum............................. (PRE9007544) Spearmint..............................(PREV770013)
Vanilla Mint............................ (PRE9007545) Bubblegum.............................(PREV770105)
Bulk Pack Unit Dose - .50mL
100 per Box..................................... $146.96
Melon....................................(PREV770083)
Strawberry.............................(PREV770043)
Caramel..................................(PREV770155)
Spearmint..............................(PREV770033)
Bubblegum.............................(PREV770115)
Embrace Varnish Tastytooth Flouride Varnish
Pulpdent Premier Dental
Embrace Varnish contains CXP “Xylito-coated Put a smile on your patient’s face with Tas-
Calcium and Phosphate for unsurpassed fluo- tyTooth varnish. Create a satisfying experi-
ride release”. The xylitol coating prevents the ence with our high-impact flavors, featuring
calcium and phosphate salts from reacting a blend of xylitol and surcralose. Our silky
until they come in contact with saliva. smooth formula is easy to apply, affordably
Tube - 12 mL designed and gluten-free.
(PULFVT)........................................... $25.44 100 per Box....................................... $88.16
Unit Dose - .40 mL Caramel.................................. (PRE9007580)
50 per Box............(PULFV50)............. $58.76 Melon.................................... (PRE9007581)
200 per Box..........(PULFV200)......... $215.56 Bubblegum............................. (PRE9007582)
www.tricountydental.com | [email protected] 261
Preventives
Home-Care Gels & Pastes
DuraShield CV USoltdriauTmhinFlu5o%ride Varnish MI Paste Plus
5% Sodium Varnish
Waterpik GC America
Sultan Healthcare Waterpik® UltraThin Fluoirde Varnish is a GC MI Paste Plus™ is a topical paste or
DuraShield® CV 5% Sodium Fluoride Clear 5% sodium fluoride varnish indicated for the creme with fluoride that helps strengthen
Varnish is a colorless varnish that provides treatment of dentinal hypersensitivity and as and rejuvenate teeth. It contains a product
optimal fluoride release in just 2 hours. It is a cavity varnish. In independent studies, Ul- that binds calcium and phosphate to the
a thin formula that applies smooth during traThin was shown to go on thinner and have tooth surfaces, plaque and surrounding
applcation with minimal mess. Offered in a superior fluoride release in the first critical soft tissue. It also contains RECALDENT™
flexible unit dose package with a variety of hours, as compared to the leading brand. (CPP-ACP), a special milk derived protein that
holding positions for a convenient applica- Unit Dose - .40 mL can help replace lost minerals in the teeth,
tion. Available in delicious Watermelon and 30 per Box ........................................ $56.80 making them stronger and protecting them
Strawberry flavors. Bubble Gum........................ (WAT20014133) from decay and erosion.
Unit Dose - .40 mL Strawberry.......................... (WAT20014135) 40 Gm Tubes
50 per Box......................................... $73.46 Melon................................. (WAT20011179) 10 per Box ...................................... $132.26
Watermelon............................... (SUL31103) Mint.................................... (WAT20014137) Mint........................................ (GCA422621)
Strawberry................................. (SUL31104) Bulk Pack Unit Dose - .40 mL Strawberry.............................. (GCA422886)
Bulk Pack Unit Dose - .40 mL 100 per Box .................................... $166.56 Vanilla..................................... (GCA422888)
200 per Box..................................... $244.99 Bubble Gum........................ (WAT20014134) Assorted.................................. (GCA422614)
Watermelon............................... (SUL31105) Strawberry.......................... (WAT20014136)
Strawberry................................. (SUL31106) Melon................................. (WAT20011180)
Mint.................................... (WAT20014138)
Assorted.............................. (WAT20014139)
5D%urSaoShdiieulmd CVVarnish MI Paste
Sultan Healthcare GC America
DuraShield® fluoride varnish has several GC MI Paste™ is a topical tooth creme
advantages over traditional fluoride treat- that helps strengthen and rejuvenate the
ments with speed, ease of use and range of patient’s teeth. The creme binds calcium and
application. With DuraShield there is no need phosphate to the tooth surfaces, plaque and
for a prophy before application. It sets on surrounding soft tissue.
contact with saliva and releases fluoride for 40 Gm Tubes
6-8 hours. 10 per Box ...................................... $132.26
Mint........................................ (GCA423679)
Assorted.................................. (GCA422265)
Strawberry.............................. (GCA424505)
Unit Dose - .40 mL - Bubble Fun
32 per Box............. (SUL31101) ......... $58.76
200 per Box........... (SUL31102) ....... $254.79
262 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Oral Rinse
NeutraGard Advanced TErneaamtmeleonntPGreelventative Chlorhexidine
CHG 0.12% Rinse
Pascal Premier Dental
NeutraGard® Advanced Gel is a 1.1% neutral Enamelon Preventative Treatment Gel (970 Xttrium Laboratories
sodium fluoride gel toothpaste with denti- ppm F) is the new standard of caring. A safe Xttrium’s generic 0.12% CHG Oral Rinse has
frice cleaning system that removes plaque and effective alternative to both 5000 ppm the same efficacy and active ingredient,
for a one-step brushing treatment and leaves fluoride toothpastes and remineralizing 0.12% Chlorhexidine Gluconate, as the
mouth fresh. Used once daily, it provides pastes, Enamelon helps to prevent caries, national brand and reference listed drug,
added protection from root caries, decay, gingivitis and treat sensitivity. Peridex®.
orthodontic decalcification and hypersensi- 4 oz Bottle......... (XTT2004)................. $3.43*
tivity. Treatment Gel - 4 oz. Tube Bubble Gum...... (XTT2000)................. $5.84*
2 oz. Tube.............................................$6.82
Winter Mint............................... (PAS11710) (PRE9007285).................................... $10.29
Mixed Berry.. .............................. (PAS11713) Toothpaste
4.3 oz Tube ....... (PRE9007280).......... $10.74
24 per Case ....... (PRE9007290).......... $68.56
Contains: 24 - .75 oz Enamelon toothpaste tubes.
NeutraGard 1.1% Topex Take Home Care Denti-Care Denti-Rinse 0.12%
Neutral Fluoride Chlorhexidine Rinse
Sultan Healthcare
Pascal Topex Take Home Care is ideal for car- Medicom
1.1% Neutral Sodium Fluoride Gel Neutral ies-prone, orthodontic, post-irradiation, and Denti-Care® Denti-Rinse 0.12% Chlorhexidine
pH: safe for porcelain crowns, bridges or hypersensitive patients and for individuals Gluconate Rinse is ideal for professional
composite restorations. with gingival recession. For use with tooth- use and in conjuction with home care for
2 oz. Tube.............................................$5.84 brush, therefore no messy trays or applica- gingivitis, periodontitis, oral irrigation and
Mint........................................... (PAS11715) tors. Alcohol-free and has no color additives. post-operative healing. Provides an extra
Tropical...................................... (PAS11718) 12 per Case........................................ $99.95 boost in the reduction of tissue inflammation
Bubble Gum............................... (SUL30210) bleeding and plaque accumulation.
Mint........................................... (SUL30212) 16.9 oz Bottle
Berry.......................................... (SUL30211) (MED10025)....................................... $7.80*
Contains: 12 - 4.3 oz home care gel tubes. *Case goods freight charges applies
www.tricountydental.com | [email protected] 263
Preventives
Gum Paroex CHX GPRuNmORrianlcRinionlse Listerine Mouthwash
Rinse Alcohol Free
Sunstar Americas Johnson & Johnson
Sunstar Americas Rincinol is a revolutionary new bio-adherent Helps prevent and reduce supragingival
Paroex is a alcohol-free, chlorhexidine rinse. mucosal coating for oral soft tissue pain and plaque accumulation and gingivitis when
Efficacy without the alcohol. Therapeutically aphthous ulcers. Does not numb or sting used in a conscientiously applied program of
equivalent to Peridex®Contains 0% alcohol the mouth. Does not contain benzocaine oral hygiene and regular professional care.
vs. 11.6% alcohol in all other chlorhexidine or alcohol. Oral pain management in a Helps prevent and reduce plaque build-up,
rinses marketed in the U.S. new convenient office dispenser. Provides gingivitis, and bad breath.
4 oz. Bottle - Mint a protective coating to soothe tissues and 3.2 oz Bottles
(SUN1788P)........................................ $4.41* promote healing. For fast long lasting pain re- 24 per Case....................................... $23.48*
16 oz. Bottle - Mint lief. Patients can leave our office feeling more Original......................................(JOH70895)
(SUN1789P)........................................ $6.82* comfortable. Cool Mint...................................(JOH72795)
36 per Box......... (SUN1771)............... $26.42 1.5 Liter Bottles
6 per Case........................................ $48.96*
Mouthwashes Original......................................(JOH70153)
Fresh Burst.................................(JOH42855)
Vanilla Mint................................(JOH52155)
Cool Mint...................................(JOH42755)
Citrus.........................................(JOH42256)
Gallon Bottles with Pump
2 per Case........................................ $53.86*
Cool Mint...................................(JOH42750)
Gum ParioShield Listerine Zero Listerine Ultraclean
Sunstar Americas Johnson & Johnson Johnson & Johnson
GUM PerioShield is a breakthrough next-gen- A low intensity, alcohol free mouthwash Listerine® Ultraclean®Antiseptic Mouthwash
eration oral rinse. A proprietary active ingre- that provides a deep clean by killing germs afer just 30 seconds of rinsing you will get
dient (delmopinol 0.2%) in GUM PerioShield that cause bad breath for a cleaner, freasher 24-hour protection against plaque and gingi-
breaks down plaque, making it easier to mouth. Contains signature 4 essential oils vitis germs.
remove and also creates an invisible barrier found in Listerine®.
that blocks plaque from forming on your 3.2 oz. Bottles
teeth and gums. 24 per Case........ (JOH42830)............. $23.48*
10 oz. Bottle 1.5 Liter Bottles
(SUN1775).......................................... $7.80* 6 per Case......... (JOH42834)............. $48.96*
3.2 oz. Bottles - Artic Mint
24 per Case........ (JOH42264)............. $23.48*
1.5 Liter Bottles - Artic Mint
6 per Case......... (JOH42259)............. $48.96*
264 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Dry-Mouth Relif
Listerine Smart Rinse GC Dry Mouth Gel Embrace Wetbond
Pit & Fissure Sealant
Johnson & Johnson GC America
Listerine® Smart Rinse® Anticavity Fluoride GC Dry Mouth Gel provides comfort to indi- Pulpdent
Rinse had just the right amount of fluoride viduals who may be experiencing difficulty Embrace™ Wetbond™ Pit and Fissure
for your child’s young teeth. eating, speaking or suffering from dry mouth. Dental Sealant is hydrophilic, moisture
27 mL. Bottles - Mint Dry mouth is a common problem often seen tolerant resin restorative that bonds
72 per Case........ (JOH11322)............. $39.16* in individuals with impaired production of sa- chemically and micromechanically to
liva from medications, radiation treatment or slightly moist teeth.
disease that can damage the salivary glads, Complete Kit..................................... $73.46
for example. Tooth Colored............................... (PULEMS)
10 Per Pkg......... (GCA002526).......... $63.66* Off White.................................. (PULEMSW)
Contains: 10 - 40gm Tubes, 2 of each flavor gel (fruit salad, Contains: 4 - 1.2 mL. syringe, & applicator tips.
lemon, mint, orange, raspberry).
Syringe Refills 3mL............................. $36.22
Pit & Fissure Sealants
Tooth Color................................. (PULEMS3)
Off White................................ (PULEMS3W)
Listerine Total Care Fuji Triage Capsule Seal-Rite *Case goods freight charges applies
Pit & Fissure Sealant
Johnson & Johnson GC America
Listerine Total Care provides whole-mouth- If you’re serious about keeping your young Pulpdent
cleaning and prevents cavities, restores patients’ teeth cavity-free you should start Seal-Rite™Pit & Fissure Sealant is a light-
minerals to enamel, strengthens teeth, kills them off right with GC Fuji TRIAGE, the revo- cured filled UDMA resin-based pit and
bad-breath and freshens breath. lutionary Glass Ionomer Sealant and Surface fissure sealant that protects against caries on
3.2 oz. Bottles - Fresh Mint Protectant. No isolation required. No bond- occlusal surfaces. Regular viscosity Seal-Rite
24 per Case........ (JOH30695)............. $23.48* ing agent required. Qorks in a moist field. is 34.4% filled and flows nicely from cusp to
And you don’t have to worry about sealing cusp. Low viscosity is 7.7% filled and flows
Listerine Total Care Zero over immature enamel or non-cavitated with ease into pits and fissures.
lesions. Self-bonding GC Fuji TRIAGE with
Johnson & Johnson its high fluoride release, creates a strong, Standard Package
New Listerine Total Care Zero gives you all acid-resistant fused layer.
the health mouth benefits of Listerine Total Starter Kit........................................ $249.86 (PULSEAL).......................................... $52.49
Care, now with less intensity and ZERO Pink......................................... (GCA439990)
alcohol. White...................................... (GCA439991) Contains: 4 - 1.2 mL. syringe, & 8 applicator tips.
3.2 oz. Bottles
24 per Case........ (JOH30668)............. $23.48* Contains: 50 Capsules: 3g powder & 15g liquid, 1 GC Cavity Procedure Kit
Conditioner, 1 GC Fuji Coat LC, & 1 Capsule Applier.
(PULRITE).......................................... $42.49
Capsule Refills................................. $195.96
Contains: 4 - 1.2 mL. syringe of: 2 Seal-Rite, 1 Etch-Rite
Pink........................................(GCA001946) etching gel, 1 Dry-Rite drying agent & 12 applicator tips.
White.....................................(GCA002269)
Contains: 50 capsules: 3g powder & 15g liquid
www.tricountydental.com | [email protected] 265
Preventives
Disposable Prohy Angles
BioCoat Twist Disposable Diamond Disposable
Prophy Angle Prophy Angle
Premier Dental
BioCoat is a 56% filled resin sealant provid- Crosstex Denticator
ing excellent long-term resistance to wear TWIST® Prophy Angle is 90° reciprocating Diamond Disposable Prophy Angles have a
with a compressive strength comparable to DPA that eliminates spatter and heat. Its pat- patented prophy cup with an exclusive dia-
flowable composites. The resin formula is ented oscillating motion allows for maintain- mond design. The longer and deeper prophy
very resistant to oral solubility, a problem ing continuous contact and pressure on tooth cup holds more paste and virtually eliminates
glass ionomer and resin filled glass ionomers surface for maximum stain removal. It is ideal paste splatter.
sealants cannot overcome. for applying dental medicaments, preparing Standard Package
teeth for etchants and bleaching procedures 144 per Box....................................... $85.25
Standard Package as well as orthodontic cases where use Soft Cup.................................. (YOU500114)
includes on and in between brackets, wires Regular Cup............................. (YOU500014)
(PRE3001530).................................... $21.52 and bands. Bulk Package
500 per Box..................................... $259.66
Contains: 1 x 1.2ml syringe, 5 x 22g applicator tips. Standard Package Soft Cup.................................. (YOU500150)
Regular Cup............................. (YOU500050)
100 per Bag....................................... $58.76
Soft Cup.................................... (CROTPASC)
Firm Cup.................................... (CROTPAFC)
100 per Bag....................................... $93.06
Flat Brush.................................. (CROTPAFB)
Trapered Brush.......................... (CROTPATB)
PBieta&utFiSisesaulraenSt ealant Twist Plus Disposable Eco Disposable
Prophy Angle Prophy Angle
Shofu Dental
BeautiSealant is BPA- and HEMA-free with Crosstex Denticator
dual adhesive monomers that thoroughly TWIST® Plus is a unique disposable prophy Denticator Eco is made with 25% less plastic
penetrate and prepare pits and fissures for angle that moves in a 120° reciprocat- than leading disposable prophy angles. The
bonding to the sealant. Unlike traditional ing (back-and-forth) motion instead of a Denticator Eco 125ct box is biodegradable,
sealants which require phosphoric acid etch- traditional spinning motion. This patented compostable and made with 100% recycled
ing, demineralizing and dehydrating healthy mechanism greatly diminishes frictional heat content, while the 1000ct box is made with
teeth, Shofu’s self-etching primer is signifi- while reducing the splatter of prophy paste, 35% recycled content. These prophy angles
cantly less acidic helping to preserve healthy saliva, blood and other potentially infectious also come individually wrapped in recyclable
tooth structure. materials. The innovative ergonomic design flim. By purchasing Denticator Eco angles,
Complete Kit optimizes comfort as well as visibility during you are helping create a greener dental
(SHO1798)......................................... $78.36 procedures. environment.
Standard Package Standard Package - Soft Cup.............. $78.36
Contains: 1 -BeautifulSealant Paste 1.2g, 1-BeautiSealant 100 per Bag....................................... $63.66 125 per Box....... (YOU295463)
Primer 3mL, 15-Needle Tips, 50-Microbrush Fine (Pink), Soft Cup............................ (CROTPLUSPASC)
25-V-Dish, Directions for Use. Firm Cup.............................(CROTPLUSPAFC)
Paste Refill Syringe
(SHO1799) 1.2 Gm............................. $31.32
Primer Refill Bottle
(SHO1800) 3 mL................................. $44.09
Tapered Brush................................. $102.86 Bulk Package - Soft Cup................... $548.76
100 per Bag........................(CROTPLUSPATB) 1,000 per Box.... (YOU295464)
266 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Original Green Emerald Disposable Prophy ProAngle Disposable
Disposable Prophy Angle Angle Prophy Angle
Denticator Denticator Pac-Dent
Original green Prophy Angle contain a The Emerald provides enhanced polishing Patented prophy angle employs the same
4-webbed cup design that offers quick effi- benefits and a newly designed, latex-free cup patented design as ProAngle Plus to ensure
cient cleaning. Original Green fits all standard featuring external ribbing for improved inter- each prophy procedure would require only
nose cone low-speed handpieces. They are proximal access and flare. Additional features one angle to finish. ProAngle utilizes the
latex-free and come individually wrapped. provide the clinician with a comfortable grip same beveled gear design as ProAngle Plus
Standard Package and an angled neck that facilitates a neutral for assured quality and performance.
144 per Box....................................... $83.26 wrist position and improved posterior access. Standard Package
Soft Cup.................................. (YOU501314) Standard Package - Soft Cup 144 per Box....................................... $39.16
Firm Cup.................................. (YOU501214) 144 per Box....................................... $88.16 Soft Cup.......................................(PAC6002)
Bulk Package Soft Cup.................................. (YOU580014) Firm Cup.......................................(PAC6005)
500 per Box..................................... $249.86 Bulk Package Bulk Package
Soft Cup.................................. (YOU501350) 500 per Box..................................... $264.56 500 per Box..................................... $132.26
Firm Cup.................................. (YOU501250) Soft Cup.................................. (YOU580050) Soft Cup.......................................(PAC6011)
Firm Cup.......................................(PAC6020)
Zooby Disposable ProAngle Plus ProAngle Ergo
Prophy Angle Disposable Prophy Angle Disposable Prophy Angle
Denticator Pac-Dent Pac-Dent
Zooby’s Disposable Prophy Angle puts the ProAngle Plus employs a patented new Proangle Ergo’s shell is ergonomically de-
fun into young patient care. The soft web, design and reinforced beveled gears to signed for ease of use. Its tilted head allows
latex-free cup fits slow speed handpieces. ensure only one angle is required for each hand and wrist to operate with less effort
Standard Package prophy procedure. Features include a smaller compared with traditional prophy angles,
100 per Box....................................... $63.66 angle head and shell, quieter and smoother causing less micro-traumas. The gearing
Soft Cup.................................. (YOU575010) operation, guaranteed no cup dropping and structure of ProAngle Ergo makes it much
Bulk Package matching colors for corresponding prophy quieter than other contraangle DPA’s. The
500 per Box..................................... $284.16 cups and angle shells. newly developed Torque Cup effectively
Soft Cup.................................. (YOU575050) Standard Package reduces splattering with its blade geometry.
144 per Box....................................... $44.06 Standard Package
Soft Cup.......................................(PAC6033) 144 per Box....................................... $58.76
Firm Cup.......................................(PAC6039) Soft Cup.......................................(PAC7168)
Bulk Package Super Soft Cup..............................(PAC7170)
500 per Box..................................... $142.06 Firm Cup.......................................(PAC7185)
Soft Cup.......................................(PAC6042) Torque Cup...................................(PAC7190)
Firm Cup.......................................(PAC6047) Bulk Package
500 per Box..................................... $205.76
Soft Cup.......................................(PAC7215)
Super Soft Cup..............................(PAC7220)
Firm Cup.......................................(PAC7233)
Torque Cup...................................(PAC7237)
www.tricountydental.com | [email protected] 267
Preventives
2pro Total Access ESA DisposableProphy Angle Eez-Touch
Disposable Prophy Angle Disposable Prophy Angle
Preventech
Premier Dental Make your current handpiece 50% lighter Sunstar Americas
2pro cleans and polishes all tooth surfaces with the esa (extended straight attachment) Experience a new level of comfort in prophy
with its unique cup and tip design! Use the disposable prophy angle. Less weight makes angles. Unique soft grip on disposable
cup to polish all tooth surfaces. Use the tip esa easier on your wrists and hands, making prophy angle designed to provide greater
for gingival and proximal areas, occlusal sur- you feel a whole lot better at the end of the control, reduce vibration and lessen hand
faces, veneer margins, and around implants day. and finger fatigue. Dimpled housing makes
and orthodontic brackets. For Midwest Shorty & Rhino Low Speeds applying and removing DPA to hand piece
Standard Package 144 per Box........... $74.44 100 per Box....................................... $58.31 faster and easier.
Soft-short Cup (Purple)........... (PRE5500101) Soft Cup - Midwest................... (PRE330001) Standard Package 200 per Box......... $112.66
Soft-Long Cup (White)............ (PRE5500103) Firm Cup - Midwest.................. (PRE330002) Soft Cup.................................... (SUN1201P)
Firm-Short Cup (Blue)............. (PRE5500102) No-latex Soft Cup - Midwest........ (PRE330004) Firm Cup.................................... (SUN1202P)
Firm-Long Cup (Green)........... (PRE5500104) Tapered Brush - Midwest Type........... $74.97
Bulk Package 100 per Box....... (PRE330003) Gel-Grip Disposable
1,000 per Box.................................. $460.56 For Star Titan Low-Speeds Prophy Angle
Soft-short Cup (Purple)........... (PRE5510001) 100 per Box....................................... $58.31
Soft-Long Cup (White)............ (PRE5510003) Soft Cup - Star Titan.................. (PRE330011) Waterpik
Firm-Short Cup (Blue)............. (PRE5510002) Firm Cup - Star Titan................. (PRE330012) Soft grips prophy angles reduce fatigue and
Firm-Long Cup (Green)........... (PRE5510004) No-latex Soft Cup - Star............... (PRE330014) soreness. Tactile response for precision
Tapered Brush - Star Titan Type......... $74.97 control. Optimized angle for better reach and
Pivot Disposable 100 per Box....... (PRE330013) access to posterior sites. Smooth running
Prophy Angle and vibration-free. A combined webbed and
Upgrade Disposable ribbed cup design for stain removal and re-
Preventech Prophy Angle duced splatter. Available in Soft Blue, for easy
Dentists and hygienists all over the country contoured cleaning and patient comfort, and
tell us that PIVOT performs closer to a metal Sultan Healthcare Firm Yellow for tougher stains.
angle than any other disposable angle they Upgrade® Disposable Prophy Angle is de-
have ever used. It runs smoothly, quietly and signed to run longer and smoother with less Standard Package 200 per Box....$134.26
gets through the prophy every time. PIVOT chatter, providing improved comfort and less
is available in natural rubber and non-latex hand fatigue than traditional angles. Soft Cup (Blue).............. (WAT20018272)
cups. Standard Package 100 per Box........... $58.76 Firm Cup (Yellow).......... (WAT20018273)
Standard Package 144 per Box........... $67.58 Soft Cup..................................... (SUL30101) LatexFree Soft Cup (Gn).(WAT20018274)
Soft Cup.................................(PREV110001) Firm Cup..................................... (SUL30100) Latex-Free Soft Cup & Brush Combina-
Firm Cup.................................(PREV110002) Multi-Color Soft Cup................... (SUL30106) tion
Non-Latex Soft Cup.................(PREV110004) Bulk Pack 1,200 per Box................... $636.96
Non-Latex Firm Cup................(PREV110005) Soft Cup..................................... (SUL30502) 200 per Box (WAT20018275)......$171.46
Bulk Package Firm Cup..................................... (SUL30503) Tapered Brush............................$112.66
1,200per Box................................... $489.96 Multi-Color Soft Cup................... (SUL30506)
Soft Cup...............................(PREV1100017) 100 per Box................... (WAT20018276)
Firm Cup...............................(PREV1100027)
Non-Latex Soft Cup...............(PREV1100047)
Non-Latex Firm Cup..............(PREV1100057)
268 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Densco Young Classic
Disposable Prophy Angle Disposable Prophy Angle
Waterpik Young Dental
A combined webbed and ribbed design for Young’s Classic Disposable Prophy Angles offer convenience with quality angles along
heavy stain removal and reduced splatter, with reliability and stability you can count on. The prophy angles are designed for stain
Densco disposable prophy angles are made and biofilm removal and increases the efficiency of the paste.
of high-strength nylon components and a dry
natural rubber prophy cup. Standard Pk 200 per Box.............................................. $161.66
Standard Pk 125 per Box.................... $72.48 Soft Cup Firm Cup
Soft Cup (Blue)..........................(WAT18100) Webbed.................................(YOU131120) (YOU131320)
Firm Cup (Yellow)......................(WAT18150) Webbed Jr..............................(YOU131420) (YOU131520)
Dynamo Green (Latex-Free).......(WAT18125) Webbed LF.............................(YOU131620) (YOU131720)
Bulk Pk 1,000 per Box...................... $558.56 Patite Webbed LF...................(YOU134620) (YOU134720)
Soft Cup (Blue)...................(WAT1810001M) Turbo.....................................(YOU132120) (YOU132320)
Firm Cup (Yellow)...............(WAT1815001M)
Dynamo Green (LF).............(WAT1812501M) Bulk Pk 1,200 per Box.................................................. $803.56
Soft Cup Firm Cup
Webbed.................................(YOU131112) (YOU131312)
Webbed LF.............................(YOU131612) ---
Patite Webbed LF...................(YOU134612) (YOU134712)
Turbo.....................................(YOU132112) (YOU132312)
WDisizpaorsdable Prophy Angle Young Classic
Disposable Prophy Angle
Waterpik
Unique cup and brush combination gently Young Dental
polishes teeth. Removes stains efficiently, Young’s Contra Disposable Prophy Angles are a premium disposable angle designed to
especially from occlusal surfaces and inter- keep your wrist in a neutral position, reduce muscle fatigue, and allow for easier access
proximal spaces. Spiral cup design minimizes in hard-to-reach places.
splatter.
Standard Pk - Soft Cup Standard Pk 200 per Box.............................................. $166.56
125 per Box....................................... $97.96 Soft Cup Firm Cup
Soft Cup (Blue).................... (WAT20005474) Patite Webbed LF...................(YOU154620) (YOU154720)
Turbo Plus..............................(YOU153120) (YOU153320)
Bulk Pk 1,200 per Box.................................................. $881.96
Soft Cup Firm Cup
Petite Webbed LF...................(YOU154612) (YOU154712)
Turbo Plus..............................(YOU153112) (YOU153312)
Bulk Package - Soft Cup
1,000 per Box.................................. $744.76
Soft Cup Pk.......................... (WAT20005475)
www.tricountydental.com | [email protected] 269
Preventives Prophy Cups
Reusable Prophy Angles
Screw Shank Snap On
Deluxe Prophy Cups Prophy Cups
Prophy Angle
Dentamerica Waterpik
Miltex Dentamerica Disposable Prophylaxis Polish- Waterpik’s complete line of prophy cups
Miltex Deluxe Reusable Prophy Angles are ing Cups have high elasticity and are effective and brushes minimizes splatter and fit most
fully autoclavable. Easy to access hole for in polishing and removing stains from teeth. prophy angles. Densco® prophy cups are
oiling without disassembling. Supplied with 2 available in Soft Blue, Firm Yellow, Medi-
oil bottles and wrench. White Firm Cups um White and Latex Free Dynamo Green,
5 Per Pack........................................ $127.36 which Features a reverse helix rib design for
Screw Type...................................(MIL7528) 144 Per Pack...................................... $14.66 reduced splatter.
Snap Type.....................................(MIL7530) Standard Package
Screw Type.................................(DAM5099) 144 Per Pack...................................... $48.96
HP & Prophy Angle Lube - 1/2oz. Snap Type...................................(DAM5078) Soft Cup (Blue).................... (WAT85132144)
Firm Cup (Yellow)................ (WAT85133144)
4 per Box........... (MIL7538)................ $63.66 White Firm Cups - Latch Type Dynamo Green (LFree)......... (WAT85148144)
Bulk Package
144 per Box....... (DAM5906).............. $19.56 1,000 Per Pack.................................$284.16
Soft Cup (Blue)...................(WAT8513201M)
Prophy Brushes Firm Cup (Yellow)...............(WAT8513301M)
Dynamo Green (LFree)........(WAT8514801M)
144 Per Pack...................................... $32.30
Screw Type.................................(DAM5416)
Snap Type...................................(DAM5415)
Care-Free Prophy Angle Traditional
Web Prophy Cups
Young Dental
Care-Free Prophy Angles combine the Young Dental
convenience of a disposable prophy angle Young’s most popular selling prophy cup. The
with the performance of a traditional metal Traditional Web Prophy Cup has a divided
prophy angle. Saves time, as no maintenance web interior that provides a fast and effective
is required. Simply wipe the angle with a dis- cleaning.
infectant and sterilize. 1 year warranty when Screw Type
used with Young products 144 Per Box....................................... $68.56
5 per Pack.......... (YOU018005)......... $225.36 Gray Soft Cup.......................... (YOU051101)
White Firm Cup....................... (YOU051301)
Economy Package
720 Per Box..................................... $284.16
Gray Soft Cup.......................... (YOU051105)
White Firm Cup....................... (YOU051305)
270 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Turbo Cup Prophy Paste Preventives
Turbo Plus Cup
Medium - Cinnamon...............(CROUPSFMC)
Medium - Fruity.....................(CROUPSFMF)
Medium - Spearmint..............(CROUPSFMS)
Medium - Wht Choco......... (CROUPSFMWC)
Turbo & Turbo Plus Sparkle Zooby
Prophy Cups Prophy Paste Prophy Paste
Young Dental Crosstex Denticator
Turbo Prophy cup has a patented curved Cleans and Polishes - maximum stain removal Zooby contains xylitol and 1.23% fluoride.
rib interior is designed to reduce splatter with minimal enamal loss. Available in 4 Zooby Paste is low splatter and a great stain
by pulling the paste back into the cup while flavors and tree grits. Gluten FREE formula remover. With Fluoride.
still allowing the cup to flex and follow tooth with Xylitol. Contains 1.23% active fluoride 100 Per Box....................................... $26.42
contours. This provides maximum surface ion. Spatter free formula with optimum Coarse - Spearmint.................. (YOU601010)
contact for an effective cleaning. Turbo Plus rinsability - leaves no residual grit. Coarse - Grape......................... (YOU602010)
Prophy cup has a patented design combines With Flouride Coarse - Happy Cake................ (YOU603010)
the superior splatter reduction of the Turbo 200 Per Box....................................... $27.40 Coarse - Chocolate................... (YOU604010)
Cup with the fast and effective cleaning of Coarse - Mint............................. (CROUPCM) Coarse - Gator Gum................. (YOU605110)
the popular webbed divided interior. Coarse - Berry............................. (CROUPCB) Coarse - Melon........................ (YOU606010)
Standard Package - Screw Type Coarse - Bubble Gum................(CROUPCBG) Coarse - Assorted.................... (YOU600010)
144 Per Box....................................... $78.36 Coarse - Cherry......................... (CROUPCCH) Medium - Spearmint............... (YOU601110)
Turbo - Gray Soft Cup............... (YOU052101) Coarse - Orange Vanilla.............(CROUPCOV) Medium - Grape...................... (YOU602110)
Turbo Plus-Gray Soft Cup......... (YOU053101) Coarse - Assorted....................... (CROUPCA) Medium - Happy Cake............. (YOU603110)
Economy Package Medium - Mint.........................(CROUPMM) Medium - Chocolate................ (YOU604110)
720 Per Box..................................... $303.76 Medium - Berry.........................(CROUPMB) Medium - Gator Gum.............. (YOU605110)
Turbo - Gray Soft Cup............... (YOU052105) Medium - Bubble Gum........... (CROUPMBG) Medium - Turtle Melon........... (YOU606110)
Turbo Plus-Gray Soft Cup......... (YOU053105) Medium - Cherry.....................(CROUPMCH) Medium - Assorted.................. (YOU600110)
Medium - Orange Vanilla........ (CROUPMOV)
Medium - Assorted....................(CROUPMA)
Fine - Bubble Gum.................... (CROUPFBG)
Sparkle Fine - Spearmint...................... (YOU601210)
Prophy Paste Fine - Grape............................. (YOU602210)
Fine - Happy Cake.................... (YOU603210)
Crosstex Fine - Chocolate....................... (YOU604210)
Cleans and polishes - maximum stain re- Fine - Gator Gum..................... (YOU605210)
moval with minimal enamel loss. Available Fine - Turtle Melon.................. (YOU606210)
in patient pleasing Spearmint flavor and two Fine - Assorted........................ (YOU600210)
grits. Gluten FREE - Dye FREE - Fluoride FREE
formula with Xylitol. Spatter free formula
with optimim rinsability - leaves no residual
grit.
200 Per Box....................................... $27.40
Coarse - Cinnamon..................(CROUPSFCC)
Coarse - Fruity......................... (CROUPSFCF)
Coarse - Spearmint.................. (CROUPSFCS)
Coarse - Wht Choco............. (CROUPSFCWC)
www.tricountydental.com | [email protected] 271
Preventives
PKoroloprhzy Paste Enamel Next
Pro Prophy Paste Prophy Paste
DMG America
Kolorz Professional Prophylaxis Paste is a Premier Dental Preventech
premium Splatter-free fluoride formula Enamel Pro prophy paste is formulated to Next Prophy Paste is a fresh, non-splatter,
which means less mess and easier clean-up. deliver ACP (Amorphous Calcium Phosphate) flavorful prophy paste. This prophy paste
The disposable unit-dose cups prevents cross which stimulates remineralization of tooth contains Xylitol and 1.23% Fluoride along
contamination. Kolorz Prophy Paste contains enamel. Enamel Pro also delivers 31% more with excellent stain removal and superior
Xylitol and comes in choices of grits. fluoride uptake while it quickly cleans with polishing properties. With Fluoride.
Screw Type less splatter. With Fluoride. 200 Per Box....................................... $39.16
200 Per Box....................................... $46.02 200 Per Box....................................... $48.96 Xtra - Coarse - Mint................(PREV220043)
Xtra - Coarse - Triple Mint.......(DMG788404) Xtra - Coarse - Mint................ (PRE9007603) Coarse - Mint..........................(PREV220043)
Coarse - Triple Mint................(DMG788403) Coarse - Bubble Gum.............. (PRE9007616) Coarse - Cherry.......................(PREV220073)
Coarse - Cinnamon.................(DMG788416) Coarse - Cinnamon................. (PRE9007606) Coarse - Bubble Gum..............(PREV220003)
Coarse - Cherry Burst..............(DMG788407) Coarse - Grape........................ (PRE9007612) Coarse - Choco Mint...............(PREV220153)
Medium - Triple Mint.............(DMG788402) Coarse - Mint.......................... (PRE9007602) Coarse - Cinnamon.................(PREV220173)
Medium - Cinnamon...............(DMG788415) Coarse - Strawberry................ (PRE9007609) Coarse - Watermelon..............(PREV220203)
Medium - Cherry Burst...........(DMG788406) Coarse - Raspberry Mint......... (PRE9007622) Coarse - Grape........................(PREV220343)
Medium - Carnival Pak............(DMG788409) Medium - Bubble Gum........... (PRE9007615) Coarse - Vanilla.......................(PREV220233)
Fine - Triple Mint(.DMG788401)Fine - Bubble Medium - Cinnamon............... (PRE9007605) Coarse - Winter Green............(PREV220263)
Gum....................................... (DMG788417) Medium - Grape..................... (PRE9007611) Coarse - Kid’s Variety..............(PREV221123)
Fine - Carnival Pak..................(DMG788408) Medium - Mint....................... (PRE9007601) Coarse - Adult Variety.............(PREV221143)
Medium - Strawberry............. (PRE9007608) Medium - Mint.......................(PREV220023)
Carnival Pak Contains: Cotton Candy, & Blue Raspberry. Med - Raspberry Mint............ (PRE9007621) Medium - Cherry....................(PREV220063)
Fine - Bubble Gum.................. (PRE9007614) Medium - Bubble Gum...........(PREV220093)
Fine - Cinnamon..................... (PRE9007604) Medium - Choco Mint.............(PREV220143)
Fine - Grape............................ (PRE9007610) Medium - Cinnamon...............(PREV220163)
Fine - Mint.............................. (PRE9007600) Medium - Watermelon...........(PREV220193)
Fine - Strawberry.................... (PRE9007607) Medium - Grape.....................(PREV220333)
Fine - Raspberry Mint............. (PRE9007620) Medium - Vanilla....................(PREV220223)
Medium - Winter Green.........(PREV220253)
Medium - Kid’s Variety...........(PREV221113)
Medium - Adult Variety..........(PREV221133)
Fine - Mint..............................(PREV220013)
DentiCare Nada Pumice Paste
Pro-Polish Prophy Paste
Preventech
Medicom Nada pumice paste is a prep paste that
Denti-Care® Pro-Polish Prophy Paste with contains no fluoride, flavor or oils making
fluoride is a prophylaxis paste used to clean it a perfect preparation paste prior to acid
and polish teeth. This special formula offers etching for sealants, composite bonding and
fast stain removal, high polishing ability, low application of orthodontic brackets.
splattering and quick rinsing 200 Per Box....... (PREV223313).......... $39.16
200 Per Box....................................... $27.40
Coarse - Mint.............................. (MED1040)
Coarse - Raspberry..................... (MED1044)
Medium - Mint........................... (MED1046)
Medium - Cherry........................ (MED1042)
Fine - Bubble Gum...................... (MED1049)
272 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Prophy Air Polishers
Topex Waterpik Prophy Paste Air-Flow
Prophy Paste Master Perio Standard
Waterpik
Sultan Healthcare Waterpik Prophylaxis Paste is a pumice-based Hu-Friedy
Topex prophy paste combines the perfect dental abrasive for the removal of all types of AIR-FLOW® Technology delivers air polishing
blend of polishing and cleansing agents with tooth accumulation and extrinsic stain. Tough that is effective for practitioner and patient
1.23% Flouride Ion. Excellent washability, on stains and plaque, with minimal splat- alike: reliable, fast and productive for the
leaves no gritty residue Splatter-free formula, ter and four great tasting flavors, Waterpik practice; Stress-Free and comfortable for the
stays on Prophy cup and tooth surface with Prophy Paste is the hygienist’s partner in
no mess. Disposable unit dose cup, elimi- polishing effectiveness. With Fluoride •p aAtiuetnotm. atic illumination of activated pow-
nates cross contamination. Color-coded tops 200 Per Box....................................... $34.26 • dEaesrychhaanmdblienrgf,ocrleidaennintigfiacantdiorne.filling of the
and easy to read labels, are convenient and Xtra - Coarse - Mint....... (WAT20015789) • pSmowodoethr. touch panel surface for simple
simple to use. With fluoride. Coarse - Mint................. (WAT20015790) • cSlleeaenkiunsgearnindtdeirsfiancfeecotfifoenr.s easy adjustment
200 Per Box....................................... $37.20 Coarse - Cherry.............. (WAT20015788)
Xtra - Coarse - Mint.................... (SUL30042) Coarse - Melon.............. (WAT20015784) for power and water delivery.
Coarse - Assortment................... (SUL30000) Coarse - Strawberry....... (WAT20015786)
Coarse - Mint.............................. (SUL30002) Medium - Mint.............. (WAT20015841) (HUF2316)................................... $6,267.10
Coarse - Cherry........................... (SUL30001) Medium - Cherry........... (WAT20015787)
Coarse - Pina Colada................... (SUL30004) Medium - Melon........... (WAT20015783) Contains: Air-FLOW MASTER PERIO Unit, 1 - Original AIR-
Coarse - Choco Mint................... (SUL30007) Medium - Stawberry...... (WAT20015785) FLOW Handpiece, 1 - Perio AIR-FLOW handpiece, 1 - Perio
Coarse - Fun Pak......................... (SUL30008) Medium - Bubble Gum.. (WAT20015781) Flow nozzles box, 1 - Classic Comfort Powder Bottle, 1 - Steri
Coarse - Neopolitan.................... (SUL30009) Medium - Variety Pack... (WAT20015791) - Box, 2 - handpiece holders, 1 - foot pedal, Power cord, Main-
Medium - Assortment................ (SUL30015) Fine - Melon.................. (WAT20015782) tenance accessories, user manual & operation instructions.
Medium - Mint........................... (SUL30012) Fine - Bubble Gum......... (WAT20015780)
Medium - Cherry........................ (SUL30011)
Medium - Cherry........................ (SUL60011)
Non-fluoride
Medium - Pina Colada................ (SUL30014) Air-Flow S1
Medium - Choco Mint................. (SUL30017)
Medium - Fun Pak...................... (SUL30018) Hu-Friedy
Medium - Neopolitan................. (SUL30019) The AIR-FLOW S1 is the ideal unit for hygien-
Fine - Mint.................................. (SUL30041) ists. By using a jet formed by air, powder
Fine - Bubble Gum...................... (SUL30025) and water, the Air-Flow S1 removes dental
Fine - Neopolitan........................ (SUL30029) plaque, soft deposits and surface stains
from pits, grooves, interproximal spaces and
s•m Foreoeth-Fslouwrfatceecshnoof ltohgeytteoetphr.event clogging
• oInfcpreodwibdleyr,liagihrtahnadnwdpatieecrelintueb. ing allows for
easier maneuvering of the handpiece while
in use.
(HUF2305)................................... $3,033.10
Contains: Air-FLOW S1 Unit, 2 - Original AIR-FLOW Hand- 273
pieces, 1 - Maintenance set with cleaning needles and seals,
AIR-Flow handpiece hose with quick connector on handpiece
and device, 1 - Original Air-Flow Powder Classic 300g bottle,
Water hose with quick connector on device, Compressed - air
hose with quick connector on device, Water filter cartridge
replacement tool, Power cord, & Foot switch.
www.tricountydental.com | [email protected]
Preventives
Air-Flow Handy 3.0 Air-Flow Handy 3.0 Premium Prophy Plus
Hu-Friedy Hu-Friedy Vector Research
The AIR-FLOW Handy 3.0 portable air The AIR-FLOW Handy 3.0 PREMIUM is a Stain removal and prophy blasting hand-
polishing units enable dentists to efficiently, portable sub and supragingival biofilm and piece. Your dental control units water and
safely and comfortably perform air polishing stain removing air polishing device. The drive air mix at the tip to create a powerful
treatments in any operatory. Simply connect handy 3.0 employs two handpieces to tackle and effective prophy-blasting slurry that can
the AIR-FLOW handy 3.0 device to your den- biofilm above and below the gingival margin. remove the toughest tartar and stain without
tal unit for a simple, convenient air polishing The PLUS handpiece will remove biofilm and damaging the enamel surface. No bulky
experience. stain supragingival and in shallow periodon- equipment or additional water, air or electri-
Each........................................... $1,469.96 tal pockets. cal connections are required, simply connect
Kavo...........................................(HUF2219) Each........................................... $2,053.10 to the control unit by way of any KaVo Multi-
Midwest.....................................(HUF2217) Kavo...........................................(HUF2203) flex type swivel connection (sold separately).
Midwest.....................................(HUF2200) Extra large powder bowl provides enough
Contains: 1 - AIR-FLOW® handy 3.0, 1 - 120° spray powder for a complete procedure.
handpiece AIR-FLOW®, 1 - Original AIR-FLOW® Powder Contains: 1 - AIR-FLOW® handy 3.0 Perio, 1 - AIR-FLOW (HUF8840)....................................... $783.96
CLASSIC, 300 g bottle, 1 - Refill device AIR-FLOW® Easy Perio handpiece, 1 - Air Flow Plus handpiece, 1 - Voucher for
Fill 3.0, 1 - Cleaning device AIR-FLOW® Easy Clean, 1 - Main- 1 bottle of AIR-Flow Powder, 1 - AIR-FLOW Easy Fill 3.0 de- Contains: Prophy Plus handpiece, Tip, Replacement O-ring
tenance set. vice, 1 - AIR-Flow easy clean cleaning device, 1 - Maintenance
Set. 40 - Perio-Flow single-use slim nozzles.. Kit, (Note: Powder and swivel sold separately)
Non-Optic Kavo Style Swivel
(HUFVKS)........................................... $97.51
Air Polishing Powder
Air-Flow Handy 3.0 Perio Air-Flow Handy 3.0 Prophy Powder
Hu-Friedy Bosworth Company Bosworth Company
The AIR-FLOW Handy 3.0 Perio air polishing The AIR-FLOW Handy 3.0 portable air Sodium bicarbonate powder compatible with
units enable dental practitioners to effi- polishing units enable dentists to efficiently, most air polishing units. Less abrasive than
ciently, safely and comfortably perform air safely and comfortably perform air polishing prophy paste. Use to remove stubborn stains,
polishing treatments in any operatory. Simply treatments in any operatory. Simply connect plaque and soft debris
connect the AIR-FLOW handy 3.0 device to the AIR-FLOW handy 3.0 device to your den-
your dental unit for a simple, convenient air tal unit for a simple, convenient air polishing 10 oz............................................$18.58
polishing experience. experience.
Each............................................ $1,763.96 Each................................................ $832.96 Spearmint........................... (BOS16691)
Kavo............................................ (HUF2213) Red.......................................... (BOS16670R) Grape.................................. (BOS16690)
Midwest...................................... (HUF2210) Black....................................... (BOS16670B) Orange................................ (BOS16692)
Blue........................................(BOS16670LB)
Contains: 1 - AIR-FLOW® handy 3.0 Perio, 1 - Spray hand- Orange.................................... (BOS16670N)
piece AIR- FLOW® PERIO, 40 - PERIO-FLOW® single use
nozzles, 1 - Voucher for one bottle of Original AIR-FLOW® Contains: 1 - ProphyBrite Air Polishing Unit, 2 - Nozzles, 2 -
Powder, 1 - Refill device AIR-FLOW® Easy Fill 3.0, 1 - Clean- Powder Chamber Caps, 1 - Cleaning File, 1-O-ring, & 1-3 oz
ing device AIR-Flow® Easy Clean, 1 - Maintenance Set sample of Bosworth prophy powder.
274 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Air-Flow Classic Lemon Powder Air-Flow Perio Powder Blis-Sonic Scaler Tips
& Accessories
Hu-Friedy Hu-Friedy
The AIR-FLOW Classic powder is effective for The AIR-FLOW Perio powder is used with the Star Dental
dental cleanings and plaque removal. AIR- PERIO-FLOW handpiece and nozzle, the AIR- Replacement Scaler Tips
FLOW Classic powders provide an alkaline FLOW Perio powder’s extra-fine, low density Each.................................................. $78.36
effect to protect against tooth decay, and an grains remove harmful biofilm and bacteria Universal.................................... (STA61668)
osmotic effect to support the treatment of subgingivally. Perio.......................................... (STA61669)
gingivitis. 120 Gm ............. (HUF2110) .............. $27.40 Perio Left.................................... (STA63397)
Sickle.......................................... (STA63667)
300 Gm ............. (HUF2111) .............. $32.30 Perio Right................................. (STA63398)
Rotor Spare Kit
(STA56715) ....................................... $93.06
Piezo Scaling Units
Blis-Sonic Titan Scalers
Star Dental
Titan® Blis-sonic™ Scalers are the clinical-
ly proven sonic scaler design effectively
Air-Flow Classic Mint Powder removes hard calculus deposits and stains.
A• uPtoorctlaabvalebl-eC-oMnnoetcotrsatnodegxrisiptisng air driven
Hu-Friedy • tEurgboinngosmaincd- foot control.
Air-Flow Classic powder is a sodium bicar- Silicone grips with comfort- Blis-Sonic Titan Scalers
bonate prophy powder used for removal of • Laibglhetfwinegigehr tp-uOrcnhlays4e5regmliev- eres lfiienvgeesrwfartiisgtue
heavy stains and plaque during supragingival • Saanfdef-inCgaenr fatigue. Coltene Whaledent
air polishing. be used on patients with pace- BioSonic Suvi Premier is the ultimate tool
300 Gm ............. (HUF2113) .............. $32.30 • mFuallkyearsutoclavable motor and grips. for ultrasonic treatment. Due to its wide
BlisSonic K Titan Scaler (fixed Backend) power range and a veriety of tips, the scaler
Air-Flow Classic Comfort Powder is remarkably adjustable for all treatments.
(STA64565) ..................................... $783.96 This multi-purpose device offers ultrasonic
Hu-Friedy solutions not only for traditional scaling but
The AIR-FLOW Classic Comfort powder is Contains: 1 - BlisSonic SW Scaler & 5 Tips. (1 of each: Perio, also for endodontics, prosthetics, implant
premarily used for supragingaval removal maintenance, and restorative treatments.
of biofilm and colorations, it can also be Sickle, Universal, Left Perio, & Right Perio) Piezoelectric power system vibrates the tip
used for surface preparation before dental
treatments. BlisSonic K Titan Scaler (fixed Backend) m• o2r-eYtehaarnW1a.6rmrainlltiyo.n times per minute.
250 Gm ............. (HUF2109) .............. $32.30
(STA64563) ..................................... $705.56 BioSonic Suvi Premier (Tap Water)
Contains: 1 - BlisSonic SW Scaler & 5 Tips. (1 of each: Perio, (COL60014237) ........................... $1,665.96
Sickle, Universal, Left Perio, & Right Perio). *Swivel sold Contains: Suvi unit with handpiece & foot switch, introductory
separately kit (2 silicone grips, 1 PE-38 ultrasonic tip, 1 PE-40H ultrasonic
4-Hole Non-Optic Swivel (with water) tip & 2 torque tip wrenches) & instructions for use
(STA61547) ..................................... $166.56 BioSonic Suvi Premier
(Medicament Feeder)
(COL60014238) ........................... $1,861.96
Contains: Suvi unit with handpiece & foot switch, introductory
kit (2 silicone grips, 1 PE-38 ultrasonic tip, 1 PE-40H ultrasonic
tip & 2 torque tip wrenches), medicament bottle & instructions
for use
www.tricountydental.com | [email protected] 275
Preventives
Piezo Scaling Units
Biosonic Suvi Elite Piezon 150 Piezon Master 700
Coltene Whaledent Hu-Friedy Hu-Friedy
The BioSonic® Suvi® is an excellent power The Piezon 150 combines power, precision, Equipped with the Original Piezon Method
tool that upgrades any working environment design and function in the smallest ultra- from EMS, the Piezon Master 700 is the
to new levels of quality. Distinguished ergo- sonic package available from Hu-Friedy. The perfect formula for uniquely smooth tooth
nomics combined with uniquely designed Piezon 150 attaches to water system and has surfaces, offers maximum protection of the
LED lighting, advanced electronics, and long a unique external water filter and clear water gums and virtually painless treatment. The
lasting tips make Suvi devices ideal for all line for biofilm detections. The LED hand- NO PAIN module of the Piezon Master 700
piece ensures enhanced visibility while the allows power differentiation delivered in a
•••p roAWErcugaetotdoenucrolraremevsagi.cbulhleaathinoadnnpdinieptciheeecwehiatahnnddLEhpDyieglciigeehn te fingertip control delivers 35 individual power variety of treatment applications. Regard-
• Aslueteov-eCsleaning function with the touch of increments for the exact power you want, less of procedure, the linear movements of
•• To2an-peYwebauarttetWornacrornannetyc.tion the instrument and uniform power output
•w hLeanrgyeo, uerwgoannot mit.ic interface with fingertip combine to spare the epithelium, to optimize
BioSonic Suvi Elite (Tap Water) treatment efficiency and increase patient
control allow the clinician to easily select comfort.
(COL60014239) ........................... $3,523.10 or change the desired power setting during (HUF2700) .................................. $3,915.10
Contains: Suvi Elite Plus unit with handpiece & foot switch, • Iullsuem. inated handpiece remains lit for 20 Contains: 1 - Piezon Master 700 Unit, 2 - Piezon Handpieces,
waterline, air line, introductory kit (4 silicone grips, 1 PE-38 1 - Steribox, 2 - Handpiece Magnetic Holders, 2 - Piezon
ultrasonic tip, 1 PE-40H ultrasonic tip & 2 torque tip wrenches), seconds after the foot control is released Handpiece Cords, 2 - 350ml Bottles, 1 - Power Cord, 1 - Foot
universal polisher nozzle, hooked polisher nozzle, 180 Gm. for continued visibility of the treatment Control.
site and easier diagnosis.
Piezon Master LED Handpiece
(HUF2231) .................................. $1,763.96
(HUF2706) ...................................... $906.46
Contains: Piezon 150 Unit, 1 - Original Piezon LED handpiece,
3 - EMS Swiss Instruments A, P, PS Tips (each in Combi-
Torque), 2 - External Water Filters, 1 - 2 - Step 360 degree foot
switch, & 1 - Handpiece Cord
polishing powder & instructions for use.
BioSonic Suvi Elite Air-Flow S2 Combo Unit
(Medicament Feeder)
Hu-Friedy
(COL60014240) ........................... $3,719.10 Combination Air Polishing/Piezo Tabletop
device. The AIR-FLOW® S2 combines two
Contains: Suvi Elite Plus unit with handpiece & foot switch, devices in one for the professional removal
medicament bottle, air line, introductory kit (4 silicone grips, of tooth deposits and stains. With the
1 PE-38 ultrasonic tip, 1 PE-40H ultrasonic tip & 2 torque tip combined use of AIR-FLOW® and Piezon®
wrenches), universal polisher nozzle, hooked polisher nozzle, technologies, it is a complete workstation
180 Gm. polishing powder & instructions for use. for the dental hygienist or practitioner.
A combination of an air polishing and
Piezon 250 ultrasonic unit, the AIR-FLOW® S2 removes
calculus, dental plaque, soft deposits
Hu-Friedy and surface stains from pits, grooves,
Tabletop, self-contained ultrasonic scaling interproximal spaces and smooth surfaces of
device. The Piezon® 250 combines power, the teeth. It is also recommended for a wide
precision, design and function in a self-con- variety of cleaning procedures.
tained package with an irrigant bottle. The (HUF2311) .................................. $4,503.10
LED handpiece ensures enhanced visibility
while the fingertip control delivers 35 individ- Contains: AIR-FLOW S2 Combo Unit, Original AIR-FLOW
ual power increments for the exact power
you want, when you want it. handpiece, 1 - Maintenance set, 1 - Steribox, 1 - AIR-FLOW
(HUF2241) .................................. $2,547.96
Contains: Piezon 250 1 unit, 1 - Original Piezon, LED handpiece hose, 1 - Original AIR-FLOW Powder CLASSIC,
handpiece, 3 - EMS Swiss Instruments A, P, PS Tips (each in 300g bottle, 1 - Original Piezon® universal handpiece, 3 -
combiTorque), 1 - 350mL Bottle, 1- 2-Step 360 degree foot Swiss InstrumentPM A, P, PS, each in CombiTorque®, 1 - Foot
switch, 2 - Peristaltic Pumps, & 1 - Handpiece Cord switch, 50 “Dental Check-up” patient brochures.
276 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Air-Flow Master Piezon Power Plus Dual Power Plus Piezo Scaler
Bottle Piezo Scaler
Hu-Friedy Piezo Technologies
Piezo Technologies The Handpiece: Slim, light weight, power-
• Smooth touch panel surface for simple Power Plus Piezo Scaler by Vector Research ful and autoclavable the handpiece is the
• Eclaesaynhinagndalnindgd, icslienafencintigonand refilling of the & Development with a dual bottle water heart of the piezo technologies scaling unit.
• pSloewekdeursechr ainmtebrefarsce offers easy adjustment supply. This is a desktop Power Plus Piezo Technology and quality second to none in the
• Eorfgpoonwoemriacnhdanwdaptieercdeeslfioverrwyorking comfort Scaler by Vector Research & Development dental industry. Piezo Technologies handpiec-
• aInntdelpligreecnitsifoenedfobratchkeccolnintricoilatnechnology with a dual bottle water supply. We offer es accept all EMS type scaling inserts and will
this scaler in EMS or Satelec style with LED or connect to any EMS style piezo tubing which
senses when higher power is needed to without LED on our site. Adapts to your cur- makes them a great replacement handpiece
remove deposit and adjusts accordingly rent scaling tips and interchanges with your for existing EMS systems. Compare to any
existing handpieces. Accessory pack included brand at any price, these hanpieces are
(HUF2300) .................................. $7,835.10 provides a sterilization tray, autoclavable tip second to none in both quality and perfor-
wrench with torque control, five tips (P, PS, mance.
Contains: AIR-FLOW Master Piezon Unit, 3 - handpieces A, C & 90 degree endo holder Satelec/NSK or
(Original Piezon LED, AIR-FLOW, & PERIO-FLOW), 2 - EMS type) Power Plus Piezo Scaler Non LED
Handpiece Cords, 2 - Magnetic Handpiece Holders, 1 - 350mL
Bottle, 2 - Powder Chambers (AIR-FLOW & PERIO-FLOW), Power Plus Piezo Scaler Non LED Each ............................................... $440.96
40 - Perio-Flow Slim Nozzles, 1 - Foot Pedal, & 1 - 300gm
Bottle AIR-FLOW Powder Classic. Each ............................................... $639.96 NSK Type (PT-PP200S).................(PIET1933)
EMS Type (PT-PP200E)................(PIET1920)
Perio-Flow Slim Nozzles NSK Type (PT-PL5500S)...............(PIET1952) Power Plus Piezo Scaler LED Optic
EMS Type (PT-PL500E)................(PIET1960)
40 per Box........... (HUF2221)............ $154.95 Power Plus Piezo Scaler LED Optic Each ............................................... $587.96
Each ............................................... $783.96 NSK Type (PT-PP300S).................(PIET1930)
EMS Type (PT-PP300E)................(PIET1915)
NSK Type (PT-PL9002).................(PIET1950)
EMS Type (PT-PL500E)................(PIET1955) Contains: Unit, Handpiece, 5 tips (G1, G2, G3, G4, P1),
Scaling Tip wrenchm Power Transformer, Foot Pedal and
Contains: Piezo unit, handpiece cord, 6 tips included (G1,G2, Instructions.
G3, G4, P1, E1), Endo File wrench, scaling tip wrench,
power transformer, foot pedal, 2 bottles (1 - Large, 1 - Small)
autoclavable tip holder and instructions.
Replacement Piezo Handpieces
PIET10HE PIET10HELE
PIET10HES PIET10HELS
Replacement Piezo Handpieces Replacement Piezo Handpieces
Piezo Technologies Piezo Technologies
Non Optic Piezo Handpiece............. $244.96 Optic Piezo Handpiece..................... $293.96
Satalec Type................................(PIET10HE) EMS Type................................ (PIET10HELE)
Ems Type...................................(PIET10HES) Satalec Type............................ (PIET10HELS)
www.tricountydental.com | [email protected] 277
Preventives Hu-Friedy + EMS Piezo Tips are made from an exclusive stainless steel alloy. Intricate
manufacturing process with up to 31 production steps. Reproducible oscillation behavior
Hu-Friedy + EMS Piezo Scaling Tips due to high-precision fabrication. Fine surface due to special polishing process for long life.
Inspection of each tip before leaving the manufacturing facility.
Piezo# S10 P10 USU P 100 Thin Perio Tip USAFL USAFS USAFR
After 5
Description Universal Universal Universal Pro Universal Universal Subgingival After 5 Left Straight After 5 Right
EMS - - - - - DS011HF/HF - - -
Satalec/NSK HUFUSS10 HUFUSP10 HUFUSU HUFUSP HUFUS100 - HUFUSAFL HUFUSAFS HUFUSAFR
Price $88.16 $97.96
$88.16 $88.16 $97.96 $117.56 $102.86 $102.86 $102.86
Piezo# A 100M Perio Slim P3 4L 4R 2L 1D 2R
Universal Subgingival Thin Curette Curved Left Curved Right Left Diamond Straight Right Dia-
Description Supragingival Modified Diamond
UE100M - HUFUE1D mond
EMS DS001HF/HF HUFDS016HF/ HUFUEP3 - HUFUE2LD HUFUE2RD
- HF HUFUSP3 HUFUS4L HUFUS1D
Satalec/NSK - - $107.76 $107.76 HUFUS4R HUFUS2LD HUFUS2RD
Price $97.96 $107.76 $107.76 $122.46 $122.46
$137.16 $122.46
Satelec Acteon
SETELEC® has always designed tips that respect the tooth’s anatomy Color Coded Torque Wrenches
and vibrate in perfect harmony with the handpiece. In addition •S••a YGBteelrulelleeoecwn- HA--icLMgotheweoPdopniuwomwereprWofwohreerndseTulriicetaeattdemftoerrenaEtstnmddeoemnnttaiscnssdu. scha
to their expert design, our tips are manufactured using extremely as periodontics.
precise tolerances to assure they will work predictably, correctly and sustained effort
safely with your SATELEC® ultrasonic equipment. • Olikreansgcaeli-nHgi.gh Power for use with polymerization & loosening posts
& crowns
Torque Wrenches Each.....................$48.96
Green....................(SALF81320) Blue...................... (SALF81322)
Yellow...................(SALF81321) Orange.................. (SALF81323)
278 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Satelec Acteon Piezo Scaling Tips Preventives
SATELEC® has always designed tips that repect the tooth’s anatomy and vibrate in perfect
harmony with the handpiece. In addition to their expert design, our tips are manufactured
using extremely precise tolerances to assure they will work predictably, correctly and safely
with your SATELEC® ultrasonic equipment.
Scaling
Tip # No 1S No 1 No 2 No 3 No 10P No 10X No 10Z
Part # F00245 F00246 F00247 F00248 F00359 F00254
F00253 Subgingival
Description Supra & Subgingival Scaling Universal Scaling High Power Scaling Removing Stains Supra & Interproximal Scaling
Subgingival Scaling $117.56
Scaling<3mm
EMS $117.56 $97.96
Periodontics
Tip # H1 H2L H2R H3 H4L H4R P2L P2R
Part # F00366 F00369 F00114 F00115 F00090 F00091
F00367 F00368
Description Anterior Teeth Anterior Teeth
Diamond Molars & Molars & Premolars Curette Molars & Premolars Molars & Narrow Pock- Narrow Pock-
Price Premolars Diamond Right Left Premolars Right ets Left ets Right
Diamond Left
$117.56 $142.06 $142.06
Bio-Film
Disruption
(BDR)
Perio Soft
4 per Pack
Tip # TK1-1S TK1-1L TK2-1L TK2-1R PH1 PH2L PH2R IP1 IP2L IP2R IP3L IP3R
Part # F01001 F01004 F02162 F02161 F00702 F00705 F00706 F02121 F02124 F02125
Molars & F02122 F02123
Description Short Long Molars & Molars & Anterior Premolars Molars & Implant Med. Med. Narrow Narrow
Probe Probe Premolars Premolars Teeth Premolars Abutments Thread Thread Implants Implants
Price Left Implants Implants
Left Right $97.96 Right Left Rights Left Right
$137.16
$117.56 $142.06
Endo-success
Retreatment
Tip # ET18D ETBD ET20 ET25 ET25S ET25L ETPR
Part # F88011 F88018 F88021 F88022 F88019
Description F88017 F88020 Universal Short Ti-NB Tip Loosening
$107.76 Ti-NB Tip $132.26 Long Ti-NB Tip $107.76
Price Cavity Access Exploration
Finishing
$122.46
www.tricountydental.com | [email protected] 279
Preventives
Coltene Whaledent Ultrasonic Inserts
BioSonic Inserts are available with ergonomically designed handles to reduce finger fatigue,
or with SuperSoft cushion grips to enhance tactile sensitivity and rotational Control. BioSonic
Inserts come in a variety of the most popular tip designs in both 25kHz and 30 kH.
BioSonic Optimist Inserts BioSonic SuperSoft Inserts
Feature through-the-tip water delivery - SuperSoft cushion grips to enhance tactile
delivering water at the point of contact. sensitivity and rotational Control.
Specify #10 #10 Slim #1000 #10 Universal #10 Slim #10 Universal #10 Slim #10 Slim
Description Universal Universal Triple Bend Optimist Optimist SuperSoft SuperSoft Optimist
SuperSoft
30Hz COLUS1030K COLUS1030KSP COLUS100030K COLUS1030KOM COLUS1030KOS COLUSG1030K COLUSG1030KSP COLUSG1030KOS
25Hz COLUS1025K COLUS1025KSP COLUS100025K COLUS1025KOM COLUS1025KOS COLUSG1025K COLUSG1025KSP COLUSG1025KOS
Price $122.46 $137.16 $127.36 $156.76
Premier Ultrasonic Inserts
Premier ultrasonic inserts are precision engineered for optimal performance and extedned
wear. Compatible with all magnetostrictive (Cavitron Style) ultrasonic scalers. Premier inserts
come available in either a economical resin handle or in their “Big Easy” thicker sculpted
medical-grade silicone grip to cushion fingers and permit a firm grasp.
Resin Handle Inserts “Big Easy” Inserts Implant Insert P100 Insert
Economical line of Have a cushion-grip for The no-scratch tip Metal external water
maximum comfort and will safely and quickly
high quality ultrasonic clean around implants. flow insert.
Inserts. decreased fatigue.
Specify #10 #100 #1000 #10 #100 #1000 Implant #P100
Description Universal Thin Triple Bend Universal Thin Triple Bend Big Easy Straight
30Hz PRE1006900 PRE1006920 PRE1006901 PRE1005310 PRE1005330 PRE1005315 PRE1005336 PRE1006902
25Hz PRE1006800 PRE1006820 PRE1006802 PRE1005300 PRE1005320 PRE1005305 PRE1005326 PRE1006801
Price $88.16 $112.66 $146.96 $117.56
280 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Swivel Direct Flow Ultrasonic Inserts have a through-tip water delivery. This design focuses
the water flow directly to the tip, reducing excess spray and increased visibility. The grip is
18% larger than standard inserts - reduces finger pinching, resulting in less hand fatigue and
enhanced tactile sensitivity. The lightly textured grips provide secure, comfortable grasp and are
color-coded for easy tip identification.
Each...............................................$176.36
Specify #10 Universal #100 Thin #1000 Triple Xtra Thin Triple Bend Thin After Five After Five Left After Five Right
Bend Straight
30kHz UI30SD10 UI30SD100 UI30SSXT UI30SDXTTB UI30SDS UI30SDL UI30SDR
25kHz UI25SD10 UI25SD100 UI30SD1000 UI25SSXT - UI25SDS UI25SDL UI25SDR
UI25SD1000
Streamline Direct Flow Ultrasonic Inserts Streamline Direct Flow inserts offer efficent Each.............................................. $151.86
scaling at a great price. The through-tip water delivery offers a targeted water flow,
reduces excess spray and increases visibility. The comfortable wide diameter handle will
reduce finger pinching and ensure clinician comfort.
Specify #10 Universal #100 Thin #1000 Triple Xtra Thin Triple Bend Thin After Five After Five Left After Five Right
UI30SF100 Bend UI30SFXT Straight UI30SFL UI30SFR
30kHz UI30SF10 UI30SFXTTB UI30SFS
25kHz UI25SF10 UI30SF1000 -
UI25SF100 UI25SF1000 - UI25SFS UI25SFL UI25SFR
Streamline Ultrasonic Inserts......... $142.06 Original Prophy Plus...................... $166.56
Original Prophy............................. $156.76
Specify #10 Universal #100 Thin #1000 Triple Bend #3 Beavertail Original Prophy Plus #10 Original Prophy #10
30kHz UI1030K UI30K100S UI100030K UI330K UI30KP10P UI30KP10
25kHz UI1025K UI25K100S UI100025K UI325K UI25KP10P UI25KP10
After Five Plus+ Ultrasonic Inserts. $156.76 After Five Ultrasonic Inserts........... $156.76
Specify After Five + After five + Left After Five + Right After Five Straight After Five Left After Five Right
Straight
30kHz UI30KSL10R
25kHz UI30KSF10S UI30KSF10L UI30KSF10R UI30KSL10S UI30KSL10L UI25KSL10R
UI25KSF10S UI25KSF10L UI25KSF10R UI25KSL10S UI25KSL10L
www.tricountydental.com | [email protected] 281
Preventives
Ultrasonic Scaling Units
BioSonic US100R Swerv3 Ultrasonic Scaler System Turbo Sensor Ultrasonic Scaler
Ultrasonic Scaler Parkell
Hu-Friedy The Parkell Turbo Sensor is an autotune mag-
Coltene Whaledent The new Hu-Friedy SWERV3 magnetostrictive netostrictive ultrasonic scaler that operates
The improved BioSonic® US100R Ultrasonic 30K scaler combines power and handling automatically detects whether the hand-
Scaler provides better water flow control, in a unique ergonomic design. In light of piece contains a 25 kHz or 30 kHz insert, and
kink-resistant handpiece cord and improved advances in ultrasonic technology, power switches to the correct operating frequency.
output power making it even better for scaling instruments are new indicated for The Turbo Sensor also provides a higher
your sub- and supragingival hygienic scaling the removal of all types of deposits and maximum power setting for extreme calculus
needs. The lower power range keeps the biofilm, and should be considered to have a •b laPsotiwnegr.s any 25 kHz or 30kHz compatible
patient’s comfort in mind. The US100R ac- primary role in periodontal debridment. The • iAnusteormt atically switches frequently to
commodates both 25 kHz and 30 kHz inserts Hu-Friedy SWERV3 magnetostrictive power • Cmoamtcphatchte- insert
allowing either insert type to be used. New scaler offers finely tuned electronics, delivers doesn’t take up valuable count-
uni-directional foot pedal makes operating a full range of power for superior efficacy, ••• EeEFoxxrptoseaptrnacndcoaeenl dtwrolaoltlweerd-fitplutoerwbroeprrpepovewernieotrsmbcooloodgsest and
the US100R even easier. Large, easy-to-use provides unrivaled patient comfort, and • dCroimpppinacgt - doesn’t take up valueable
dials for controlling both the ultrasonic enables superior clinician comfort. SWERV3 •• 5Fcoo-uoYntetcaeorrnWstpraoarlcrleeadnttyuorbnoppoowweerrubnoitost
power and water supply. The unit is also is also compatible with the inserts produced
equipped with a “Turbo” button to instant- by all major magnetostrictive scaling unit (PARD560)....................................... $783.96
ly set maximum power without having to
re-adjust the preferred power settings. The •••m••• aACCTTFoonioounuuumlteoofcclarfhhy--ocp--cttrppuouutaaradnrgddbeeeerldccdesfoo.ulehinngnlattehcrrncoottditellorsspdoninedciicsesplay Contains:TurboSENSOR™ Ultrasonic Scaler - Includes two
unit’s small footprint facilitates placement in Each ........................................... $2,449.96
autoclavable handpiece sheaths, in-line water filter with spare
••••an EOAPycrcfooofcepvnorieomsdrmeapostridoceiaamrctyliesp.-esr5o2w0v5%aektdelHerpzsafslatoienewxdnpct3eo0cnnosktmiHrvoefzol tirnhtsaenrts 30kHz Swerv3 ......................... (HUFUM330)
• c2o-mYepaertiWtoarsrranty 25kHz Swerv3.......................... (HUFUM325) disk, quick-disconnect water connection and foot controller.
(COLUS100R) .................................. $979.96
Contains: Swerv3 Scaling Unit, Swerv3 Handpiece and Cord TurboVue Illuminated (30kHz) Scaler
Contains: Biosonic US100R unit, #10 Slim 30K insert
Assembly, Foot Control, Power. (PARD570)................................... $1,077.96
(US1030KSP), handpiece assembly, foot control, quick
Contains:TurboVue 30KHz scaler with attached handpiece,
connect and owener’s guide.
foot control, water line. In-line water filter with spare disk quick
connect, and power transformer.
282 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Preventives
Lil’ Beaver 2.0 Ultrasonic Scaler Beaver Elite 2.0 Ultrasonic Scaler Autoscaler Ultrasonic Scaler
Vector USA Vector USA
The Lil’ Beaver 2.0 ultrasonic scaler is The Beaver Elite 2.0 ultrasonic scaler includes South East Instruments
designed for use in prophylaxis periodontia all the features of the Lil’ Beaver 2.0 with the AUTOSCALER® is American made for high
treatments, and other areas of operative additional feature of the fully self-contained quality, and as the professional you get an
dentistry. The unit operates with a fine warm water delivery system. The on-board pump outstanding product. Over 35 years of design
spray, requiring little of the physical exertion provides a constant flow of either water or experience is incorporaated in the AUTO-
necessary with and treatments. It easily and medicaments through the scaling unit to the SCALER®. Features include a detachable
effectively removes stubborn calculus and tip and oral cavity. The dual-bottle system handpiece assembly (not shown in photo
stains both supragingivally and subingivally, with selector switch is ideally suited for attaches to the front left side of console),
leaving crown and root surfaces clean and either water or medicament solution delivery precision tuning and water pressure flow
s•m Aococtehp.ts both 25K and 30K ultrasonic during treatment. Easily move the unit from regulation to ensure precise delivery of water
o• pA-tcoc-eopptswbitohtha built in carry handle. during procedures. The AUTOSCALER® is
• Finrsoenrtt-sm. ounted water control with easy-to- 25K and 30K ultrasonic a great value! It is designed to accept and
• Tinusrebrotsb. oost, 2 positon foot pedal - press function efficiently with most major brand
• Taudrjubsotbdoiaols. t, 2 position foot pedal - press lightly for regular dial power, press firmly magnetostrictive insert tips. The AUTOSCAL-
lightly for regular dial power, press ffirmly • fDouraTlusreblfo!contained bottle with on-board ER® was rated Excellent among 15 other
• Afollr Turbo! competitors by a leading research institute.
aluminum housing for improved du- pump. No water supply needed - just plug Our founder is one of the original design
rability. No more plastic to stain, crack or • Sinelaencdtogros!witch allows the user to switch pioneers of ultrasonic instruments since the
• bLireesafkl.at or mounts vertically in provided
from bottle A to bottle B, doubling the 1•••9 P2P6rr0-ee’Yscce,iissaaiioornnndWWAhauorartltdaoensmrtUyCanto(ii6nctetyTrdeuoanSl ritnawgteasrrpaantteynotns.
vertical mounting stand for optimal count- amount of water or allowing one bottle to
• e1r-sYpeaacreWsaavrrinagn.ty • b1e- filled with an irrigant. circuit boards)
Year Warranty
Each................................................ $636.96
Each................................................ $489.96 Each................................................ $734.96
30kHz Autoscaler ........................ (SOU3000)
White - Lil Beaver 2.0 ...................(VEC8745) White - Beaver Elite 2.0 ...............(VEC9111) 25kHz Autoscaler......................... (SOU2500)
Black - Lil Beaver 2.0.....................(VEC8720) Black - Beaver Elite 2.0.................(VEC9100)
Contains:Unit, Foot control, Detachable handpiece, and
Contains:Lil’ Beaver Scaling Unit, Power Cord, 2 Position Contains:Lil’ Beaver Scaling Unit, Power Cord, 2 Position instruction manual.
Turbo Boost Foot Pedal, 1/4” Water Line w/Quick-Disconnect, Turbo Boost Foot Pedal, 1/4” Water Line w/Quick-Disconnect, Handpiece Assembly 25/30
(SOUHP127A).................................. $225.36
Vertical Mount Stand, Handpiece Holder Mount, Autoclavable Vertical Mount Stand, Handpiece Holder Mount, Autoclavable
Handpiece Sheath Handpiece Sheath
www.tricountydental.com | [email protected] 283
Retraction Materials
Retraction Cords Each.................................................$11.95
#00 Very Thin........................ (GIN12170M)
#1 Thin.................................. (GIN12171M)
#2 Medium............................ (GIN12172M)
#3 Thick................................. (GIN12173M)
Z-Twist Plain #000 Ultra Thin - 108”
(GIN1117TM)....................................$11.95
Roeko Stay-Put Retraction Cord Soft-Twist Cord Z-Twist - 108”
Coltene Whaledent Gingi-Pak Each.................................................$10.95
Stay-put combines the advantages of a Gingi-Pak MAX Soft-Twist cord is firmly
braided retraction cord with the adaptability twisted for easy packing, yet absorbent #00 Very Thin........................ (GIN11170M)
of a fine metal filament. The pliable core is and adaptable to the sulcus. Made of 100% #1 Thin.................................. (GIN11171M)
so effective that the cord is not only easy to cotton, the cord stays positioned and will not #2 Medium............................ (GIN11172M)
place in the sulcus but it stays there. pop out of the sulcus. Soft-Twist cords, of- #3 Thick................................. (GIN11173M)
72” per Bottle.................................... $16.95 fered in 3 sizes, are suitable for all techniques
#0 X-Fine......................................(COL2100) including the 2-cord technique. KnitTrax
#1 Fine.........................................(COL2101) Soft-Twist with Epinephrine - 108”
#2 Medium...................................(COL2102) Each.................................................. $11.95 Pascal
#3 Thick........................................(COL2103) #1 Thin....................................(GIN10105M) 100% cotton, knitted chains prevent cord
#2 Med....................................(GIN10110M) from dislodging or unraveling and fraying
Original Cord #3 Thick...................................(GIN10115M) during the packing procedure. Non-im-
pregnated and can be soaked in hemostatic
Gingi-Pak Soft-Twist Plain - 108” agents of choice for conventional cord pack-
The soft 2-ply and 4-ply cords are loosely ing techniques. 100 inches of cord.
wound and the strands are easily separat- Each.................................................. $10.95 100” per Bottle
ed, twisted or combined to make it readily Each.................................................. $11.95
adaptable for use in the gingival sulcus, #1 Thin....................................(GIN11105M) #000 Ultra Thin........................... (PAS07569)
regardless of the sulcus size and is suitable #2 Med....................................(GIN11115M) #00 Very Thin............................. (PAS07570)
for all techniques, including the 2-cord #3 Thick...................................(GIN11110M) #0 Thin....................................... (PAS07575)
technique. #1 Medium................................. (PAS07580)
Max 2-Ply with Epinephrine - 108” #2 Thick...................................... (PAS07585)
(GIN10120M)..................................... $11.95
Max 2-Ply Plain- 108” Z-Twist Cord Pascord
(GIN10120M)........................................$9.95
Crown-Pak 4-Ply w/Eprinephrine - 108” Gingi-Pak Pascal
(GIN10120M)..................................... $19.95 Gingi-Pak MAX Z-Twist Weave is a Racord® Impregnated with a solution of
Cotton Coil w/Eprinephrine - 24” Vial fourth-generation, state-of-the-art retrac- aluminum sulfate, then dried by a special
(GIN10120M)..................................... $17.95 tion material. It’s unique braided configu- process, ensuring both consistent aluminum
ration gives the 100% cotton cord excellent solfate content and hemostatic retraction
handling characteristics that packs easily properties.
and remains in place. The tight weave resists 72” per Bottle
penetration by even the smallest of pack- Each.................................................. $11.95
ing instruments. The cords’ dark colors are #7 Ultra Thin.............................. (PAS07597)
easily seen in the sulcus. Available in 5 sizes, #8 Thin....................................... (PAS07600)
including the NEW #000 Z-Twist, which are #9 Medium................................. (PAS07610)
ideal for all techniques, including the 2-cord #10 Thick.................................... (PAS07620)
technique.
Z-Twist with Epinephrine - 108”
Each................................................ $11.95
#00 Very Thin........................ (GIN10170M)
#1 Thin.................................. (GIN10171M)
#2 Medium............................ (GIN10172M)
#3 Thick................................. (GIN10173M)
Z-Twist with Aluminum Sul - 108”
284 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Retraction Materials
Racord Sil-Trax Plain Sil-Trax Plus
Pascal Pascal Pascal
Racord® Retraction Cord is saturated with a Sil-Trax® Plain is a nonmedicated braided Sil-Trax® Plus is a braided 100% cotton retrac-
solution of stabilized epinephrine hydrochlo- retraction cord that may be soaked in a he- tion cord saturated with both epinephrine
ride and dried in a special process to ensure mostatic agent. This cotton cord is memory hydrochloride and zinc phenolsulfonate, then
both consistent epinephrine content and free for precise placement and retention in dried by a special process.
excellent hemostatic retraction properties. the sulcus. 72” per Bottle
72” per Bottle 100” per Bottle Each.................................................. $11.95
Each.................................................. $12.95 Each.................................................. $10.49 #7 Ultra Thin.............................. (PAS07297)
#7 Ultra Thin.............................. (PAS07697) #7 Ultra Thin.............................. (PAS07397) #8 Thin....................................... (PAS07300)
#8 Thin....................................... (PAS07700) #8 Thin....................................... (PAS07400) #9 Medium................................. (PAS07310)
#9 Medium................................. (PAS07710) #9 Medium................................. (PAS07410) #10 Thick.................................... (PAS07320)
#10 Thick.................................... (PAS07720) #10 Thick.................................... (PAS07420)
Knit-Pak Knit-Pak+
Racord Two Sil-Trax Aluminum Sulfate Knit-Pak
Pascal Pascal Premier Dental
Racord® Two Retraction Cord is a combina- Sil-Trax® Aluminum Sulfate Gingival Re- Knit-Pak® gingival retraction cord is a non-im-
tion of vasoconstritor and astringent action traction Cord is used for patient situations pregnated knitted cord made from 100%
in one cord. Racord® Two is impregnated where gingival retraction material containing cotton.
with a solution containing both racemic epi- epinephrine is contraindicated. 100” per Bottle
nephrine hydrochloride and zinc phenolsul- 72” per Bottle Each.................................................. $10.95
fonate, and then dried by a special process. Each.................................................. $11.95 Size 000 - Green...................... (PRE9007551)
72” per Bottle #7 Ultra Thin.............................. (PAS07097) Size 00 - Brown....................... (PRE9007552)
Each.................................................. $11.95 #8 Thin....................................... (PAS07100) Size 0 - Purple......................... (PRE9007553)
#7 Ultra Thin.............................. (PAS07797) #9 Medium................................. (PAS07110) Size 1 - Blue............................ (PRE9007554)
#8 Thin....................................... (PAS07800) #10 Thick.................................... (PAS07120) Size 2 - Orange........................ (PRE9007555)
#9 Medium................................. (PAS07810) Size 3 - Yellow......................... (PRE9007556)
#10 Thick.................................... (PAS07820)
Retrax Sil-Trax EPI Knit-Pak+
Pascal Pascal Premier Dental
Non-medicated retraction cord. Unique pack- Sil-Trax® EPI is a gingival retraction cord Knit-Pak+ is a knitted restraction cord
aging prevents cord tangles and cord will not impregnated with a solution of stabilized manufactured from unique microfibers. The
fall back into bottle. Memory free for precise epinephrine hydrochloride, the dried by a fibers are distinguished by having very low
placement and retention in the sulcus. special process, ensuring both consistent moisture content with high durability and
100” per Bottle epinephrine content and excellent hemostat- retention properties. These attributes create
Each.................................................. $10.49 ic retraction properties. a retraction cord with superior absorbency
#7 Ultra Thin.............................. (PAS07897) 72” per Bottle and a pliable structure that resists fraying.
#8 Thin....................................... (PAS07900) Each.................................................. $12.49 80” per Bottle
#9 Medium................................. (PAS07910) #7 Ultra Thin.............................. (PAS07197) Each.................................................. $12.95
#10 Thick.................................... (PAS07920) #8 Thin....................................... (PAS07200) Size 000.0 - Green................... (PRE9007560)
#9 Medium................................. (PAS07210) Size 000 - Green...................... (PRE9007561)
#10 Thick.................................... (PAS07220) Size 00 - Brown....................... (PRE9007562)
Size 0 - Purple......................... (PRE9007563)
Size 1 - Blue............................ (PRE9007564)
Size 2 - Orange........................ (PRE9007565)
www.tricountydental.com | [email protected] 285
Retraction Materials
Cord-Packing Instruments
#113 - Serrated Traxodent Racegel
Balshi
Premier Dental Septodont
CSI1 Traxodent has a 15% aluminum chloride Gingival preparation/hemostatic material
Guyer 7 retraction paste packed in sleek 0.7g syringes controls fluids prior to impression taking.
with bendable tips for easy access. Traxodent Formula contains 25% aluminum chloride,
S6 has the absorbent paste displaces soft tissue which is clinically proven for its astringent
and works synergistically with the astringent properties. The bright orange color makes it
Cord Packers properties of aluminum chloride to create easy to dispense, place and rinse while caus-
retraction. ing no machanical trauma to the gingiva.
Hu-Friedy
Each.................................................. $31.95 Starter Package Complete Kit
#113 - Serrated........................(HUFGCP113)
Balshi......................................(HUFGCPBAL) (COL9007093).................................... $79.95 (SEPC0500)........................................ $83.95
CSI1 - Serrated........................(HUFGCPCSI1)
Guyer#7 - Serrated................... (HUFGCPG7) Contains:7 - 0.7Gm. Syringe & 15 - applicator tips. Contains: 3 - 1.4 Gm. Syringes & 30 prebent application tips.
#S6............................................(HUFGCPS6)
Value Package
(COL9007091).................................. $219.95
Contains:25 - 0.7 Gm. Syringes & 50 - applicator tips.
Unit Dose Package
(COL9007094) 24/Pk.......................... $74.95
Unit Dose Dispenser
(COL9007089) 3/Pk............................ $89.95
Applicator Tips
(COL9007092) 50/Pk.......................... $34.95
Retraction Systems Hemostatic Solutions Quick-Stat Free Clear
Magic Foamcord Hemodent Liquid Vista Dental
Quick-Stat Free is a 25% Aluminum Chlo-
Coltene Whaledent Premier Dental ride with a proprietary blend of hemostatic
Is the first expanding PVS material designed Hemodent effectively stops minor gingival agents controls minor bleeding during
for easy and fast retraction of the sulcus bleeding. It contains no epinephrine to help impressions, restorations, crown and bridge
without the potentially traumatic and time avoid cardiac reactions. Hemodent is stable procedures.
consuming packing of cord. and offers a long shelf life.
Intro Kit (PRE9007071) 10cc............................ $14.95 Standard Kit
(COLC6735)...................................... $174.95 (PRE9007072) 20cc............................ $26.95
(PRE9007073) 40cc............................ $46.95 (VIS504600)....................................... $16.95
Contains:50 ml FoamCord (2x 50ml), 30 Mixing Tips (C6550),
30 Oral Mixing Tips (C6555), 1 comprecap Anatomic set ( 10 Contains: 4-1.2ml Prefilled syringes, 8- Stat-Flo Tips.
of each size: #1, #3, #5), 1 Instructions for use.
Value Pack
Refill Package
(VIS504640)....................................... $96.95
(COLC6737)...................................... $139.95
Contains: 40 - 1.2ml Prefilled syringes, 50 - Stat-Flo Tips.
Contains:2-50mL refills 1 - Instructions for use.
Bulk Syringe
(VIS504660)....................................... $29.95
Contains: 1 - 30ml Prefilled syringe, & docking port.
(VIS504650)....................................... $39.95
Contains: 1 - 30ml Prefilled syringe, 1 - docking port, 20 - Stat-
Flo Tips, & 20 - 1.2ml empty syringes.
286 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Retraction Materials
Applicator & Dispensing Tips
Stat-Flo
Application Tips
Septodont
Ideal for use with Vista’s Quick-Stat Ferric
Sulfate and with Quick-Stat FREE Hemostatic
Gel.
Curved Bristle Tips 19G - Yellow
(SEP312100) 100/Pk.......................... $55.95
Pellets & Cotton
Roeko Comprecap
Coltene Whaledent
ROEKO Comprecap compression caps stop
bleeding naturally - by compression and con-
trol moisture. The use is simple and supports
impression preparation regardless of the
retraction technique.
Assortment Kit
(COL530000) 150/Bx.......................... $30.95
Contains: 7mm, 10mm & 12.5mm
Comprecap Refills #1-7mm (Small)
(COL530008) 120/Bx.......................... $25.95
(COL531008) 600/Bx........................ $103.95
#3-10mm (Medium)
(COL530010) 120/Bx.......................... $27.95
(COL531010) 600/Bx........................ $125.95
#5-12.5mm (Large)
(COL530014) 60/Bx............................ $20.95
(COL531014) 400/Bx.......................... $97.95
www.tricountydental.com | [email protected] 287
Rubber Dam
Dental Dam
Hygenic Dental Dam Hygenic Dental Dam Elasti-Dam
Coltene Whaledent Coltene Whaledent Coltene Whaledent
Hygenic Dental Dam is made of pure, natural ELASTI-DAM is a low protein, powder-free
rubber latex. Tough and hard to tear, the Convenience Packages dam that offers low modulus for easier
powdered material is used as a barrier during stretching and placement over clamps.
operative and endodontic procedures. Thin Guage 5x5.................................. $99.95 Elasti-Dam is supplied in popular Greenmint
scented or Blue-vanilla scented colors in
Ready Cut 1 Sq. Yd. 5 x 5 Light................................ (COLH04236) either Medium or Heavy gauge.
5 x 5 Green.............................. (COLH04240) 1 sq. yd.
Thin Guage........................................ $16.95 Medium Guage.................................. $18.95
Contains: 5x5 = 7sq. yd. 5 x 5 Green.............................. (COLH11624)
5 x 5 Light................................ (COLH00523) 5 x 5 Blue................................. (COLH11626)
5 x 5 Green.............................. (COLH02141) Medium Guage 5x5......................... $109.95 6 x 6 Green.............................. (COLH11625)
6 x 6 Light................................ (COLH00533) 6 x 6 Blue................................. (COLH11627)
6 x 6 Dark................................ (COLH00538) 5 x 5 Light................................ (COLH04237) Heavy Guage..................................... $20.95
6 x 6 Green.............................. (COLH02146) 5 x 5 Dark................................ (COLH04239) 5 x 5 Green.............................. (COLH11675)
5 x 5 Green.............................. (COLH04241) 5 x 5 Blue................................. (COLH11677)
Medium Guage.................................. $18.95 6 x 6 Green.............................. (COLH11676)
Contains: 5x5 = 7sq. yd. 6 x 6 Blue................................. (COLH11678)
5 x 5 Light................................ (COLH00524)
5 x 5 Dark................................ (COLH00529) Thin Guage 6x6................................ $149.95 Contains: 1sq.yd. 5x5=52 sheets; 6x6=36 sheets.
5 x 5 Green.............................. (COLH02142)
5 x 5 Blue................................. (COLH03529) 6 x 6 Light................................ (COLH04242) Fiesta Dental Dam
6 x 6 Light................................ (COLH00534) 6 x 6 Dark................................ (COLH04246)
6 x 6 Dark................................ (COLH00539) Coltene Whaledent
6 x 6 Green.............................. (COLH02147) Contains: 6x6 = 10sq. yd. Natural rubber latex dam is supplied scented
6 x 6 Blue................................. (COLH03530) for greater patient and staff comfort. Each
Medium Guage 6x6......................... $164.95 cox contains an assortment of purple, clue
Heavy Guage..................................... $20.95 and pink colored sheets with a fresh fruit
6 x 6 Light................................ (COLH04243) scent.
5 x 5 Light................................ (COLH00525) 6 x 6 Dark................................ (COLH04245) 1 sq. yd.
5 x 5 Dark................................ (COLH00530) 6 x 6 Green.............................. (COLH04247) Thin Guage........................................ $17.95
5 x 5 Green.............................. (COLH02143) 5 x 5 Green.............................. (COLH04640)
5 x 5 Blue................................. (COLH07314) Contains: 6x6 = 10sq. yd. 6 x 6 Blue................................. (COLH04639)
6 x 6 Light................................ (COLH00535) Medium Guage.................................. $19.95
6 x 6 Dark................................ (COLH00540) 5 x 5........................................ (COLH04641)
6 x 6 Green.............................. (COLH02148) 6 x 6........................................ (COLH04642)
6 x 6 Blue................................. (COLH07315) Heavy Guage..................................... $22.95
5 x 5........................................ (COLH04643)
Extra Heavy Guage............................ $22.95 6 x 6........................................ (COLH04644)
5 x 5 Light................................ (COLH00526)
5 x 5 Dark................................ (COLH00531)
5 x 5 Green.............................. (COLH02144)
6 x 6 Light................................ (COLH00536)
6 x 6 Dark................................ (COLH00541)
6 x 6 Green.............................. (COLH02149)
Contains: 1 Sq. Yd. 5x5=52 sheets; 6x6= 36 sheets
288 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Rubber Dam
Non-Latex Dental Dam Non-Latex Framed Flexi Dam Safe Touch Dental Dam
Coltene Whaledent Coltene Whaledent Medicom
This 100% latex free dental dam has similar Forget the time-consuming and tech- Maximum barrier protection and isolation
tear resistance to natural rubber latex with- nique-sensitive fitting of a frame! The of operating worksite reduces vross-con-
out any patient/staff reactions. It is pow- Hygenic Framed Non-Latex Flexi Dam is now tamination by controlling moisture. Next
der-free, color reflective and has a minimum available with an ultra-convenient, built-in- generation, built-in strength and improved
of three years shelf life. It is easy to apply frame! The flexible frame is designed with a tear resistance save time and avoid potential-
and used for improved patient comfort and convenient working size of 100mm x 105mm ly costly wastage. Made with natural rubber
enhanced view of working field. to ensure for easy placement without getting latex.
5x5 Teal/ Green in the way. The smooth surface of the plastic Thin Guage...........................................$8.95
(COLH09928)..................................... $26.95 frame helps to maximize patient comfort Unscented-Blue...........Mint Green
6x6 Teal/ Green when positioned on their skin. 5x5 (MED7030)........... (MED7014)
(COLH09105)..................................... $31.95 5x6 Purple......................................... $59.49 6x6 (MED7033)........... (MED7020)
6x6 Green-Convenience Package 20 Per Box............................... (COLH00750) Medium Guage.....................................$9.95
(COLH09106)................................... $149.95 Unscented-Blue...........Mint Green
5x5 (MED7035)........... (MED7012)
6x6 (MED7037)........... (MED7018)
Heavy Guage..................................... $10.95
Unscented-Blue...........Mint Green
5x5 (MED7038)........... (MED7010)
6x6 (MED7039)........... (MED7016)
Non-Latex Flexi Dam MiniDam Insti-Dam
Coltene Whaledent DMG America Zirc
Hygenic Non-Latex Flexi Dams are non-la- MiniDam is a silicone-based gingival protec- Built in flexible frame with pre-punched hole.
tex dental dams that offer great strength tion device that protects the proximal area Ideal for isolating anterior teeth. Compact
and high elasticity while maximizing clinical during treatment quickly, easily and most design fits outside patient lips. Easy to use,
success. They provide greater visibility and importantly, comfortably for the patient. The non-threatening and comfortable.
access to the work site by eliminating inter- DMG MiniDam’s innovative design ensures Latex-Free Insti-Dam (Blue)................ $49.95
ference from patients tongue or cheek. that the site being treated is kept relatively 20 Per Pk.................................(MED50Z459)
6x6 30 Per Box................................... $42.95 dry while protecting the gingiva from the ma- Latex Insti-Dam (Natural)................... $46.95
Purple..................................... (COLH09945) terials that coud cause harm such as, etching 20 Per Pk.................................(MED50Z455)
Teal/Green.............................. (COLH09946) gel. The DMG MiniDam can be placed in just Relaxed Fit Insti-Dam-Latex Free........ $59.95
a few seconds and stabilizes itself without 20 Per Pk.................................(MED50Z457)
the use of clamps, while still allowing open
acess to the treatment. area.
20 Per Box............. (COL220381)........ $27.95
www.tricountydental.com | [email protected] 289
Rubber Dam
Dental Dam Accessories
Ora-Shield Rubber Dam Napkins Endo Nylon Rubber Dam Frame U of W Clamp Forcep
Coltene Whaledent Young Dental U of W Clamp Forcep are used to place rub-
Soft dental dam napkins to avoid direct con- Radiolucent. Lightweight. Virtually unbreak- ber dam clamps prior to a dental procedure.
tact of dental dam with sensitive skin. Made able Model#2210 - 11 Tines.
of special, non-woven fabric in both frame (YOU171401)..................................... $16.95 Miltex $149.95
sizes, for use with standard frames or larger (MIL7615)........................................
size for use with a strap-holder. Maximum Rubber Dam Instruments
absorption of saliva, water and perspiration. Lightweight Clamp Forcep
Frame Size Ainsworth Rubber Dam Punch
50/Pk..............(COLH01415).............. $18.95 Lightweight Clamp Forceps are used to place
Holder Size Miltex rubberdam clamps prior to a dental procedure.
50/Pk..............(COLH00841).............. $24.95 Ainsworth Style Rubber Dam Punches are Miltex
used to punch holes in rubber dam materi-
Dental Dam Frames al. Select from five different punch sizes to (MIL7623).......................................... $46.49
ensure the proper fit.
(MIL766)............................................ $89.95
Hygenic Plastic Dental Dam Rubber Dam Punch Ivory Clamp Forcep
Frames
Hu-Friedy Heraeus Kulzer
Coltene Whaledent A pupular rubber dam clamp accessory, this Selective positioning and fixing of the
U-shaped plastic frame --radiolucent & classic punch is solidly built to for lasting clamps. Handmade. Stainless steel. Autoclav-
autoclavable. longevity. able.
5” Plastic - For 5x5 Dental Dam (HUFRDP)........................................ $224.95 (HER50057220).................................. $79.95
(COLH01416)..................................... $14.95
6” Plastic - For 6x6 Dental Dam
(COLH01414)..................................... $14.95
Ostby Plastic Circle Style-Frame
(COLH00560)..................................... $19.95
Ivory Style Rubber Dam Punch
Ivory Style Dam Punches are used to punch
holes in rubber dam material. Select from
five different punch sizes to ensure the
proper fit.
Miltex
(MIL7611).......................................... $89.95
Metal Dental Dam Frame Heraeus Kulzer
Miltex (HUF50057225)............................... $169.95
Stainless steel frame and pins.
(MIL7625).......................................... $14.95
290 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Rubber Dam
Ivory Rubber Dam Clamps Molars - Winged #11..................................... (HER50057342)
Heraeus Kulzer #26..................................... (HER50057370)
Heraeus manufactures many styles of Each................................................ $12.95 #27..................................... (HER50057372)
uniquely designed Ivory Rubber Dam Clamps Specialty Clamps Molars - Wingless
to meet the most demanding situations. You #3....................................... (HER50057322)
will find one of these clamps suitable for #4....................................... (HER50057324) Each.................................................$16.95
•p raTchteictaellnyseiovneroyf application. #7....................................... (HER50057328)
each clamp is meticulously #8....................................... (HER50057334) #W4................................... (HER50057524)
hand-set in our factory and is appropriate #8A.................................... (HER50057336) #W5................................... (HER50057526)
for the tooth on which it is designed to be #12A................................... (HER50057348) #W7................................... (HER50057528)
•• DHusieeea-dtcutrteated #13A................................... (HER50057352) #W8................................... (HER50057534)
Starter Kit #14..................................... (HER50057354) #W14................................. (HER50057554)
#14A................................... (HER50057356) #W56................................. (HER50057568)
(HER50057968).................................$89.49 #56..................................... (HER50057374) #26N.................................. (HER50057728)
#28N.................................. (HER50057732)
Contains: 8 clamps: 0, 2, 2A, 7, 8A, 9, 14 and 14A #W3
#56T
Premolars - Winged Molars - Wingless
#W3................................... (HER50057522) Labial - Winged
Each.................................................$12.95 #W8A................................. (HER50057536)
#W14A............................... (HER50057556) Each.................................................$16.49
#00..................................... (HER50057302) Specialty Clamps Premolars - Winged
#0....................................... (HER50057304) #6....................................... (HER50057382)
#1....................................... (HER50057306) Each.................................................$16.95 #9....................................... (HER50057384)
#2....................................... (HER50057310) #W7................................... (HER50057528)
#2A.................................... (HER50057312) #1A.................................... (HER50057308) Tiger - Clamps
Premolars - Wingless Tiger clamps have serrated jaws.
Premolars-Wingless #W0................................... (HER50057504)
#W2................................... (HER50057510) #W1................................... (HER50057506) Each.................................................$21.95
#W2A................................. (HER50057512) #W27N............................... (HER50057730)
Molars - Winged #1T..................................... (HER50057841)
#2 #W2 #5....................................... (HER50057326) #2T..................................... (HER50057843)
#7A.................................... (HER50057330) #2AT................................... (HER50057847)
#10..................................... (HER50057338) #9T..................................... (HER50057855)
#14T................................... (HER50057849)
#14DT................................. (HER50057857)
#56T................................... (HER50057853)
Ivory Rubber Dam Clamps General Molars - Winged #14 Upper Molars - Wingless #26N
#8A................... (HUFRDCM8A) #W4.................(HUFRDCMW4) #12A
Hu-Friedy #8AD...............(HUFRDCM8AD) #18 #26N...............(HUFRDCM26N) #W7
Hu-Friedy Rubber dam clamps are made of #10.................... (HUFRDCM10) #4 #30.................... (HUFRDCM30) #W9
Satin Steel. The Satin Steel matte finish was #11.................... (HUFRDCM11) #31.................... (HUFRDCM31) #212
designed to reduce the reflection of operato- #14.................... (HUFRDCM14) Lower Molars - Winged
ry lights, which can help reduce eye fatigue #14A................ (HUFRDCM14A) #3........................ (HUFRDCM3)
#27.................... (HUFRDCM27) #7........................ (HUFRDCM7)
Each.................................................$13.49 #56.................... (HUFRDCM56) #7A................... (HUFRDCM7A)
Premolars - Winged #56S................ (HUFRDCM56S) #12A................ (HUFRDCM12A)
#0........................ (HUFRDCM0) #1 General Molars - Winged #13A................ (HUFRDCM13A)
#W8A............ (HUFRDCMW8A) #26.................... (HUFRDCM26)
#1........................ (HUFRDCM1) #W14A.........(HUFRDCMW14A) Lower Molars - Wingless
#1A................... (HUFRDCM1A) #18.................... (HUFRDCM18) #W3.................(HUFRDCMW3)
#2........................ (HUFRDCM2) #24.................... (HUFRDCM24) #W7.................(HUFRDCMW7)
#2A................... (HUFRDCM2A) #25.................... (HUFRDCM25) #28.................... (HUFRDCM28)
#2AS................ (HUFRDCM2AS) Upper Molars - Winged Anterior - Winged
#209................ (HUFRDCM209) #4........................ (HUFRDCM4) #00.................... (HUFRDCM00)
#5........................ (HUFRDCM5) #6........................ (HUFRDCM6)
Premolars - Wingless #27N #8........................ (HUFRDCM8) #9........................ (HUFRDCM9)
#W2.................(HUFRDCMW2) #201................ (HUFRDCM201) #9S.................... (HUFRDCM9S)
#27N...............(HUFRDCM27N) #205................ (HUFRDCM205) Anterior - Wingless
#29.................... (HUFRDCM29) #212................ (HUFRDCM212)
#212SA........ (HUFRDCM212SA)
www.tricountydental.com | [email protected] 291
Surgical Products
Bone Grafting Materials
Foundation HeliMed HeliPlug
Miltex
J. Morita USA Miltex HeliCOTE® is an absorbable wound dressing
Foundation is a revolutionary bone augmen- The HeliMend and HeliMend Advanced made of collagen abtained from bovine deep
tation material for use after teeth ex- absorbable collagen are made from puri- flexor (Achilles) tendon. The soft, white,
tractions. Collagen-based, it provides support fied bovine tendon. The product provides pliable and nonfriable material is used to
for implants, bridges, and dentures. Imme- wound stabilization and creates space during help control bleeding, develop blood clots
diately following an extraction, foundation is guided tissue regeneration procesures where and protect the wound site in order for the
placed into the socket. The surrounding cells a longer absorbtion rate is desired. The •h eRaleinagbsporrobceedssbtyotbheegbino.dy in 10 to 14 days
and capillaries gradually infiltrate foundation. HeliMend collagen membrane is absored in after placement
As the extraction socket heals, it is filled 4 to 8 weeks; while the HeliMend Advanced • Packaged in individual clam shells with an
with new augmentaed bone. Foundation is collagen membrane is absorbed in 18 weeks. easy-to-peel backing.
shaped in “bullet” form for easy placement. The product is easy to use and has excellent 3/4” x 1 1/2”
handling characteristics. The membrane is
I••t iMSsmaevadaliliulBamubllBleeutinll=ebt8om=th1m5smmwiamdllewaxnid2de5mmxe2md5imummsizes. very pliable and does not become slip- 10/Bx............. (MIL62202)................ $97.96
Each................................................ $368.44 pery when hydratedm making it easier for
clinicians to properly place the membrane
Small 10 per Box.................. (JMO27500100) over the defect. Each membrane is supplied
Medium 5 per Box............... (JMO27500200) sterile and in an easy to open package.
Assorted 6 per Box.............. (JMO27500150) HeliMend - Absorbable (4-8 weeks)
15x20mm ......... (MIL62203).............. $73.46
Assorted Contains: 3-Small, 3-Medium sizes of Foundation. 20x30mm ......... (MIL62204).............. $88.16
30x40mm ......... (MIL62205)............ $146.96
HeliMend - Advanced (18 weeks)
15x20mm ......... (MIL62206).............. $88.16
20x30mm ......... (MIL62207)............ $102.86
30x40mm ......... (MIL62208)............ $146.96
Guidor easy-graft Classic RTR Resorbable Tissue
Sunstar Americas Replacement
Septodont
Guidor easy-graft is a fully resorbable bone R.T.R Syringe and Beta-Tricalcium Phosphate
grafting system that contains a syringe filled
with coated granules and a ampule of the Bone Grafting Material support the replace-
ment of bone loss following tooth extraction,
liquid activator, BioLinker. Once mixed, Gui- intrabony defect treatment Bone grafting
dor easy graft can be dispensed and shaped
directly into the defect where it will harden •m aMteardiael during sinus lift procedures.
into a stable, porous scaffold in approximate- of beta-tricalcium phosphate gran-
ules of synthetic origin.
•••ly one minute. HeliTape • Sterile and gradually resorbable bone
Designed for ease of use and predictability substitute.
100% synthetic and fully resorbable. Miltex • Releases calcium and phosphate ions that
Ideal for ridge preservation and filling HeliTAPE® is a thin, soft, white, pliable help promote new bone formation.
voids around immediate implant place- collagen tape used for dressing minor Osteoconductive micro and macroporous
ments. wounds. Tape accelerates wound healing •
and is absorbed into the body after 10 to 14 structure that fosters dense new bone
Classic Large - .4mL Syringe days. Each dressing is sterile and individually growth.
packaged. • Helps renew bone integrity within 3-6
(SUNC11008)................................... $254.76 1” x 3”
Classic Medium - .25mL Syringe 10/Bx............. (MIL62200).............. $146.96
months.
(SUNC11078)................................... $225.36 0.8cm Curved Syringe
Classic Small - .15mL Syringe
(SEPS0500)........................................ $97.96
(SUNC11018)................................... $186.17
292 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Surgical Products
TChoellraagfeonrmMembrane
Surgical Esthetics
OSSIF-i sem mineralized cancellous bone OSSIF-i Sem OSSIF-i Sem Mineralized
•al loBgioracoftm.2p5a-t1ib.0lepaanrtdichleigshizlye-.purified Mineralized Cortical Bone Cortical/Cancellous Bone
Surgical Esthetics Surgical Esthetics
atelocollagen Demineralized cortical bone is a versatile A combination of mineralized cortical and
• Ideal interaction with mesenchymal stem graft material. OSSIF-i sem contains less than cancellous bone to promote bone formation
cells 4 percent residual calcium standard for quali- •an Hdivgohluinmneermsauirnfatecneaanrceea.from the large
••••• Porcine-derived •t•y demineralized bone processing.
Favorable resorption profile Versatile for a numerous uses •• particle cancellous component
Hemostatic properties Easy to use double sterile packaged Excellent scaffold for bone formation
Easy handling, pliable consistency container Approximately 40% mineralized bone
Easily trimmed to fit clinical needs • No need to transfer material-can be component
••In dCEixoctavrteaiorc/tncisoo:nntsaoinckbeotnceovgerraifntging material in a • Provides volume
transferred directly to the sterile field once maintenance
opened ••In dERilicedavgtaieotianousn:gomfetnhteatmioanxillary sinus.
••••In dEEATihxlcpetaeivrctaaifooictleitlnoiicnsotn:gonomosffoyt,pchkceeeyrstmiostedacxotinolltamarlyyd,saeinnfeudcstrsoot
•• variety of procedures repair •• Large extraction sockets
Schneiderian membrane Whenever volume maintenance
Hemostasis is desired
30-40mm (SUR0030).......................... $88.16
0.5cc Jar............................................. $73.46
resection .6-1.25mm (SUR2050)
•• As a graft expander .6-1.25mm (SUR3050)
In combination with numerous graft
materials 1.0cc Jar...........................................$107.76
0.5cc Jar............................................ $68.56 .6-1.25mm (SUR2100)
.25-1.0mm (SUR4050) 1.0-2.0mm (SUR3100)
OMSinSIeFr-ailSizeemd Cancellous Bone 1.0cc Jar............................................ $88.16 2.0cc Jar...........................................$195.96
.25-1.0mm (SUR4100) .6-1.25mm (SUR2200)
1.0-2.0mm (SUR3200)
2.0cc Jar.......................................... $127.36
Surgical Esthetics
.25-1.0mm (SUR4200)
OSSIF-i sem mineralized cancellous bone
•al loEgxcraefllte.n2t5i-n1n.0erpasurtrifcalecesiazree.a and porosity
allow for excellent bone formation
• Mineralized bone provides excellent space
maintenance
• Natural bone allograft properties allow for
natural osteoclast remodeling.
•In dEixctartaioctniso:n sockets, in conjuction with
implant placement
• Perrio defects apicoectomy, cystectomy,
and root resection
0.5cc Jar............................................ $73.46
.25-1.0mm (SUR0050)
1.0-2.0mm (SUR1050)
1.0cc Jar.......................................... $107.76
.25-1.0mm (SUR0100)
1.0-2.0mm (SUR1100)
2.0cc Jar.......................................... $195.96
.25-1.0mm (SUR0200)
1.0-2.0mm (SUR1200)
www.tricountydental.com | [email protected] 293
Surgical Products
Bone Grafting Syringe
Allograft Bone Putty Bone Grafting Syringe Surgical Absorbable Hemostat
S•u 1rg0i0c%alhEusmthaentibcosne (no other carriers or
synthetic materials) Hu-Friedy Johnson & Johnson
•• Highly biocompatible (batch assayed 7mm Bone Grafting Syringe used during These oxidized, regenerated cellulose hemo-
Osteoinductive potential grafting procedures. Inner Diameter 5.8mm. stats provide a knitted fabric for a stronger
for BMPs) Load from tip to prevent clogging. suture base. They offer fast and effective
•• Flowable & malleable healing (HUFSYBG)....................................... $164.49 hemostasis. SURGICEL NU-KNIT® hemostats
Resists irrigation during will hold a suture without sticking to wet
•••••In dOAOESiuxclssvtapsserteepaioooolceluutanmirssso:rendriendesptfgoeaetcciokrtaebaurteflgotppmecrarkeeiarsgnpertraiacvftataiosltisnfouosnrrgveoriidesfilling Medicaments & Packing Material gloves or instruments. They offer complete
0.5cc Syringe absorption within seven to 14 days. Bacteri-
ActCel Hemostatic Guaze cidal and sterile.
(SUR0005)....................................... $137.16 1/2”x2” 12/Pk....... (JOH1955).......... $519.36
1.0cc Syringe Coreva Health Sciences
ActCel Hemostatic Guaze is a collagen-like SWoocukIntd! ODrraelsHsiyndgrogel
(SUR0010)....................................... $186.16 natural substance created from chemically
treated cellulose. The material contains no MCMP
Augma 3D Bond chemical additives, thrombin or collagen. SockIt! is an all-natural, drug-free wound
ActCel does not cause delayed healing as dressing designed to be used after anything
Augma do other hemostatic material that may have from extrations and implants to grafts and
Augma 3D bond is a unique pure biphasic similar appearance. hygiene procedures. After the initial appli-
calcium sulphate cement. This Product 2”x2” 20/Pk........... (COR2022)........... $98.00 cation in the office, the remainder of the
can be mixed with allograft or other bone syringe is sent home with the patient.
substitutes, to create the ideal graft mate- CURITY Plain Packing Strips 10 Gm. Syringes
rial. Augma 3D Bond is bicompatible, and is 5/Pk...................... (MCMS-I5)........... $73.46
completely absorbed and replaced within Covidien 25/Pk.................... (MCMSI-25)....... $244.96
4-10 weeks. CURITY Packing Strips. 100% cotton, fine
0.5cc Syringe mesh gauze ideal for wet-to-dry packing. SafeGauze
(SUR0305)............. 2 per pack.......... $112.66 Available in plain, iodoform, and AMD vari- HemoStyp Topical Dressing
1.0cc Syringe eties.
(SUR0310)............. 2 per pack.......... $166.56 5yd.......................................................$3.88 Medicom
1/4”............................................ (COV7631) SafGauze HemoStyp Topical Hemostatic
1/2”............................................ (COV7632) Dressing is a sterile, woven, pH neutral
soluble hemostatic gauze that is derived
from cellulouse and is easy to apply. Upon
contact with blood, it quickly transforms into
a clear viscous gel, which fills extraction and
surgical sites, seals capillary ends, activates
the clotting system and thereby helps control
bleeding.
3/4”x 3/4” Blister Pack
20/Bx.................... (MED4900)........... $48.96
294 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
Surgical Products
Periodontal Dressing
Gelfoam Sponge Coe-Pak
Pfizer Pharmaceutical GC America
GELFOAM Dental Sponges are small, sterile, COE-PAK is a noneugenol surgical dressing
surgical sponges prepared from specially and periodontal pack that has no buring sen-
treated and purified gelatin solution which is sation, no unpleasant taste, no disagreeable
beaten to desired porosity, dried, sectioned, odor, and offers proven protection to surgical
packaged, sealed, and sterilized by dry heat. sites. Promotes cleanliness and healing.
GELFOAM is pliable, and is capable of ab- Regular
sorbing and holding within its meshes many (GCA135001)..................................... $85.22
times its weight in whole blood. It is used as Hard & Fast
a hemostatic device. (GCA135301)..................................... $85.22
Size #4
(PFI39605)....................................... $215.56 Coe-Pak Automix NDS
Contains: Caton of 6 envelopes (2 Sponges per envelope). GC America
COE-PAK is a noneugenol surgical dressing
(PFI1545)......................................... $146.96 and periodontal pack that has no buring
sensation, no unpleasant taste, no disagree-
Contains: 12-Sponges (12 packets of 1 sponge). able odor, and offers protection to surgical
sites. NDS version eliminates manual mixing
(PFI1549)......................................... $156.76 and provides a consisten mix for immediate
placement.
Contains: Gelfoam Sponge Size 50. 4 per box. Regular
(GCA135003)................................... $104.82
(PFI1555)......................................... $362.56
Contains: 2-50mL cartridges & 12 mixing tips.
Contains: Gelfoam Sponge Size 100. 6 per box.
www.tricountydental.com | [email protected] 295
Surgical Products
Silk - Black Braided Sutures
Hu-Friedy
Perma Sharp® silk, black braided sutures are nonabsorbable and indicated for general soft tissue
approximation and/or ligation.
Part # Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
HUFPSN7772S C-6 18.7mm 3/8 Circle Reverse Cutting 3-0 18” $61.70
HUFPSN684S C-7 24.3mm 3/8 Circle Reverse Cutting 3-0 18” $61.70
HUFPSN632S C-9 23mm 1/2 Circle Reverse Cutting 3-0 18” $61.70
HUFPSN7762S C-43 16.2mm 1/2 Circle Reverse Cutting 3-0 18” $61.70
HUFPSN641S C-3 13mm 3/8 Circle Reverse Cutting 4-0 18” $145.00
HUFPSN683S C-6 18.7mm 3/8 Circle Reverse Cutting 4-0 18” $61.70
HUFPSN640S C-3 13mm 3/8 Circle Reverse Cutting 5-0 18” $145.00
HUFPSN682S C-6 18.7mm 3/8 Circle Reverse Cutting 5-0 18” $61.70
Polyester - Green Braided Sutures
Perma Sharp® Polyester Green Braided Nonabsorbable Sutures are designed for efficient and reliable soft tissue closure for all
types of dental procedures.
Part # Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
HUFPSN7773L D-14 17.5mm 1/2 Circle Reverse Cutting 5-0 18” $137.16
Polypropylene - Sutures
Hu-Friedy Perma Sharp ® Sutures are designed for efficient and reliable soft tissue closure for all types of dental procedures.
Part # Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
HUFPSN8697P C-1 10.7mm 3/8 Circle Reverse Cutting 6-0 18” $162.64
HUFPSN8695P C-3 13mm 3/8 Circle Reverse Cutting 6-0 18” $162.64
HUFPSN8696P C-1 10.7mm 3/8 Circle Reverse Cutting 7-0 18” $162.64
PGA Violet - Braided Sutures
Absorbable PGA Perma Sharp® Sutures are designed for efficient and reliable soft tissue closure for all types of dental procedures.
Part # Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
HUFPSN392V C-6 18.7mm 3/8 Circle Reverse Cutting 4-0 18” $82.28
Silk - Black Braided Sutures
LOOK™ Nonabsorbable Black Braided Silk Sutures are made of noncapillary silk and have excellent handling and tying characteristics. Modern braiding technique
provides a uniform smooth surface and a greater tensile strength.
Part # Suture Code Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
LOO778B 778B C-26 11mm 1/2 Circle Reverse Cutting 3-0 18” $27.40
LOO777B 777B C-26 15mm 1/2 Circle Reverse Cutting 4-0 18” $27.40
LOO785B 785B C-31 24mm 1/2 Circle Reverse Cutting 3-0 18” $23.48
LOO795B 795B C-16 11mm 3/8 Circle Reverse Cutting 3-0 18” $23.48
LOO774B 774B C-17 12mm 3/8 Circle Reverse Cutting 5-0 18” $23.48
LOO792B 792B C-3 13mm 3/8 Circle Reverse Cutting 4-0 18” $50.92
LOO784B 784B 18” $23.48
LOO781B 781B C-6 19mm 3/8 Circle Reverse Cutting 3-0 18” $23.48
LOO786B 786B 18” $24.46
C-6 19mm 3/8 Circle Reverse Cutting 4-0
C-7 24mm 3/8 Circle Reverse Cutting 3-0
Gut - Plain Sutures (5-7 Day Resorption)
LOOK™ Plain Gut Sutures are made of first quality raw material, ensuring a dependable and predictable absorption and an extremely high tensile strength. Every
strand is precision polished to a uniform diameter, permitting smooth and secure knotting.
Part # Suture Code Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
LOO594B 594B C-31 24mm 1/2 Circle Reverse Cutting 3-0 18” $26.42
LOO535B 535B C-17 12mm 3/8 Circle Reverse Cutting 5-0 18” $27.40
LOO596B 596B C-3 13mm 3/8 Circle Reverse Cutting 5-0 18” $58.76
LOO554B 554B C-6 19mm 3/8 Circle Reverse Cutting 3-0 27” $29.36
LOO591B 591B C-6 19mm 3/8 Circle Reverse Cutting 4-0 18” $29.36
LOO551B 551B C-6 19mm 3/8 Circle Reverse Cutting 4-0 27” $29.36
LOO553B 553B C-7 24mm 3/8 Circle Reverse Cutting 3-0 27” $29.36
Gut - Chromic Sutures (10-15 Day Resorption)
LOOK™ Chromic Gut Sutures are absorbable, sterile surgical sutures composed of purified connective tissue
derived from eiher the serosal layer of beef or the submucosal fiberous layer of sheep intestine
Part # Suture Code Needle Code Needle Length Needle Description Suture Size Suture Length Price 12/Bx
LOO1248B 1248B
LOO560B 560B C-3 13mm 3/8 Circle Reverse Cutting 5-0 18” $58.76
LOO558B 558B
LOO559B 559B C-6 19mm 3/8 Circle Reverse Cutting 3-0 27” $29.36
C-6 19mm 3/8 Circle Reverse Cutting 4-0 18” $29.36
C-6 19mm 3/8 Circle Reverse Cutting 4-0 27” $29.36
296 Toll Free: 877.767.8237 | Ph: 909.880.9555 | M-F 9 AM to 5:30 PM PST
SFoynutnhdBatoionneTFMilling A)Helimend® Surgical Products
Stimulates bone growth Absorbable Collagen Membrane Gelfoam
Bullet shaped for easy Pfizer Pharmaceutical
placement 15x20mm......................... $74.95
Small 10/Pkg 20x30mm......................... $89.95 Absorbable
Medium 5/Pkg 30x40mm...................... $149.95 A Dental Gelatin Sponges
B)Helimend® Advanced
$37500 15x20mm......................... $89.95 USP
20x30mm...................... $104.95 SIngle Use
Small 10/bx......................... (JMO27500100) 30x40mm...................... $149.95 Size 4
Medium 5/bx...................... (JMO27500200) C)Heliplug® 12 Dental Sponges
Assorted 6/bx...................... (JMO27500150)
Collagen Wound Dressing Size 4 12/bx............ (JMO39605)........ $219.95
BBoovnieneMaterial ® 10/Pk B Size 12-7 12/bx........ (JMO1545)......... $149.95
(INM62202).................. $102.95 Size #50 4/bx........... (JMO1549)......... $159.95
D)Helitape® Size #100 6/bx......... (JMO1555)......... $369.95
Collagen Tape C
A Natural Bone Mineral 1”x3”...(INM62200)..... $158.95 OSSIF-i sem™ OSSIF-i sem™
Matrix E)Helicote® Mineralized Demineralized
Deproteinized Bovine D Cort/Canc Bone Cortical Bone
Bone Collagen Cote Allograft SP
Cancellous Granules Allograft SP .25-1.0mm
.25-1mm 1”x3”...(INM62201)..... $113.95 1.0-2.0mm
0.5 cc...........$61.50
$7399 0.5 cc.............. $75 1.0 cc...........$79.95
1.0 cc........ $107.50 2.0 cc........ $119.50
.25gm, 0.5cc ................................... $72.99* E 2.0 cc............$199
.5gm, 1cc ....................................... $116.99
1gm, 2cc ......................................... $189.99
MCoenmFObRraMneTM RCM6TM Unigraft Synthetic®
Membrane Bioactive Glass
Resorbable Collagen Non-Pyrogenic and
Membrane non-immunogenic
20x30mm $113.99 Compatible with
30x40mm $169.99 autologous and
freeze-dried bone
1$51x2107m9m9 15x20mm Completely resolvable $15999
& transforms into
Resorbable Collagen Membrane $9399 natural bone 200-420 Micron,
20x30mm ......................................... $139.99 .37gm, 5/Pkg
30x40mm ......................................... $229.99 200-420 Micon,
1.0gm 5/Pkg $255.99
$1795 $1795 $1595
Suture Plain Catgut Suture Chronic Gut Suture Silk
An absorbable catgut sterile surgical suture An absorbable chromic catgut sterile Nonabsorbable silk suture sterile, surgical
composed of highly purified connective surgical suture composed of highly purified suture composed of an organic protein cal
tissue (mostly collagen) derived form either connective tissue (mostly collagen) derived fibroin...............................................12/Pkg
beef or sheep intestines. 97%-98% Pure form either beef or sheep intestines.
Collagen............................................12/Pkg 97%-98% Pure Collagen.....................12/Pkg
Bioplant HTR Cytoflex R.T.R.
Synthetic bone material Resorbable Membrane
6 Syringes 1-20x25 cm.... ((UUNNII--CC003300210011)).............................$..$17160 Resorbable tissue replacement $95.95
1-30x40 cm....
0.125gm.......... (KER216110)............ $299.95 0.8cm.............(SEP01-S0500).............
0.25gm............ (KER216112)............ $479.95
www.tricountydental.com | [email protected] 297
The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Tri County Dental Catalog
Discover the best professional documents and content resources in AnyFlip Document Base.
Search