The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by Pusat Sumber KPT, 2022-01-13 02:38:17

thesun1301

thesun1301

INSIDE

TELLING IT AS IT IS Infection page Safe haven page
risk from in times
anti-vaxxers 3 4
of trouble

ON THURSDAY JANUARY 13, 2022 ALL SET ... A devotee cleans the golden chariot of Lord

No. 7946 PP 2644/12/2012 (031195) www.thesundaily.my Muruga in the Thaneermalai Sree Balathandayuthabani
Devasthanam, better known as Waterfall Hill Temple, in
George Town ahead of the Thaipusam procession on Jan 18.
– MASRY CHE ANI/THESUN

Plan for a bad day
█ BY ELLY FAZANIZA oAll stakeholders should be ready to
[email protected] respond to a disaster before it happens,
experts say
PETALING JAYA: Preparedness is
key to ensuring minimum damage theSun on how much better the rescue earthquake or floods,” she said.
to life and property in the event of operations could have been managed “The people would be instructed on
a natural disaster. during the recent floods. what to do and selected schools are
An early warning system and creating designated as safe locations during a
awareness within the community on the Nadma came under fire for its poor disaster.”
protocols during such events, and the response to the disaster. Many of those Schools in Japan are designed to be
need to adhere to safety standards are also whose homes were flooded were left to the safest places in times of disasters.
essential to keep people safe. wait for hours on rooftops before rescue They are built on higher ground and
teams arrived. there are big spaces to accommodate
Urban planning expert Dr Yong Adilah a large number of evacuees.
Shamsul Haruman of Universiti Malaya At one point, more than 70,000 people Each evacuation centre is located
proposed that an emergency coordination had to be evacuated to flood relief centres. no further than 500m from the
team under the purview of the National Many of those stranded had to be rescued community, ensuring that they can be
Disaster Management Agency (Nadma) be by volunteers who came with their own reached quickly on foot.
set up to work closely with the various boats and trucks. A total of 53 lives were Disaster management expert Dr
local authorities during disasters. lost in the floods. Khairilmizal Samsudin said the various
emergency response agencies in
“Each local authority should have a Yong Adilah said Malaysia could learn Malaysia have the tactical
representative who can act as a link to the from countries such as Japan, where there response capability and the right
community. The representative can relay is an early warning system to inform the assets such as boats, and their Turn to
to the people instructions on the steps to people of an impending disaster via short personnel are trained in
take to ensure safety for everyone,” she told messaging service (SMS) or TV. evacuation as well as search and —
theSun.
“They do not wait until the rain comes page 4
Yong Adilah said selected members of before raising the alarm. To ensure people
the community should also be trained in are prepared, a warning is sent out at the rescue operations.
life-saving skills such as cardiopulmonary first sign of a disaster, such as an
resuscitation (CPR) and, where necessary,
to administer first aid while waiting for
emergency rescue personnel.

She was responding to questions from

2 theSUN ON THURSDAY | JANUARY 13, 2022
NEWS WITHOUT BORDERS

Temple to ensure strict adherence
to SOP during Thaipusam

GEORGE TOWN: Preparations for The Penang Hindu Endowment
Thaipusam celebrations in Penang Board had previously issued an
on Jan 18 are almost complete, with assurance that the celebrations
the management of a temple would be held in compliance with the
imposing strict standard operating set SOP and that it was ready to
procedures (SOP). adjust it as per the National Security
Thanneermalai Shree Council’s instructions for the safety
Balathandayuthapani Devasthanam of all quarters, Bernama reported.
(Hilltop Temple) chairman Datuk
R. Subramaniam said preparations Mohd Shuhaily said the temple
inside and outside the temple had management had done thorough
reached 90% completion and the preparations such as providing QR
golden chariot was also ready. codes and special passes to residents
“However, we are waiting for the living near the temple.
final SOP to be issued by the National
Security Council before making an He said police would mobilise
announcement. Overall, we are ready 1,300 personnel for Thaipusam-
for any situation to ensure a safe related duties, adding that it was
Thaipusam celebration. waiting for the council’s SOP to
“For the sake of their health, those finalise the numbers.
who are ill are advised not to come to
the temple on Jan 17 and 18 because “The final SOP in regard to the
it will be crowded. They can come celebrations will be announced by
after that,” he said yesterday. the council and it will take into
Earlier, Subramaniam account the current Covid-19
accompanied Penang police chief situation. I hope the people will be in
REGAL RECOGNITION ... Sultan of Selangor Sultan Sharafuddin Idris Shah, who is also Universiti Putra Malaysia Datuk Mohd Shuhaily Mohd Zain to touch with the temple to get the latest
Chancellor, presenting a royal award for non-bumiputra students to Chow Heng Yee at the varsity’s 44th convocation in the temple to observe preparations information on the SOP.”
Serdang yesterday. – BERNAMAPIX for Thaipusam.
According to the initial plan, the
silver chariot procession ferrying the
statue of Lord Murugan will begin its
9km journey at 6am on Jan 17.

Expert sees potential in new airline

█ BY RAJVINDER SINGH o SKS Airways, to be launched on Jan 25, licence (ASL), that was awarded by expand its fleet and has purchased
[email protected] to focus on flights to several resort islands the Malaysian Aviation Commission three ATR-72s, which will be used for
PETALING JAYA: While many do not (Mavcom), is effective Jan 1. cargo operations.
expect it to soar, a new airline hopes each with a capacity of 19 passengers. before they applied for a licence.
to capture a niche market that has yet The emergence of the new airline He agreed that servicing island Its air operator’s certificate was “We want to have a mixed fleet but
to be explored. granted by the Civil Aviation have yet to decide on which other
has come as a surprise to many, given resorts was a good strategy but the Authority of Malaysia on Oct 1. aircraft to buy.”
SKS Airways, which will be the significant drop in air travel as a demand was not expected to be very
officially launched on Jan 25, will result of the pandemic. high, given the current situation. Rohman said Mavcom took three Rohman said the airline would
focus on servicing several islands Nonetheless, he said there is months to assess the airline’s have a three-tier fare system to meet
around Malaysia. The civil aviation expert, who potential for growth. business model before expressing its individual passenger needs.
requested anonymity, agreed that it satisfaction and granting the ASL.
A civil aviation expert theSun would be tough to make it a profitable “The use of the turboprop aircraft For instance, the fare from Subang
spoke to said the island-hopping venture. is also a good strategy, given their “But that is understandable given to Pulau Pangkor starts at RM139.
strategy made “a lot of sense”. short take-off and landing capability.” that it has a duty to protect not only
“Don’t expect profits to start passengers but also airlines. The inaugural flight takes off a day
The airline will fly to Pulau coming in overnight. The investors Most runways at island resort after the launch for Pulau Pangkor,
Pangkor, Pulau Redang and Pulau will have to be patient and willing to airports cater to such aircraft. “They would not want to see the followed by the next flight on Jan 31 to
Tioman as soon as operations begin. put in more money along the way airline being grounded after only Pulau Redang.
It will also service Johor Baru and before they start seeing profits.” The expert expects the airline to three or six months of doing
Subang. work closely with tourism industry business.” “We realise that some resorts on
He added the investors would players to fill its seats. Tioman and Redang will close during
SKS Airways director Datuk have carried out an in-depth study Rohman added SKS Airways had the monsoon season but there are
Rohman Ahmad said the airline will SKS Airways’ full air service also been given a full service carrier enough resorts open that will allow us
take off with four DHC6 Twin-Otters, licence similar to that awarded to to fly to those destinations,” he said,
AirAsia and Malindo. adding that SKS will slowly build up
its routes.
He said the airline intends to

Johor prince determined to resolve flood problems in state Tanjung Pelepas
Port donates
JOHOR BARU: The Tunku Mahkota management and high levels of Tunku Ismail said he believes permanent solution so that the life jackets
of Johor Tunku Ismail Sultan readiness to handle disasters. prevention is better than cure and people would not have to face flood
Ibrahim has announced his will organise a river cleaning disasters again. JOHOR BARU: The Port of Tanjung
intention to find a permanent “Floods are a problem that occur programme as well as special Pelepas (PTP), a member of the
solution to the state’s flood problem. almost every year. Although there initiatives next month to raise public Earlier, Tunku Ismail met Johor MMC Group, yesterday donated 50
have been improvements in flood awareness on the importance of Baru Mayor Datuk Mohd Noorazam life jackets to Kelab Media Johor, an
He said among the important mitigation efforts since the events in keeping rivers clean. Osman and water management and association for the welfare of media
aspects that need attention are 2006, I intend to find a permanent drainage system experts for a personnel in Johor.
drainage and sewerage systems that solution to the problem in Johor,” he He added the Sultan of Johor and briefing on initiatives and efforts to
could accommodate large amounts said through a post on his official his family would continue to work improve flood mitigation in the state.
of rainwater, effective river Facebook page yesterday. with the government to find a – Bernama

MSC to be renamed Digital Malaysia The life jackets were handed to
Bernama Johor bureau chief
Nor Baizura Basri, who represented
the club.
“The media, particularly the
KUALA LUMPUR: identified corridors,” he said at the equitable distribution across technologies to achieve tremendous club, remains one of PTP’s most
Communications and Multimedia opening of the Malaysia Digital income groups, ethnicities and growth,” he said. important stakeholders.
Minister Tan Sri Annuar Musa has Economy Week at Expo 2020 Dubai. regions. “The distribution of life jackets
announced that MSC Malaysia will Annuar added Malaysia has also is, therefore, part of its efforts in
be enhanced and renamed as Annuar said MSC helped to drive According to the 12th Malaysia been riding on the digital wave, extending gratitude and
Digital Malaysia. the growth of the country’s digital Plan, the digital economy is building an ecosystem filled with appreciation to media personnel for
He said MSC needs to evolve economy, which currently accounts projected to contribute 25.5% to advanced technologies such as the support and many
following the rapid shift of socio- for 22.6% of the national gross Malaysia’s GDP by 2025. artificial intelligence, the Internet of contributions to PTP,” the port
economic norms in response to the domestic product (GDP). Things and Big Data analytics. concessionaire said in a statement.
constant advancements of digital Additionally, the government – The life jackets will be
technology. “It was indeed a programme that via the Malaysia Digital Economy Citing the e-Conomy Southeast distributed to media personnel who
“Since its introduction in 1996, was never before seen in the world Corporation (MDEC) – will continue Asia Report by Google, Temasek and have been assigned to cover floods
MSC has catalysed and transformed back in 1996, a game-changer. to drive the digital economy forward Bain & Company, he said Malaysia in the state.
Malaysia into a knowledge-based towards making Malaysia a globally saw three million new digital Currently, the club has 140
economy. “In many ways, MSC was the competitive digital nation and consumers since the start of the members.
“It was created to foster a original start-up at a time when the digital hub of Asean members. pandemic in 2020, and 81% of all Meanwhile, the flood situation in
conducive ecosystem driven by term ‘start-up’ had yet to be coined,” internet users are now users of Johor has improved, with the
high-end infrastructure he said. “The pandemic has tested us in digital services. number of evacuees at 26 relief
development and information and many forms and restricted our centres decreasing to 1,227 as of
communications technology He added that the government ability to grow. The report projected Malaysia’s 8am yesterday compared with 2,154
companies’ catchment within has identified digital economy as overall internet economy to reach on Tuesday. – Bernama
one of Malaysia’s key economic “However, it has also served as a US$21 billion in gross merchandise
growth areas to achieve sustainable great boon for the digital economy, value in 2021, hitting US$35 billion
growth while ensuring shared paving the way for eCommerce and by 2025. – Bernama
prosperity through fair and Fourth Industrial Revolution

3theSUN ON THURSDAY | JANUARY 13, 2022
NEWS WITHOUT BORDERS

Infection risks from anti-vaxxers

o Group endangers people when mingling in public, Datuk Dr Kasemani Embong said the private would undermine the government’s effort to
especially while using fake vaccination certificates clinic had been allowed to administer Covid-19 ensure that all Malaysians get vaccinated.
vaccinations for a fee since September last year.
█ BY RAJVINDER SINGH Covid inoculation drive, was arrested on The Health Ministry recently reported that
[email protected] suspicion of selling fake vaccination certificates. Azrul added that those who have vaccination 14% of the 122 Omicron cases among umrah
PETALING JAYA: One of the main challenges of certificates without having taken the jab are not pilgrims did not have any vaccination records.
the Covid-19 vaccination campaign is to get anti- Initial investigations revealed that the doctor, only putting the health of their families at risk,
vaxxers to see the folly of their ways. who has a clinic in Marang, had dealings with but also endangering the community. “We should not allow this to happen
about 1,900 individuals but it is still unclear how again,” said Azrul.
According to health expert Azrul Mohd many had bought the fake documents. “The doctor claims that he is an anti-vaxxer
Khalib, such individuals have made up their but he is just using it as an excuse to provide fake Malaysian Medical Association (MMA)
minds and it is difficult to convince them According to Terengganu police chief Datuk certificates while raking in a huge profit.” president Dr Koh Kar Chai expressed dismay
otherwise. Rohaimi Md Isa, the doctor was charging RM400 at the news of fake vaccination certificates
to RM600 for each certificate. Azrul said the problem with anti-vaxxers is being sold.
To compound matters, some doctors assist that they refuse to listen to reason or consider
anti-vaxxers to fool the authorities. He said there was a possibility that people data and evidence that have proven the efficacy “We urge the authorities to conduct and
from other states also purchased the fake of the Covid-19 vaccine. investigation and bring those responsible to
“They are putting people’s lives at risk,” said certificates from the doctor. book.”
Azrul, who is Galen Centre for Health and Social “Reasoning with them is difficult because they
Policy chief executive officer. “His clinic is one of those designated as a have made up their minds.” Koh said the public should also alert the
vaccination centre, but he was issuing certificates authorities if they come across any corrupt
It was reported last Saturday that a 51-year-old even to those who declined to take the jabs,” Azrul said it should not come as a surprise activities in the healthcare sector.
doctor, who declared that he objected to the Rohaimi said. that there are a number of people in the
healthcare profession who are anti-vaxxers. “MMA does not condone activities that
Terengganu Health Department director (threaten) the integrity of the medical
“But just because they do not want to be profession, more so when it causes harm to
vaccinated does not mean that they should also people’s health.”
trade in fake certificates.”

He warned that the sale of fake certificates

Witnesses prepared to cooperate in probe

KUALA TERENGGANU: Several those who had obtained the laptops and mobile phones will in Marang, was being remanded Totalconfirmed
individuals with information on certificates without taking the be sent to the forensics unit of to assist investigations under cases
the sale of fake Covid-19 jabs, was very much needed. the Commercial Crime Section 420 of the Penal Code for
vaccination certificates in Investigation Department in cheating. 2,795,233
Terengganu have agreed to “For now, five individuals Bukit Aman,” he said after
appear as witnesses to assist in have agreed to come forward attending a handing-over-of- The remand order ends Totcaalsaecstive Newcases
investigations. and appear as witnesses. They duties ceremony for the today.
admitted to not being Terengganu deputy police chief 39,913 3,198
State police chief Datuk vaccinated but managed to at the state police headquarters At the ceremony, SAC Wan
Rohaimi Md Isa said obtain the first dose vaccination yesterday, Bernama reported. Rukman Wan Hassan was
investigations were progressing card. appointed the new Terengganu
smoothly but public He said the prime suspect, deputy police chief, taking over
cooperation, especially from “We will continue with our who is a doctor at a private clinic from SAC Norhalid Kimi, who
investigations. Case items like has retired.

Currentrecovery Totalrecoveries
rate cases

A healthcare worker showing 97.32% 2,720,399
empty vaccine vials at the centre in
Darul Kifayah Complex yesterday. Deathtoll Brought-in-Dead
– BERNAMAPIX
31,723 6,401

PERLIS 13
KEDAH 183

PENANG 179

PERAK 141
SELANGOR 935

K. LUMPUR 319
PUTRAJAYA 34

PAHANG 210

MALACCA 76

N.SEMBILAN 106

JOHOR 417

KELANTAN 197

Inoculation centre hours extended TERENGGANU 76

LABUAN: The operating hours of centre from the Membedai Health from 8am to 4pm. booster vaccination roll-out would LABUAN 9
the vaccination centre dispensing Clinic to the Darul Kifayah Ismuni said some 22,936 be expedited in view of the
booster shots here has been Complex on Dec 29, due to the emergence of the Omicron variant. SABAH 280
extended until 8pm during increasing number of people individuals from a total 72,000
weekdays, from 5pm previously, receiving appointments for the eligible adults in the duty-free “We are urging the people who SARAWAK 23
since Jan 10. booster jabs. island have received their booster have received the second dose of
shots as of Jan 11. the vaccine and completed the six- PROGRESS STATISTICS FOR THE NATIONAL COVID-19
Labuan Health Department “After looking at the steady month interval to visit the
director Dr Ismuni Bohari said this increase in the number (of vaccine He added that the average vaccination centre for a booster IMMUNISATION PROGRAMME As of January 11
was to help speed up the booster recipients), we decided to extend number of people visiting the shot,” he said.
vaccination exercise and provide a the operating hours during vaccination centre was about 800 to 26,030,831 Received second dose
flexible schedule for working weekdays,” he said yesterday. 1,000 daily. Labuan has detected a new
adults. active “Jalan OKK Awang Besar 25,657,970
On Saturdays, the centre at the Meanwhile, Labuan Covid-19 Saudi” cluster, which was triggered
“We shifted the vaccination Darul Kifayah Complex operates Immunisation Task Force by an umrah pilgrim. – Bernama
chairman Rithuan Ismail said the

4 theSUN ON THURSDAY | JANUARY 13, 2022 FOLLOW ON YOUTUBE SCAN
NEWS WITHOUT BORDERS ME
/theSunMedia

FESTIVE PREPARATIONS ... A worker putting final touches on tiger-themed lanterns at the Fo Guang Shan Dong Zen Temple in Jenjarom, Selangor April 13 hearing for
ahead of the Chinese New Year celebrations next month. – ASYRAF RASID/THESUN Azmin’s appeal
to strike out suit
Safe haven for the public
in times of trouble PUTRAJAYA: The appeal by Gombak MP
Datuk Seri Mohamed Azmin Ali to strike out
o Go-To-Safety-Point initiative at participating premises offers Petron Malaysia head of retail and a lawsuit filed by 10 voters from his
assistance when lives are in danger or during emergencies commercial business Choong Kum Choy said constituency for alleged deceit and breach
the company has 720 petrol stations across of fiduciary duty as their MP, will be heard
█ BY MUHAMMAD YUSRY difficult situations. the country that serve as a stop for any by the Court of Appeal on April 13.
[email protected] The GTSP is part of a National Blue Ocean traveller in trouble.
Lawyer N. Yohendra, representing the
PETALING JAYA: Sharifah Shamini Syed Strategy that initially partnered the police “A ‘Go-To-Safety-Point’ sticker would be voters, said the date was fixed during case
Mohamed still recalls vividly the night of with the 7-Eleven chain of convenience stores placed at all of our stations,” he said. management before senior assistant
November 2019 when a senior citizen and Pos Malaysia. registrar Nur Adilah Halid last Monday.
collapsed in a restroom of her petrol kiosk in Choong said all dealers and staff
Kebun Teh, Johor Baru. It entails making premises a go-to place for participating in the GTSP programme were Parties in the appeal are required to file
The 60-year-old woman was travelling the public when lives are in danger or during required to attend a three-month course on their respective written submissions by
with her family along the Johor Baru-Tebrau an emergency. first aid and how to handle an emergency March 29.
Expressway and they had stopped at her situation to equip themselves with the right
station for a break. These “safe havens” have a direct line to skills to handle most critical situations. Last June 10, the Kuala Lumpur High
“A while later, I heard shouts and cries for police, fire department and hospitals to Court dismissed Mohamed Azmin’s
help. I rushed to the restroom to find the ensure that help could be reached at short Refresher courses are also conducted application to strike out the suit filed against
woman on the floor, struggling to breathe,” notice. regularly by the company as well as the police. him by the 10 registered voters in the
she told theSun. Gombak parliamentary constituency.
Sharifah immediately applied For instance, if a person believes he is He said when an individual, who is in
cardiopulmonary resuscitation on the woman being tailed along a highway, or someone in distress, comes to seek help, a staff member On the same day, High Court Judge
while the family was ushered to the “distress his car is not feeling well, he could pull up at would try to calm him. Datuk Akhtar Tahir also dismissed the
corner” of the station. one of the participating convenience stores or voters’ application to strike out several
One of her staff alerted a hospital and an petrol stations. “If the person is injured, we will provide paragraphs of Mohamed Azmin’s statement
ambulance arrived 25 minutes later to pick up first aid. of defence.
the woman. The initiative, that began with seven
Sharifah was able to respond quickly after 7-Eleven outlets and two post offices, was “We will also contact the nearest police The voters filed the suit against
she attended a course on first aid and how to later expanded to include more than 3,000 station, fire department or a hospital for Mohamed Azmin, who is international trade
deal with emergencies under the petrol stations nationwide. further assistance.” and industry minister, on Nov 27, 2020 for
Go-To-Safety-Point (GTSP) initiative alleged deceit and breach of fiduciary duty
introduced by police in 2013. The oil companies involved are Petronas, Petrol Dealers Association Malaysia as their MP through the “Sheraton Move’
The initiative has come a long way, having Petron, Shell, BHPetrol and Caltex. vice-president Shahnaz Khan said when a that caused the Pakatan Harapan
saved many lives and helped many out of person is being tailed, the best thing to do is to government to collapse in February the
Police sent out a reminder through Twitter stop at the nearest petrol station. same year.
last week that those who need help should
stop at these places. “Petrol stations have traditionally been a In their statement of claim, the voters are
rallying point for people who travel in a seeking, among others, a declaration that
Its objective is to provide emergency convoy, and they are the easiest place to reach Mohamed Azmin, as the Gombak MP, had
assistance to people in distress, and to instil in during an emergency,” he said. breached his fiduciary obligations, deceived
people the awareness that safety and security them during the election in the constituency
are everybody’s responsibility. Based on these factors, it is best to stop at a and also breached the representation made
petrol station if a person senses danger. to them.

“Our crew is trained and equipped to deal They sought damages including
with such circumstances. aggravated or exemplary damages, interests,
costs and other orders deemed fit by the
“Don’t worry. Just come to us,” he added. court.

‘Give representatives expertise to handle disasters’ Last March 12, Mohamed Azmin filed an
application to strike out the suit citing that it
“The challenge is to get them to work district level and the state government only expertise, the community must also have the did not disclose a reasonable cause of action
together under a ‘unified command,’” he steps in when the district authorities are necessary tools to ensure that it is empowered and was frivolous, vexatious and an abuse of
told theSun. overwhelmed. to manage disasters. court process.
He said the federal government “We also need the federal
should deal with the strategic aspect, From government to send reinforcements He said the local team could also provide He contended that the suit violated his
such as deployment of resources to front when states need help to manage the the necessary support to emergency fundamental right to freedom of association
ensure proper distribution of aid. “This page crisis,” he said. responders to ensure that they can focus their as provided under Article 10 Clause (1) (c) of
efforts on specific areas or communities that the Federal Constitution. – Bernama
was what we found inadequate, He proposed that representatives from need the help most urgently.
especially in Selangor, during the floods,” the local communities be given the right Trader fined
he said. expertise so that they can be empowered to Khairilmizal added that non-governmental RM7,000 for selling
Khairilmizal, who lectures at Universiti manage disasters in their respective areas. organisations should be allowed to work with uncertified TV box
Malaya, said disaster response begins at the Khairilmizal said apart from the right local agencies and the community to identify
the best way forward in managing a disaster. PETALING JAYA: A trader was fined
RM7,000 by the sessions court here
yesterday after he pleaded guilty to selling
communication equipment that was not
certified by the Malaysian Communications
and Multimedia Commission (MCMC), two
years ago.

Judge Norshila Kamaruddin also ordered
Ooi Hang Sheng, 27, to be jailed for six
months if he failed to pay the fine. The
accused paid the fine.

“I sell it between RM200 and RM300
each, and I did not know it was an offence. I
promise I will not repeat it,” Ong said when
Norshila asked him about the price of the
Android TV Box sets.

The judge also advised him to stop
selling uncertified items.

Ooi was charged with selling uncertified
communication equipment, namely seven
units of Android TV Box of various brands,
which did not meet the Communications
and Multimedia (Technical Standards)
Regulations 2000.

The offence was committed at a
supermarket in Jalan SS21/37, Damansara
Uptown, Petaling Jaya at 12.30pm on July 9,
2020.

The charge, under Regulation 16 (1) (b)
of the Communications and Multimedia
(Technical Standards) Regulations 2000,
and punishable under Regulation 37 of the
same Act, carries a maximum fine of
RM100,000 or a jail term of not more than
six months, or both. – Bernama

5theSUN ON THURSDAY | JANUARY 13, 2022

NEWS WITHOUT BORDERS

Two state leaders
back logging activities

o Duo refute claims deforestation caused habitats into villages, leading to the
flooding and habitat loss for tigers human-wildlife conflict.

NEW SPIN ON TRADITION ... Zulkarin Isa showing how to spin a top PETALING JAYA: Two states have Pos Bihai last Friday. On Tuesday, Nasir handed over
during a recent media visit to Felda Kampung Tenang, Labis in Segamat, Johor, come to the defence of loggers, one of Mohd Amar said incidents of a memorandum to the Prime
organised by Tourism Malaysia as a tourist attraction. – BERNAMAPIX them over a tiger and the other over Minister’s Office urging Putrajaya to
the recent floods. tigers wandering into human take concrete action to stop
Detainee’s escape bid foiled settlements are not uncommon. deforestation in Gua Musang.
In Kota Baru, the Kelantan Tigers have also been sighted in
KAJANG: It was a short-lived who is being held under a remand government has refuted claims that villages in Jeli in the past. In Seremban, Negri Sembilan
freedom for a robbery suspect who order, was sent back to the Kajang logging activities had forced tigers out Mentri Besar Datuk Seri Aminuddin
was rearrested shortly after he police lock-up. of their natural habitat into Orang “We cannot blame it on Harun said logging had nothing to do
escaped from a government clinic Asli settlements in Gua Musang. deforestation just because a tiger with the floods that hit several
on Tuesday. He said the policemen on duty attacked and killed a person. districts in the state last month.
are being investigated for Kelantan Deputy Mentri Besar However, if there are three or four
Kajang police chief ACP Mohd negligence, while the detainee is Datuk Mohd Amar Nik Abdullah said of them encroaching into a village, He said logs found drifting into
Zaid Hassan said yesterday the being probed for attempting to a study should be conducted to then it is a serious matter,” he told a housing area in Pantai, near
suspect was among 19 detainees escape from police custody under determine how the big cats could reporters after a state executive Seremban, were actually rotten wood.
taken in a police truck from Section 223 and Section 224 of the have come prowling into unfamiliar council meeting at the Kota
the Kajang police station to the Penal Code, respectively. surroundings, Bernama reported. Darulnaim Complex yesterday. “I invite everyone to come and
Beranang health clinic for a see what happenend in Gunung
Covid-19 swab test at about 11am. Mohd Zaid urged those with He was commenting on a report of An Orang Asli of the Temiar tribe, Berembun, and assess if the area is a
information to contact Kajang an Orang Asli who was mauled to Nasir Dollah, 32, had claimed that logging area or what occurred was a
He said after the test, the police at 03-8911 4222 or Insp death by a tiger that had strayed into logging activities in the area had natural phenomenon.
detainees were led back to K. Suresh at 017-4333 795, or the his settlement in Kampung Sau, near forced tigers out of their natural
the truck. As they were boarding, nearest police station. “Sometimes, reports do not tell the
the detainee bolted. whole story. The whole thing makes
The attempted escape by the me look bad, and I hope it doesn’t
He said police at the scene gave detainee was captured on a happen again,” he said after a state
chase and managed to apprehend car dashcam video and was executive council meeting yesterday.
him about 50m away. widely shared on social media
yesterday. Handyman pleads guilty to bribing cop
Mohd Zaid said the detainee,
JOHOR BARU: A handyman pleaded lance corporal as inducement to Commission Act 2009 and punishable
guilty at a sessions court here yesterday exempt him and another person, C. under Section 24(1) of the same Act,
to bribing a policeman last year. Elamaran, from undergoing urine provides imprisonment of maximum
tests. The offence was committed at 20 years and a fine of not less than
Wong Chee Ming, 33, made the Simpang Tiga Jalan Air Bemban in five times the total value of the bribe
plea after the charge was read out Kulai at 3.15pm on May 17 last year. or RM10,000, whichever is higher.
before Judge Datuk Ahmad Kamal
Arifin Ismail. He was charged with The charge, under Section 17(b) of The court set Feb 14 for sentencing.
giving a bribe of RM1,290 to a police the Malaysian Anti-Corruption – Bernama

6 theSUN ON THURSDAY | JANUARY 13, 2022 READ OUR HERE SCAN
NEWS WITHOUT BORDERS ME
/thesundaily

Fact-checkers urge YouTube to fight disinformation

PARIS: More than 80 fact-checking the globe, from Politifact and the “We urge you to take effective deleting content,” the letter said. the spread of misinformation”.
organisations yesterday urged online Washington Post in the United States action against disinformation and It also urged the platform to make “Over the years, we’ve invested
video platform YouTube to better to the Kenya-based Africa Check. misinformation and to do so with the
combat disinformation, offering to world’s independent, non-partisan sure its recommendation algorithm heavily in policies and products in all
help debunk false statements. Videos containing false fact-checking organisations. did not actively promote countries to connect people to
information had gone “under the disinformation to its users. authoritative content, reduce the
“Every day, we see that YouTube is radar of YouTube’s policies, “Our experience as fact-checkers spread of borderline misinformation,
one of the major conduits of online especially in non-English speaking together with academic evidence YouTube spokesman Elena and remove violative videos.”
disinformation and misinformation countries”, they said in an open letter tells us that surfacing fact-checked Hernandez said fact checking was
worldwide,” said the groups spanning to YouTube chief Susan Wojcicki. information is more effective than a “crucial tool”, but just “one piece She said YouTube had seen
of a much larger puzzle to address “important progress”. – AFP

Nato and Russia hold talks Election body probes
hacking report
on Ukraine stand-off MANILA: The Philippines’ election agency said
yesterday it had tapped law enforcers and
o US, allies hope revived Washington to engage with Moscow to head in Geneva for a direct US-Russia dialogue, but information security experts to look into a news
diplomatic engagement off fears of an all-out military confrontation. Washington’s European allies are keen not to report that said hackers had compromised its
would head off conflict be sidelined in security talks. systems, but insisted no data beach had
The two sides yesterday revived the occurred.
BRUSSELS: The United States and its Nato-Russia council, a platform that has not US officials promised solidarity as
European allies sat down with senior Russian met since 2019. yesterday’s meeting expanded the talks to The Manila Bulletin newspaper on Monday
envoys at Nato headquarters yesterday, ambassadors from Nato’s 30 members. reported a suspected breach on election servers
hoping that a revived diplomatic engagement “It is a timely opportunity for dialogue at a and that hackers allegedly accessed and
can head off the threat of conflict on the critical moment for European security. When “It’s too early to tell whether the Russians downloaded an estimated 60 gigabytes of data,
Ukraine border. tensions are high, it is even more important are serious about the path to diplomacy, or if that included “usernames and PINS of vote-
that we sit down around the same table and they are prepared to negotiate seriously. We counting machines”.
Both sides remain wedded to their starting address our concerns,” said Nato Secretary are,” White House spokesman Jen Psaki said
positions, and have begun a round of tense General Jens Stoltenberg as envoys sat down. on Tuesday. Commission on Elections (Comelec)
diplomacy, with some 100,000 Russian troops commissioner Rowena Guanzon dismissed the
massed near Ukraine’s frontier. Nato and Russia broke off practical Russia’s government wants to roll back story as “fake news”.
cooperation in 2014 after Moscow occupied what the Kremlin sees as the West’s
The West defends Nato’s “open-door and annexed the Ukrainian region of Crimea. post-Cold-War encroachment on its turf. “We see no evidence of any sort of breach,”
policy” towards potential future members like Comelec spokesman James Jimenez told a
Ukraine and Georgia, while Moscow is Russia’s diplomatic mission to the alliance “The continuation of Nato’s open-door regular media briefing.
demanding a cast-iron guarantee that the was withdrawn in October last year after eight policy and the further advancement of Nato
alliance will not expand further towards its of its staff were expelled on allegations of towards our borders is precisely what, from He said the allegations, which have alarmed
territory. espionage. our point of view, threatens us,” said Kremlin presidential candidates, were being validated.
spokesman Dmitry Peskov.
Russia’s massive troop build-up around But the former ambassador – now a deputy The Manila Bulletin did not immediately
already partially occupied Ukraine has forced foreign minister – Alexander Grushko was “This is exactly what we are asking not to respond to a request for comment on its report.
back yesterday to lead negotiations with continue through legally binding guarantees.”
Stoltenberg and US Deputy Secretary of State Manila Bulletin received information on the
Wendy Sherman, having earlier this week Peskov refused to be drawn on whether cyber attack from a source during the weekend,
described the revived council meeting as a Russia could launch a military operation if Art Samaniego, the newspaper’s tech news
“moment of truth”. denied. editor, told ANC news channel yesterday,
without elaborating.
On Monday, Sherman met Kremlin envoys “We would not like to throw around threats
and ultimatums like American officials.”– AFP The reported hacking brought back
memories of a data breach months before the
2016 presidential election, where personal data,
including passport information of more than 50
million Filipinos, was compromised by hackers.

“We should not let this (incident) pass and
Comelec must explain what happened and how
this will affect the upcoming election,” former
boxing champion Manny Pacquiao, who is
running for president, said in a statement.

The National Privacy Commission said it
would start its own investigation and called for
an explanation from Comelec and the
newspaper. – Reuters

BRIEFS IRAN ARRESTS SUSPECT
OVER ATTACK ON STATUE
FROZEN MEMORIES... Visitors posing for a photo in front of an iced-up fountain in Bryant Park in the Manhattan borough of New York.
– REUTERSPIX TEHRAN: Iran has arrested an alleged
“counter-revolutionary agent” on suspicion
Man jailed for setting ‘slow’ internet cables on fire of carrying out an arson attack on a
memorial to a revered general killed in a US
BEIJING: A man in China has been sentenced containing optical fibre network cables, a “After the incident, public security officials drone strike, a judicial official said. The
to seven years’ jail for setting internet court in the city of Cenxi said in a statement. seized Lan’s instrument of crime – a lighter,” statue of General Qassem Soleimani, who
equipment ablaze after becoming enraged according to the court. headed the Quds Force, the foreign
over a slow connection. The court said the man “used a lighter to operations arm of Iran’s Revolutionary
set a napkin he had on him on fire, then Lan was later hit with a seven-year jail term Guards, up to his death on Jan 3, 2020, was
The man, surnamed Lan, was at an burned a telecommunications box at a traffic for “destroying public telecommunications torched just hours after it was unveiled in
internet cafe in southern Guangxi province intersection”. facilities”. the southwestern town of Shahrekord last
last June when his frustration with the week. “The perpetrator of this shameful act
connection speed boiled over. The fire caused nearly 4,000 households The story prompted widespread ridicule has been arrested,” Chahar Mahal-Bakhtiari
and offices, including a public hospital, to lose on the Chinese internet, with one Weibo user province judiciary chief Ahmad-Reza
He responded by destroying a public box internet access for 28 to 50 hours. calling the man a “big baby”. – AFP Bahrami said on Tuesday. “The provincial
courts will punish the perpetrator of this
outrage as quickly as possible.” – AFP

ARMENIA CLAIMS THREE
KILLED IN BORDER CLASHES

YEREVAN: Armenia said yesterday that the
number of its soldiers killed in border
clashes with Azerbaijan had risen to three,
in the most serious outbreak of fighting
between the ex-Soviet adversaries in
months. Azerbaijan previously said one of
its soldiers died in the fighting on Tuesday
along the disputed border region, where
tensions are still high in the wake of a war
between the Caucasus nations in 2020. In a
statement, Armenia’s Defence Ministry said
the body of an Armenian serviceman was
discovered with fatal gunshot wounds in
the vicinity where “intense skirmishes” had
erupted the previous day. Both sides have
accused the other of initiating
“provocations” that sparked the exchange
of fire that left one Azerbaijani soldier and
the three Armenian troops dead. – AFP

7theSUN ON THURSDAY | JANUARY 13, 2022
NEWS WITHOUT BORDERS

Firefighter HK to create more violent democracy protests swept
punished for national security crimes Hong Kong in 2019, saying it was
secret side hustle needed to restore order and would
o New legislation to add to current scope that of Hong Kong’s constitutional duty only affect a “tiny minority”.
TOKYO: A Japanese firefighter includes secession, subversion and terrorism and cannot be further delayed,” she
moonlighting as a gaming YouTuber told lawmakers, adding that the A small committee of Beijing
had cold water poured on his career HONG KONG: The city will create a a widespread crackdown on dissent. government aimed to publish a draft loyalists will choose Hong Kong’s
by public officials, who uncovered host of new national security The current national security law by June. next leader in March, and Lam has
the secret side hustle by identifying crimes, Chief Executive Carrie Lam not yet said whether she will stand
his voice in the lucrative videos. said yesterday, as she presided over defines four crimes – secession, Lam did not outline what the for a second term.
the first session of a new “patriots subversion, terrorism and colluding new crimes would be.
An anonymous tip-off prompted only” legislature scrubbed of with foreign forces – and offenders Her first term ends in June.
Wakayama city in western Japan to political opposition. can face up to life in prison. But the specific offences Article Lam said yesterday it would be
launch an investigation into the 23 lists are treason, secession, difficult for the new national security
33-year-old’s channel, which had The legislation will add to a But Lam confirmed yesterday her sedition, subversion and theft of bill to be completed by the end of her
about 15,000 subscribers. sweeping national security law government would create new “local state secrets. first term, meaning the legislation
imposed directly on Hong Kong by legislation” that meets Article 23 of will probably fall to her successor.
But because the firefighter never Beijing that has transformed the Hong Kong’s mini-constitution, It also includes prohibiting any Addressing a chamber whose
appeared on screen, a local official international finance hub and which calls for the city to pass its own foreign political organisations from walls now bear China’s red-and-gold
had to painstakingly comb through empowered authorities to carry out national security laws. conducting activities in Hong Kong national emblem – placed above the
the clips for vocal clues to his identity. or local political organisations city’s official seal – Lam praised
“Article 23 legislative work is part establishing ties with similar Beijing’s security law.
The man’s salary was cut in overseas bodies. “Its function now is to act as an
punishment for contravening a law anchor to guarantee stability, to let
limiting public workers’ engagement China imposed its own security people know there are
in commercial activities. law after huge and sometimes consequences,” she told lawmakers.
The chief executive said the new
Over a 10-month period he had legislation would be similarly “well
uploaded more than 300 videos, written”.
typically showing him playing “The law requires us to prevent,
multi-player strategy games and curb and punish crimes.
racking up about ¥1.15 million yen “If prevention is done well, we
(RM42,000) in advertising revenue. can punish less.”– AFP

“We don’t necessarily think it’s a
bad thing that he was a YouTuber,”
said city official Hidetaka Amano.

“But it’s the fact he was profiting
from ads, some of which could be
inappropriate in nature,” Amano said,
adding His actions had “betrayed the
trust of residents in Wakayama”. – AFP

BRIEFS 439 PAEDOPHILE
SUSPECTS IDENTIFIED
BLAST SITE ... The
BERLIN: More than 400 suspected scene of an explosion
paedophiles have been identified in the Somali capital
in Germany as part of a probe into Mogadishu yesterday
a huge child pornography after a car bomb
network linked to the city of targeting a convoy was
Bergisch Gladbach, investigators detonated, killing at
said yesterday. A total of 439 least eight people.
suspects have been identified and – REUTERSPIX
65 children have been freed from
the clutches of paedophiles since Woman stuck in blind date’s house after lockdown
the network was uncovered in
October 2019, the Berg special BEIJING: Imagine being on a first Wednesday when a woman fifth date wanted to show off his she is looking for a more talkative
investigation group said.“We have date you could not end? That’s what surnamed Wang was having dinner cooking skills and invited me over to partner.
suspects from all walks of life” happened to a woman in China at her blind date’s house. his house for dinner.”
including“high earners and highly whose video blogs about going into “Besides the fact that he’s as
educated people” as well as a citywide lockdown during a blind “Just after I arrived in Since then, Wang has posted mute as a wooden mannequin,
“ordinary people”, said Berg leader date have gone viral. Zhengzhou, there was an outbreak short videos documenting her daily everything else (about him) is pretty
Michael Esser. “They went about and his community was put under life in lockdown, which show her good,” Wang told The Paper.
their work quite normally and Over 100 virus cases have been lockdown and I could not leave,” date cooking meals for her, doing
there were no indications in the reported in the central Chinese city Wang told Shanghai-based outlet household chores and working at “Despite his food being
working environment that such of Zhengzhou since last week, as The Paper on Tuesday. his laptop while she sleeps in, mediocre, he’s still willing to cook,
acts had been committed.” – AFP China battles to contain multiple according to clips published by local which I think is great.”
local outbreaks of the Delta and Wang said she went there for a media.
SAUDI SEX HARASSER Omicron variants. week-long trip to meet potential Wang did not disclose her age or
NAMED AND SHAMED suitors. So far it seems romance has yet the identity of the man in the videos.
Parts of the city were abruptly to blossom during their prolonged
RIYADH: A Saudi has been named placed under lockdown last “I’m getting old now, my family date, according to Wang who said Related hashtags have racked up
in a newspaper after his conviction introduced me to 10 matches. The six million views on the Twitter-like
for sexual harassment, in an Weibo by yesterday. – AFP
apparent first under new laws
tackling a subject that is often
seen as taboo. A court ordered the
public identification of Yasser
Muslim Al-Arawi, who was named
in the Okaz newspaper after he
was sentenced to eight months in
prison and fined 5,000 riyals
(RM5,500). Saudi Arabia only
started penalising sexual
harassment in 2018, as it
embarked on wide-ranging social
reforms. The man was found guilty
of “touching from behind, verbally
assaulting and harassing” the
victim, the Okaz report said. – AFP

Kim wants more ‘military muscle’ after missile test

PYONGYANG: Kim Jong Un Hypersonic missiles are listed programme, sparked swift accurately hit a target 1,000km away. them harder to track and intercept.
personally oversaw the successful among the “top priority” tasks for condemnation, with the US State South Korea’s military, which had “Everything about this test is a
test of a hypersonic missile, state strategic weapons development in Department branding it a “threat to reminder that North Korea is all-in on
media said yesterday, and urged North Korea’s five-year plan. the international community”. cast doubt on Pyongyang’s initial a new military modernisation
North Korea to press ahead with claims, said the missile launched on campaign,” Ankit Panda of the
building more “strategic military After the launch, Kim said North It was the third reported North Tuesday had reached hypersonic Carnegie Endowment for
muscle” despite international Korea must “further accelerate the Korean test of a hypersonic gliding speeds and showed clear signs of International Peace said on Twitter.
sanctions over its nuclear weapons efforts to steadily build up the missile. The first, which took place “progress” from last week’s test. Leif-Eric Easley, a professor at
programme. country’s strategic military muscle four months ago, was followed by one Ewha University in Seoul, said the
both in quality and quantity and last week. The missile flew 700km at an weapon was not ready for
Pictures in state media showed further modernise the army”, altitude of 60km at Mach 10 speed, deployment.
Kim using binoculars to observe the according to KCNA news agency. KCNA said the most recent test Seoul’s Joint Chiefs of Staff said. “Nonetheless, Pyongyang’s ability
second missile launch by the demonstrated “the superior to threaten its neighbours continues
nuclear-armed nation in less than a Tuesday’s test, which came as the manoeuvrability of the hypersonic Hypersonic missiles travel at to grow,” he said. – AFP
week. UN Security Council met in New York glide vehicle”. speeds of at least Mach 5 – five times
to discuss Pyongyang’s weapons the speed of sound – and
The agency also claimed it can manoeuvre mid-flight, making

8 theSUN ON THURSDAY | JANUARY 13, 2022
SPEAK UP

COMMENT byYSChan Why are people angry with
the Don’t Look Up reviews?
Gamechangers could
be for better or worse █ BY HARRY COCKBURN It shows us the mess we’re in. It does not
IF one were to attempt driving from HOW are we able to coherently judge the show us how to escape this mess.
Kalabakan to Serudong, both in Sabah, it promoting and growing healthy trade and world, our societies, institutions, arts and even
would take 82 hours non-stop to circle tourism, not just between Sabah and our basic everyday choices – when we are also Again, this either leaves us feeling
around Borneo Island, passing through Kalimantan, but also benefiting far-off Brunei being asked to come to terms with the fact that uncomfortable, or may ironically offer relief
Brunei, Sarawak, west and south Kalimantan and Sarawak. pretty much anything a human does is bad for that, at the very least, some of us are capable of
before heading north to east Kalimantan and our planet? admitting how screwed we are.
Sabah, a distance of 4,164km! The 4,164km road trip circling Borneo Island,
the third largest in the world, could easily be The climate crisis is manifestly worsening. But more than that, the intense debate over
But with the construction of a road linking marketed globally as one of the epic journeys The critical life-supporting systems on our the film’s critical reception should serve as a
Kalabakan directly to Serudong, future trips one could make in a lifetime and be included in planet are collapsing. We are to blame. turning point.
would take less than an hour as the distance will the bucket list of many adventurers.
only be 39km. Kalabakan is just 90km away from But even with this knowledge, formulating As our species grapples, for real, with
Tawau, the second or third largest city in Sabah, For a start, groups of superbikers on touring a rational and consistent response on an whether it has a future or not, it is simply not
with about the same population as Sandakan. motorcycles could be the trailblazers for circling individual level is practically impossible. good enough for those of us in wealthy nations
Borneo Island in a clockwise or anticlockwise to maintain our existing cultural norms (which
Interestingly, the distance between Serudong direction. “Should I buy these imported blueberries? largely grew out of the 20th century’s political
and Samarinda in southeast Kalimantan is Are the systems that allow me to buy and economic doctrines).
961km and the journey would take almost 24 These pioneers could identify the suitable blueberries in January also actually hastening
hours non-stop. stops for meals and accommodation along the the apocalypse? I need to eat something.” For their part, the critics haven’t done
way and share their videos online. anything different from how they would
Another 100km further is Balikpapan. The As a member of this planet-destroying normally review a film — they have looked at
proposed new capital in Indonesia would be Where there are no suitable hotels, wooden parasite species myself, I find such mental the scriptwriting, the acting, the jokes and the
built between Samarinda and Balikpapan. chalets could be swiftly erected, or container somersaults exhausting to the point of directing, and the film’s context in relation to
cabins converted for lodging. numbness. And I am not the only one. other films, as they would have done for any
Samarinda is the largest city in Borneo Island, other Hollywood action film.
with Kuching third and Balikpapan fourth. The Villagers could be roped in to set up stalls to As the positive public response to the film
new Indonesian capital is certain to bring sell local produce or handicrafts or offer services Don’t Look Up has highlighted, our species is But what is suddenly emerging is a disgust
massive development to southeast Kalimantan, such as nature guides and community-based becoming increasingly ill at ease with the level at this narrow way of thinking. A huge number
and the impact could reverberate as far north as tourism activities. of cognitive dissonance now required to make of responses to the film’s poor reviews say that
Tawau, which is the seventh largest city in it through each day with our sanity intact. the critics have “missed the point”. They are
Borneo. Car rental companies in Sabah, Sarawak and right.
Kalimantan could pool their resources together You must grapple with the complex realities
Recently, Deputy Sabah Chief Minister Datuk and offer self-drive vehicles for motoring and the dark conclusions they lead to, or you Why is it that scientists and environmental
Seri Bung Moktar Radin said Serudong will be holidays along this epic route that passes retreat – wittingly, or coddled by soothing campaigners are better able to articulate why
connected by road to Simanggaris in through their states and Brunei. distractions – into ignorance. the film was powerful?
Kalimantan, and the ingress will be a game
changer for the local population, as their Local partners could provide service to Either way, it is unsustainable for a It is because the lens through which they
incomes would be raised from economic and tourists in need of assistance. civilisation or for the natural world. view the world suddenly overlaps with the
tourism activities. wider concerns people have about the state of
With more infrastructure and amenities in Don’t Look Up has been Netflix’s most the world, not the state of cinema.
In time to come, the lives of Malaysians and place, bus tours along this route would become successful project to date, and it’s not hard to
Indonesians living or working in Serudong and increasingly popular. see why – it offers some of the broad It must be noted that not all critics attacked
Simanggaris are bound to undergo drastic coherence and basic truths we are all crying the film, and many did indeed recognise its key
changes. Passengers would have the option of out for. elements, not least the four-star review by my
completing the entire circuit over two weeks or colleague Clarisse Loughrey.
But whether they will be for the better or more or could just fly off or join in from one of Yet there is palpable anger at many of the
worse will depend largely on politicians, the cities enroute. bad reviews of Don’t Look Up, and this is for a Empire magazine also gave the film a good
authorities and enforcement agencies. fascinating reason. review, though it somehow did not make any
All these would be made possible and sooner mention that the film was an allegory for the
Without proper planning, implementation if we start the first step right, which is the 39km We know we are absolutely failing as a climate emergency — perhaps illustrating the
and execution, Serudong and Simanggaris could road now under construction linking Kalabakan society to find meaning and purpose. gulf in concern for the natural world this article
easily descend into typical border towns plagued to Serudong. If no social impact assessment had is about.
with corruption, prostitution, narcotics and been carried out previously, it is imperative that The film – even without the eloquence
contraband goods, with safety and security it must be done now without delay. many critics apparently would have preferred – As the climate crisis worsens, it will
compromised by the gathering of seedy has shone a new spotlight on the “scar across increasingly inform the human experience –
characters. Likewise, problems at the Thai border should our collective soul”, as anthropologist David from our most fundamental interactions with
not be replicated at the Kalimantan border Graeber describes the psychological impact of our planet, such as breathing, eating and
The local authorities here should learn from between Serudong and Simanggaris. capitalism’s brutalising grip in one of his books. drinking, to our relationships, arts, architecture
the mistakes and challenges facing border towns and political philosophy.
at the Malaysia-Thailand border and take One sticky issue would be commercial The film offers no redemption. It takes a
preventative measures including contingency vehicles such as tour buses and taxis crossing look at our society and judges it to be beyond In government, there have been calls for the
plans to nip problems at the bud should they borders. They are often seen as encroachment by saving: our leaders are abject, the systems we creation of a “net zero ministry”, which could
arise and not allow them to take root and fester. jealous locals. work within are largely pointless and work across all departments to vet policies to
damaging, our ill-educated populations only ensure they are working to a common
A well-managed Immigration, Customs and YS Chan is Asean Tourism Master Trainer for want easy answers or comforting lies. environmental framework.
Quarantine complex staffed by officers with the travel agencies, master trainer for Travel &
highest integrity could go a long way in Tours Enhancement Course and Mesra This is extremely uncomfortable for many This is a good idea, it ought to be
Malaysia. He is also a tourism and transport people – perhaps especially those skewered in implemented. A similar approach must be
industry consultant and writer. Comments: the film – including those in the media who taken by the media en masse.
[email protected] deal in light entertainment.
The critics of the future must invest more
As well as the climate crisis, the film heavily in the human project, that means
captures our jumbled and inchoate response getting a grip on how the climate crisis and the
to the coronavirus pandemic, raising questions environment affect their subject.
about trust in the media, politicians,
corporations, science and whose interests are We must find a new way of seeing what we
ultimately being served. are doing and the world we are a part of, not
apart from. – The Independent

TELLING IT AS IT IS

LIFESTYLE YOUTH FASHION ENTERTAINMENT

THURSDAY | JANUARY 13, 2022

LEoaoskting It’s all downhill for
Don’t Look Up
EJaxppalonreestehiensinptiereridorcsafoefsIninstKaL-w>>o>rthPyage 7
>>> Page 3

123RF Pay attention to your
testosterone levels

>>> Page 4 & 5

ENTERTAINMENT FOLLOW ON INSTAGRAM SCAN
ME
2 theSun LYFE ON THURSDAY | JANUARY 13, 2022 @thesundaily
Garfield said that
█ BY CELESTINE FOO, MARIETTA MU, THASHINE SELVAKUMARAN & MARINA MUHTAR studio execs told
him he was not
ARMYs concerned handsome
Jimin’s merch enough to play
might sell out Prince Caspian. –
AFP

HYBE MERCH is currently releasing ‘artist- Almost a prince
made collections’ designed by each o The Amazing Spider-Man star Andrew Garfield
member of BTS, which was first announced reveals he was rejected for Prince Caspian role
through Twitter on Dec 31, 2021. BTS’s Jin
and RM have already had two extraordinary IT is easy to remember the successful roles reminds us how he is human too. The role eventually went to Barnes, whom
successful runs, with their merch gaining actors get, while the roles they don’t score Sharing his story with Entertainment Garfield admits did a beautiful job. – WALT
positive reactions from ARMYs, and selling often get overlooked. Having already DISNEY STUDIOS
out within minutes. received acclaim last fall for his role in The Tonight, he said: “I remember I was so through all our minds at a certain point, but
Eyes of Tammy Faye and after winning a Golden desperate. I auditioned for Prince Caspian in Garfield made the best of it.
The most recent collection to be Globe on Monday for his performance in Tick, The Chronicles of Narnia and I thought, ‘This
launched was Taehyung. As part of his Tick ... Boom!, Andrew Garfield’s biggest career could be it, this could be it. And that handsome, He said that he spent a year and a half waiting
artist-made collection, Taehyung designed achievement to date is still his turn as Spider- brilliant actor Ben Barnes ended up getting the tables, working at Starbucks, coaching cricket,
a Mute Boston Bag and an art brooch set Man in Sony’s previous film adaptation of the role. and doing telemarketing when there was a
with various themes for ARMYs. As webcrawler’s tale. pause in his career. He describes donning all
expected, that too sold out almost “I think it was down to me and him, and I those hats as “a kind of a necessary lucky thing,
immediately, with some fans complaining He recently made an amazing return to the remember I was obsessed. I was obsessed. And in a way.”
that they could not even access the website role opposite Tom Holland and Tobey Maguire I thought, why not me? Why not me? Ben Barnes
where it was being sold. in Spider-Man: No Way Home. is a very handsome, talented man. So in
retrospect, I’m not unhappy with the decision
ARMYs are now concerned if it would be One role he has been aiming for, however, is and I think he did a beautiful job.”
possible for them to even get a chance to that of Prince Caspian in The Chronicles of
buy BTS member Jimin’s upcoming merch Narnia. Unfortunately, that is not how the world The reason Garfield did not get the role
on sale when it drops on Jan 18, as it’s works. Not even for Spider-Man. would be enough to hurt a lesser man – the
getting more difficult for ARMYs to execs said he was not “handsome enough.”
purchase. In a recent interview, the British actor
“Why not me?” is something that goes
Fans are already theorising about what
sort of merch would be released by Jimin.
Some said it might include his signature
accessories. One thing is for sure – no
matter what the merch is, there is no doubt
that it will sell out super-fast.

ARMYs who managed to purchase
earlier merch are definitely considered to be
the fortunate ones. Still, other fans can’t
wait to try their luck on purchasing the
merch once it goes on sale.
All previous BTS merch have sold out within
minutes of being put on sale. – HYBE

Janet Jackson shares thoughts on body confidence Jay Park set to launch
new idol group
IN a recent interview with Allure magazine, Known for her past issues with her body image, Jackson reflected about how entertainers
Janet Jackson spoke about the steps she has today seem more comfortable in their own skin. – GETTY IN A wide-ranging career, K-pop legend Jay Park
taken to become a leader in body went from composing songs and assisting
acceptance. more focused on choosing to accept the way always accept me for who I am,” musicians with their music projects to
that she is perceived going forward, rather she said. “Everyone would always managing AOMG and H1GHR MUSIC.
Jackson noted that it took a lot of work to than trying to control it. want to stay young and this and
create a foundation for women to learn to that, but it’s inevitable. I mean, Today, he continues to make waves as he
fully embrace and love themselves. “I’m very fortunate to have a very loyal we’re all going to get there.” talks up business with Kakao Entertainment to
and loving fan base. And I think they will establish a new label and create his very own K-
“It was something very tough, very pop boy group soon.
difficult. But I’m glad I walked through it. I’m
really glad I got in. It was a way of accepting Meanwhile, Kakao Entertainment issued a
and loving, accepting yourself and your statement saying the discussion has not yet
body,” she said. been confirmed. Insiders reveal that the South
Korean entertainment company will be
Jackson said that women in investing a huge amount to aid Park’s
entertainment nowadays seem “comfortable establishment.
in their skin, in their size, in being full-
figured.” Previously, Park resigned from his position as
the head of AOMG and H1GHR MUSIC labels
She noted that it was different from how which he founded with Cha Cha Malone, but
things were when she was younger because will remain as an adviser to both.
women always had to be thin or look a
certain way. The American rapper has managed
various music artists including
Even so, she is very pleased to see that all Loco, Gray, Simon Dominic,
types of women’s bodies are accepted and Hoody, Woo Won-jae, Code Kunst,
are seen as beautiful now. UFC fighter Chan Sung Jung (The
Korean Zombie), Lee Hi and
Similarly, British pop star Billie Eilish, many more. AOMG has been
who was known for wearing baggy clothes, nominated for Label of The Year
did a cover story for British Vogue in at Korean Hip-hop Awards from
revealing clothes as part of her taking control 2019 to 2021.
of her body, which was a message that it’s her The 34-year-old first made his
right to reveal her body in any way, shape, or debut as a member of 2PM in
form she chooses. 2008.

Jackson noted that she is excited to see Park is looking to
that women are starting to be in control of start a new
how they are seen, despite what the public chapter in his
thinks. career. –
SOOMPI
She thinks that it’s important that all
women continue to talk about that issue,
even though things have changed for the
better since last time.

For the time being, Jackson said that she is

FOLLOW ON FACEBOOK SCAN ENTERTAINMENT
ME
/thesundaily 3theSun LYFE ON THURSDAY | JANUARY 13, 2022

█ BY MARK MATHEN VICTOR Academy Award winners DiCaprio and Lawrence fail to save the film from
the real comet: McKay’s self-indulgent writing. – THEVERGE.COM
A COMET is hurtling towards
Earth in Adam McKay’s A disaster (of a) movie 0Cast:
Don’t Look Up, with the Leonardo
estimated impact in six oAdamMcKay’ssatireonhumanapathyandenvironmentisunsubtleandpoorlyexecuted DiCaprio,
months expected to wipe out every Jennifer
living organism on the planet. The Lawrence,
planet’s warning system and first line Meryl Streep
of defense are Dr Randall Mindy and Jonah Hill
(Leonardo DiCaprio) and Kate 0Director:
Dibiasky (Jennifer Lawrence). Adam McKay

But standing in the way of the Mindy gets out of his car to look at the E-VALUE
duo’s mission to get the message out sky, and the frame shakes as the 3
and potentially save the planet is cameraman readjusts the camera for
everyone else, from the US President a better angle of Mindy, and then it ACTING
Janie Orlean (Meryl Streep) and her cuts to another camera outside the 6
administration, mega-corporations car. Why was the camera shaking not
such as the fictional tech company edited out? PLOT
BASH and its CEO Peter Ishwerwell 4
(Mark Rylance), to major news outlets Towards the end of the film, during
that perpetuate and feed the apathy of a rather intimate sequence with a Academy Award
McKay’s fictional world. handful of characters, the camera is winner Meryl
placed facing an actor in a close-up. Streep exemplifies
Art both mimics and satires real For no reason at all, as the actor is probably the one
life in Don’t Look Up, even if the film’s speaking his lines, the camera’s lens good thing about
subject matter is about an extinction- goes out of focus, and viewers are left the film, which is
level event comet. Just look towards watching a blurry screen for several the acting by
the increased apathy of certain seconds. everyone involved.
quarters towards the Covid-19 – THEVERGE.COM
pandemic, or the larger, looming Though McKay’s intentions for the
inevitable effects of climate change. film are most certainly present and
noble, the execution of those ideas
However, everything McKay and his ‘vision’ is a great display of
juggles in Don’t Look Up is what a trainwreck look like.
spectacularly fumbled, like a clown
juggling lit molotov cocktails, because In better hands, with tighter
the writer-director is too busy “feeling writing, editing and directing, Don’t
himself”, to put it as lightly and family- Look Up might have been a great
friendly as possible. satire of modern society.

The sense of urgency and anxiety
faced by the leads, Mindy and
Dibiasky, never gets across because
it’s consistently self-trivialised by
McKay himself as he’s too busy
turning everything into either a
punchline or a satire.

One has to wonder whether the
frustration displayed through the
acting of DiCaprio and Lawrence is
actually due to them having to put up
with McKay’s joke of a screenplay.

The latter ultimately drags out the
film’s pacing, which goes from
“Alright, so the comet is coming. The
characters have to do something
about this!” to “Alright, another joke
about how the president is a female
Trump. How much longer until the
comet hits and ends this film?”

McKay’s screenplay is akin to a
star-studded SNL episode, but
unfortunately, it’s one of the modern
episodes, and not classic SNL. This is
another way of saying Don’t Look Up
feels like TV comedy. It’s also another
way of saying the film, despite how
many A-list Hollywood celebrities are
in it, comes off as “cheap”.

The technical and editing gaffes
visually present throughout the film
further adds to the cheapness.

At one point in the film, DiCaprio’s

This year’s New Year’s resolutions could bring plenty of podcast debuts
IT will have escaped no one’s notice that podcasts have found their audience.
Two thirds of Britons over the age of 16 have already podcasts are all the rage right now. They Before the pandemic, we used to listen to
listened to a podcast episode. – ETX STUDIO are especially popular in the UK, according them “to pass the time” in the car or on
to a new study by Acast, where more than public transport. Since then, they’ve made
one in 10 Britons are supposedly planning their way into our homes, and it’s not
to lend their voice to the format by uncommon to dip into one of these pocket
launching their own podcast this year. audio formats while cooking, gardening or
even before going to sleep.
The Swedish company surveyed 500
people in the UK to find out about their “The people we surveyed were
podcasting habits. It turns out that some members of the UK public – not already
12.4% of respondents have been toying established podcasters or names – which
with the idea of taking the mic. For many, underpins our belief that podcasting
it’s even a new year’s resolution, just like should be open to everyone, and
exercising, losing weight, quitting smoking reinforces the accessibility of the medium,”
or eating less sugar. said Matt MacDonald, chief product officer
at Acast, in a statement reported by
But while making New Year’s Podnews.
resolutions is easy, sticking to them can be
harder. The most podcast-loving Britons, Podcasts are becoming as much a part
however, seem determined to follow of life in the UK as they are in the US. Two-
through on their plans. According to Acast, thirds of Britons over the age of 16 have
two thirds of those surveyed say that they listened to one, according to a report titled
want to launch their own show in the first The Infinite Dial: UK 2021 from Edison
few months of the year, with February Research. And once people get into them,
being the most-often cited. it seems that they can soon get hooked. On
Podcasts are part of daily life average, people in the UK listen to five
These results show just how much episodes a week, making podcasts a
veritable go-to format. – ETX Studio

HEALTH

4 theSun LYFE ON THURSDAY | JANUARY 13, 2022

█ BY JOHN TAN Restoring hormonal balance
TESTOSTERONE syndrome
deficiency, otherwise o Doctor Ngoo Kay Seong aims to continue educating men everywhere about low testosterone
known as hypogonadism, is
a common health issue that
many men experience as they age.
The condition, which sees the
decline in the levels of testosterone,
often begins affecting men after the
age of 30. In fact, one in five men biochemical syndrome that requires have an accident, injury or illness testosterone. The concept of the
exhibit symptoms of the process as a laboratory test to prove it. And that could damage your testicles. treatment is called testosterone
soon as they reach their late 30s. also, you must have a record of replacement therapy which aims to
But unlike menopause, the cause exhibiting these reported symptoms. “So, these are the main causes of bring up the level and quantity of
of testosterone syndrome deficiency why men have low testosterone. But testosterone. In return, this
is not solely due to ageing. And the “Only then, it can be proven that most men will not exhibit any improves your physical appearance,
effects concur sometimes can be you are experiencing a deficiency in symptoms. Only when you are sexual drive and other health
deadly. serum testosterone.” compounding it with other parameters.
Despite this, the awareness of the What are some of the factors conditions, it becomes more
condition is still relatively low, with causing this, apart from ageing? obvious.” “The treatment comes in various
many men dismissing it as a normal “Apart from ageing, it would be due Are there any side effects if left forms. The first one is pills which
consequence of ageing. to metabolic health conditions like untreated? require patients to take them three
Hence, Doctor Ngoo Kay Seong diabetes, high cholesterol and “If you do not address the times a day. But it can be pricey due
has taken it upon himself to tackle obesity. Diabetes and obesity testosterone issue, things will to the sheer volume required, and
this issue. specifically have been linked to the worsen in many ways. So, if you are troublesome due to possible side
Ngoo, a consultant urologist, has status of one’s testosterone. suffering from pre-existing effects such as nausea and digestive
been on a mission in furthering the conditions like diabetes or obesity, issues. So, patients can then opt for
cause by raising awareness. During a “It is like a chicken and egg story, your condition may not improve. It creams or gels. Patients are required
recent conversation with theSun, which one comes first? So, it is will also affect your relationship to apply them around their body.
Doctor Ngoo elaborated more about interlinked. The other reason may be with your family and close ones.
the condition and the treatments Dr Ngoo Kay Seong is a consultant due to the long-term use of certain “However, you will have to ensure
available. urologist at Pantai Hospital Cheras. drugs like steroids. Those who take a “You may feel irritable, anxious it dries up before you hug someone.
– DR NGOO lot of opioids, antipsychotics, and or even depressed, causing This is because you may
How important is testosterone to steroids can [suffer from] low difficulties in your personal accidentally transfer the hormones
a man’s health? “For instance, you may not have testosterone. relationship. This also affects the to other people, which will cause
“Testosterone in general is not only adequate male features or perhaps professional lives of the patients. For issues for them.
important for sexual functioning you may also grow breasts. These “Of course, not forgetting Covid- instance, I have men in their prime
adult males, but it is also important are problems related to early-onset 19. But I think the study on Covid age of 40 to 60, those who are taking “The next form is the form of an
for sexual maturation and hypogonadism of hormones. and the long-term effects on the lead in their careers. injection. It is called an
development. testosterone are still ongoing. We do intramuscular injection, as it is
“While the symptoms for late- not know whether this is going to be “And productive and heavily injected into the muscle.
“So, if you are born with the XY onset hypogonadism ranges from a short-term thing: whether once contributing to the economy. But if
chromosome, you are meant to be a having low sex libido, penis function you recover from Covid, will your only they focus on their health, they “One injection can last up to
male with male genitalia. and ejaculation. This is a common testosterone levels return to normal? can definitely perform better.” three months. And patients are
condition among men over age 40. Is there a cure to treat patients required to take four injections per
“But if you do not have enough In fact, one in five men has this “And obviously, those who have with this condition? year. Most men generally prefer and
testosterone, you may be born with condition. undergone surgery from the early “Yes, there are various treatments accept this form of treatment.
ambiguous genitalia. This will then days of their life. Like having your available to treat patients with low
stunt your growth spurt as an adult. “So, it is a clinical and testicles removed, your testicles then “However, the full effects of these
cannot compensate. Or also if you benefits do not appear immediately.
It requires at least a year to see the
full benefits.”

Erectile
Dysfunction is
one symptom
of Testosterone
syndrome
deficiency. –
ISTOCK

HEALTH 5

theSun LYFE ON THURSDAY | JANUARY 13, 2022

But as the saying goes, One in five
prevention is better than cure. men exhibit
Are there any precautions men symptoms of
can take to avoid this condition? Testosterone
“The thing that we usually tell our syndrome
patients is to adopt a healthy deficiency. –
lifestyle. That means having a good ISTOCK
work-life balance. This comes in the
form of adequate rest, regular
exercise, and having a healthy diet.
All these can help.

“Aside from that, a healthy
lifestyle also comes in the form of
not abusing medications and getting
regular checkups.

“If you are experiencing
symptoms of low testosterone, it is
best to consult a doctor to get it
checked as you need verification.
And if you are diagnosed with it, be
committed to the treatment.

“Visit your doctor regularly. Only
then you can see the efficacy of the
treatment.”
What can the government do to
battle this issue?
“I think first and foremost, the
government can start by promoting
a healthy lifestyle among men.

“More importantly, they can
create awareness by speaking about
male ageing. All the issues one
encounter when they age and how
they may worsen with health
problems like diabetes and obesity.

“I mean, there are many issues
relating to men’s health that can be
brought up. From prostate and
testicular cancer to male
testosterone deficiency, the
government can shed light on these
serious issues that are affecting
men.

“After all, we have a Ministry of
Women Affairs in this country, but
we have yet to have a Ministry of
Men Affairs in office.”

To find out more about the condition
or see if you are at risk, visit
www.tackletdasia.com.

Portable prostate cancer test may help reach underserved men

RESEARCH at Cornell University An infographic showing how easy the test is to run. – CORNELL UNIVERSITY
in the United States has produced
a highly portable and rapid similar to those found in at-home is that the technology to make them to also develop a mobile phone- rates.
prostate cancer screening kit that Covid-19 antigen or pregnancy tests. really cheap or mass produce them based system to detect infectious PSA testing frequency has
could provide early warning to Users would draw a drop of blood has been around for many years,“ diseases, inflammation and declined among all US ethnic and
populations with higher and apply it to the test strip, and in Srinivasan said. He estimates that nutritional deficiencies in saliva. racial groups over the last decade,
incidence of prostate cancer, and about 15 minutes, two lines appear PSA test kits may be mass produced Meanwhile, co-author Dr. David with the rate of decline steeper for
particularly those with limited on the strip. and sold for a few dollars each. Nanus, professor of medicine in the African-American men,
access to health care. Division of Hematology and Medical particularly those between 40 and
The colour of the two lines is due While a different PSA test kit Oncology and a member of the 54 years old. Close to 43% of
The proof-of-concept test, first to 150-nanometer gold nanoshells, developed by a private company has Meyer Cancer Center at Weill African American men aged 41
described online last November which greatly enhance the test’s been approved by the FDA, it works Cornell Medicine, reached out to and older have never had a PSA
in the journal Current Research in sensitivity to detect PSAs and make by putting a blood sample into a Mehta wanting to collaborate on a test, according to one study.
Biotechnology, is inexpensive and the lines appear more intense in microfluidic channel and has a portable PSA screening device to “There is a need for increasing
uses a test strip and a small cube- their presence, Srinivasan said. larger bench-top analyser, making it reach underserved populations. access to PSA screening among
shaped 1.6in reader to quantify a While a pregnancy test gives a less portable and more expensive to African-American men African-American men who are
marker of prostate cancer – called positive or negative result, the cube own and operate. frequently do not have access to otherwise not able to get tested
prostate-specific antigen (PSA) – reader senses the intensity of the test prostate cancer PSA screening and periodically, and one of the ways
from a drop of blood in minutes. strip lines and then calculates and Study co-author David Erickson, are diagnosed with more advanced is we take the test to them at
displays a measurement of PSA the S.C. Thomas Sze Director and prostate cancer, contributing to various community settings,“
The test was first aimed at concentration in the blood. Sibley College Professor in the Sibley disproportionately higher mortality Srinivasan said.
poorer, mainly African-American School of Mechanical and Aerospace
communities in the US, but hold “Another advantage of test strips Engineering, has worked with Mehta
tremendous potential for
implementation in other less
developed communities around
the world.

“We’ll be able to take a drop of
blood in a community setting,
such as a barbershop, and be able
to deliver results in 10 to 15
minutes right there, which can
indicate when somebody needs
to come in for further tests,“ said
Dr. Saurabh Mehta, the Janet and
Gordon Lankton Professor in the
Division of Nutritional Sciences
and the paper’s senior author.
Balaji Srinivasan, a research
associate in Mehta’s research
group, is the paper’s first author.

“It’s creating that first point of
contact that hopefully builds
rapport and brings health care
services to the people at the point
of need,“ Mehta said.

The kit comes with a test strip,

FEATURE

6 theSun LYFE ON THURSDAY | JANUARY 13, 2022

When you get happy, you get healthy
oWe explore the link
between hedonism and Taking the time
your health, and how to to indulge
turn it to your advantage ourselves can
actually be
A█ BY MARIETTA MU good for our
S the new year sets in, we tend to set wellbeing in
new year resolutions and long term the long run. –
goals for our coming year. However, 123RF
perhaps we’ve forgotten or overlooked
short-term pleasurable activities as they’re
associated with a negative connotation as
they’re linked to the egoistic pursuit of short-
term gratification by indulging in sensory
pleasures without regard for the consequences.

What is hedonism
Hedonism is defined as the pursuit of pleasure
and sensual self-indulgence. When you think of
the word, you might imagine getting drunk and
partying every night, but what if we think of
hedonism as the intentional savouring of
simple pleasures, like having a cup of coffee
with a friend or cuddling with a pet?

Hedonism and its philosophical ancient
roots are not based on a life of untamed
appetites, but on moderate pleasures and
respect for others. By seeking and maximising
these kinds of simple pleasures, it can boost our
health and well-being.

How hedonism is linked to your health self-control. expensive purchases, and fancy holidays. Instead of restricting yourself and thinking
A state of pleasure is linked with reducing stress. Much research has been devoted to finding Think about the last time you felt glad. A you’ll just do it some other day, consciously
When we feel pleasure, our sympathetic make time and plan to do them this weekend.
nervous system which controls our fight or out how we can reach long terms goals more pleasure may disguise itself and may look very
flight response is calmed. effectively, and the prevailing view is that self- minor, like eating a delicious lunch you made, If you can’t identify what brings you pleasure
control helps us prioritise them over having a bath, a conversation with a or pain, write down things you’re grateful for for
We then experience relaxation and stress momentary pleasure, and if you’re good at self- grandparent, or looking through old photos. the day as well as things that you didn’t like.
relief, and studies have also shown pleasurable control, it supposedly leads to a happier and Start noticing a pattern of what makes you
emotions with broader and more creative more successful life. Yet, these pleasures are anything but small. happy and what doesn’t serve you as much, and
thinking, as well as a range of positive outcomes If properly enjoyed and delighted upon, reevaluate the life you’re living at the end of the
including better resilience, social In the research, it was found that certain these sort of activities may be among the most week. After that, slowly make the changes to
connectedness, well-being, physical health, people get distracted by intrusive thoughts in moving and satisfying we can have. make your life the life you want to live.
and longevity. moments of relaxation or enjoyment, because Appreciating what we have at hand isn’t an
they are thinking about activities or tasks that attack on ambition, but there’s no point in Notice how your body feels throughout the
If your morning coffee gives you pleasure, they should be doing instead. For example, they chasing the future until we’re better at being day and write it down, notice how your body
just pause and relish it while you drink. Inhale might think about needing to work out when more attuned to the modest moments and reacts to the food you eat. If something feels bad
the fragrance fully and focus on the warm, they’re watching TV on the couch. things that are presently or readily available to or you feel yourself starting to stress out, pause
smoky, bitter deliciousness of it. Feel the us. what you’re doing and take a break. If you find
warmth of the cup in your hands and immerse Those thoughts about conflicting long-term More fundamentally, the smallness of small yourself trying to justify and rationalise the bad
yourself in the moment. goals undermine the immediate need to relax. pleasures isn’t really an assessment of how things, it’s time to be a little more honest with
On the other hand, people who can fully enjoy much they have to offer us. Instead, it is a yourself because maybe your body is telling you
This kind of savouring results in a totally themselves in those situations tend to have a reflection of how many good things the world that it doesn’t want to play this character that
different, and richer, experience than if you higher sense of well-being in general and are unfairly neglects. A small pleasure is a great you have created anymore.
absent-mindedly gulp down the coffee while less likely to suffer from depression and anxiety. pleasure in waiting, and appreciating small
dodging traffic and talking on the phone. The How to maximise pleasures pleasures means trusting our own responses. By giving way to occasional hedonism, you
act of savouring intensifies the pleasure we We’re surrounded by ideas of the sort of things Start by doing more things that you’ve can get a better quality of life. Of course,
extract from simple things and delivers greater that will make us happy. We tend to think that in always wanted to do. If you’ve been putting off suffering is inevitable in life, and learning from
satisfaction from them. order to be satisfied, we need to aim for activities because you think that you should our mistakes and pasts will always help us, but
extraordinary experiences and feelings, save up your money, try and enjoy life a little. the pursuit of pleasure will help us to live a more
According to a research from the University enjoyable and longer life.
of Zurich and Radboud University in the
Netherlands, enjoying short-term pleasurable
activities that don’t lead to long-term goals
contributes to a happy life at least as much as

TRAVEL 7

theSun LYFE ON THURSDAY | JANUARY 13, 2022

A taste of Japan

o Missing being able to visit the Land of the Rising Sun?
HeadouttotheseJapan-inspiredcafésright hereinKL!

█ BY MARINA MUHTAR food and architectural designs around the
world.
TOURISTS from all over the world gush
over Japan as a tourist destination, Taking inspiration from the country’s
mainly because it offers travellers an unique architectural look, some of the cafes
array of attractions and extraordinary here are imbued with minimalist design that
experiences. Besides its systematic public just scream quintessential Japan. If you’re still
transportation, Japan is also full of sublime counting the days until you can book a trip to
architectural wonders. visit the country, or want to experience a taste
of what it feels like, here’s a list of Japan-
Thus, it is no surprise to see elements of inspired cafés in Kuala Lumpur for you to
Japan embedded in every aspect of fashion, check out.

Perfect for al fresco dining, Mori Kohi offers a relaxing place to enjoy your meal. – MORI KOHI

0 MORI KOHI minimalist aesthetic. But, if you’re not a
Missing Japanese cuisine? Head over to Mori coffeecionado, this cosy café serves matcha
Kohi to relive the delectable goodness of and fresh juices as well. From chicken karaage
Japanese dishes. Hidden in the heart of Kuala curry rice, torikatsu curry rice to cold ramen,
Lumpur, Mori Kohi offers modern Japanese Mori Kohi serves all the mouth-watering
food and delicious coffee. The best part about dishes to keep your taste buds busy.
this café is that you are surrounded by Location: 11, Jalan Aman, Off Jln Tun Razak,
luscious green spaces as you enjoy a meal 55000 Kuala Lumpur, Wilayah Persekutuan,
with friends. Designed with an outdoor Kuala Lumpur
concept, this café is also infused with a

Aki’s Kohi is a great place to stop and grab a cuppa on your way to work. – AKI’S KOHI 0 KAKIYUKI
This next Japan-inspired café
0 AKI’S KOHI that are enough to keep you full and energised specialises in shaved ice desserts!
Kohi means “coffee” in Japanese. As you step in, before your next meal. Besides that, homemade Kakiyuki is famous for its innovative
you’ll be greeted by the aroma of fresh coffee. sweet treats are also on the menu such as cakes, flavours that make them one of the
This hidden café in Cheras opens as early as scones, brownies and cookies. Here, you have best kakigôri sellers in town! Made
9.30am which is an ideal time for you to grab a the option to choose your roast level for the with premium homemade and dairy-
cuppa before you start to get into the thick of perfect cup of coffee. free ingredients, Kakiyuki serves 10
work. Inspired by Japan’s Autumn season, the Location: Lot 2-00-07, D’Alamanda Shoplot, types of kakigôri. Its best-selling
ambience in Aki’s Kohi enables you to enjoy a Jalan Pudu Impian 4, Jalan Pudu Ulu Cheras, desserts are Matcha Colada, Matcha
peaceful moment alone, especially outside of its 56100 Kuala Lumpur Roll Cake, Matcha Anmitsu and
peak hour. This cosy café serves sandwiches Monaka Ice Cream Sandwich. So, if
you’re a matcha lover, you’re in for an
0 KISSA X COFFEE Don’t be deceived by the small space, Kakiyuki has some icy treat! Besides Kuala Lumpur,
Another minimalist café is Kissa X great kakigôri desserts. – KAKIYUKI Kakiyuki has another branch in Johor
Coffee that is situated in Taman Tun Bahru as well. If you love shopping in
Dr Ismail (TTDI). This café specialises Pavilion KL, be sure to stop by
in Japanese filtered coffee to amplify Kakiyuki and try their daifuku and
your coffee flavours and experience. mochis that are guaranteed to melt in
They carefully choose each coffee your mouth! Whether you’re looking
bean, as well as fresh milk and other to fill your tummy or craving for
ingredients to ensure that visitors get a something sweet, Kakiyuki is the
good experience. Kissa X Coffee also perfect dessert café.
allows you to choose your preferred Location: Kakiyuki, P4.17.00, Level 4,
brewing method, such as paper or 168, Jln Bukit Bintang, Bukit Bintang,
metal or drip and siphon. Besides that, 55100 Kuala Lumpur
it is also a work-friendly café as it oozes
nothing but jazz vibes. You can also
enjoy your black coffee or iced latte
with their selection of cakes!

Kiss X Coffee specialises in Japanese filtered coffee. – KISSA Location: 86A, Jalan Burhanuddin
X COFFEE Helmi, Taman Tun Dr. Ismail, Kuala
Lumpur

0 SUNBATHER COFFEE Find some great curry dishes at this quirky, but modern little cafe. – CUREÉ
No, this isn’t a place for you to get a
suntan. It’s a place that serves perfect Besides a relaxing interior, Sunbather Coffee serves great 0 CUREÉ mayonnaise and Bonito flakes. Apart from
Japanese dishes. Located in The Sphere, Japanese-inspired dishes. – SUNBATHER COFFEE Cureé takes on a modern look and serves the that, you can try their Belgian Chocolate
Bangsar South, this relaxing café serves ultimate Japanese curry. Here you’ll get to Brownie, Fried Snickers with Vanilla or
Western-influenced Japanese food, satisfy both your sweet and spicy cravings Chocolate Ice Cream as well. From spicy food
desserts, and of course, lattes! Their best- with their Chicken Katsu with Japanese curry to sweet desserts, you can get it all here in
selling dish is Beef Hambugu, which is and Hokkaido-style Tomato Curry. This café Cureé!
made from Australian ground beef and serves rice bowls and desserts such as Location: 40, Jalan 1/77A Off Jalan Imbi,
served with curry or demi-glaze. You can Okonomiyaki Waffle that is made with Changkat Thambi Dollah, 55100 Kuala Lumpur
enjoy their juicy Hamburg steak, either Okonomi sauce and drizzled with
with a side of rice or a baguette. Besides
that, if you’re looking for Japanese
comfort food, their Japanese Beef Kuro
Curry will definitely excite your
tastebuds! You can also get your sweet fix
with their yummy roll cakes, madeleines
and parfaits that are crafted with
homemade ice cream.
Location: UG-12 Upper Ground The
Sphere, 8, Jalan Kerinchi, Bangsar South,
59200 Kuala Lumpur

MEDIA & MARKETING

8 theSun LYFE ON THURSDAY | JANUARY 13, 2022

Bringing smiles
to children

o Goodday Milk’s recent art campaign lets
young artists put their works on PPEs

BRINGING smiles to Malaysian the younger generation, but also
children, many young artists came highlighted the desires these children
together for Goodday’s Happee PPEs have for those hospitalised – to
campaign to spread joy and cheer to remain positive during these
their hospitalised peers during this unpleasant times because greater Yee (third from left) handing over Goodday’s Happee PPE decorated with the children’s winning designs to Ariesza at KPJ
challenging time. days are in store. Damansara Hospital.
The bright colours used in these
Goodday Milk launched the artworks also highlighted how
campaign in conjunction with World Goodday Milk lets the goodness flow
Children’s Day to allow children to through these happy winning
give personal protective equipment designs.
(PPE) a joyful new look. Goodday Milk expressed the hope
that with these cheery designs,
The brand showcased the winning hospitalised children will be
designs on customised PPEs, which empowered to face any difficulties
were handed over to Ariesza Noor, and challenges with resilience.
chief corporate officer, KPJ Etika Sdn Bhd vice president of
Healthcare Berhad at KPJ Damansara marketing Yee Pei Kuan said: “There
Hospital on Dec 17. is no doubt that children tend to get
scared and have increased levels of
Young artists Auni Maisarah anxiety when seeing healthcare
Mustaffa (11 years old), Choong Xin professionals dressed in their PPEs,
Yu (six years old) and Chua Ee Xin bringing about negative The three winning artworks.
(five years old), were selected as the
top three Grand Prize winners and connotations. Milk, congratulations to the three innovative products and we hope Besides the three Grand Prize
were given the opportunity to pursue “We launched Goodday’s Happee Grand Prize winners as well as the everyone will continue to support winners, Goodday Milk awarded 10
their dreams in the future, through an PPEs contest to allow children to additional 10 consolation winners. this too.” other young artists with RM500 each.
education fund worth RM10,000, spread positivity to their hospitalised
each. peers in children wards, and remove “We hope Malaysians of all ages The for kids, by kids contest saw For more information on
the fears surrounding PPEs. will continue to stand united as we go the enthusiasm of children aged five Goodday Milk’s initiatives and future
Their designs will be printed on “We are so grateful for all the through this time together. and 12 years come together towards activities, visit the Goodday Milk
10,000 units of PPEs, used by participants who showed their this cause. The contest received an Malaysia Facebook page at
healthcare professionals treating excitement through this meaningful “We aim to bring goodness to overwhelming response from www.facebook.com/
hospitalised COVID-19 patients in campaign and on behalf of Goodday Malaysians in the time to come participants. gooddaymilkmalaysia.
hospitals across Malaysia. through exciting campaigns and

These winning designs not only
demonstrated the artistic talents of

Hada Labo gives back with green CSR campaign Silver jubilee and
HADA LABO’S ‘We Care for Nature’ convocation for
green campaign has successfully Shanmugaraj (in dark shirt) along with volunteers and staff members at Hada Labo’s ‘We Care for Nature’ campaign. UTP
replanted 700 forest tree saplings in
Kuala Selangor Nature Park. The Project, which aims to improve the Hada Labo would like to pursue Labo’s cause. A total of 1,604 students will be
replanting of trees will commence in environment in the Klang Valley by kindness to the earth and contribute “This campaign would not have graduating at Universiti
January and is expected to be planting more trees. to a greener planet. Therefore, we been a success without the constant Teknologi PETRONAS (UTP) 21st
completed by this March. want to do our part to protect and support from the public, so for that, convocation ceremony this year,
“As a skincare brand that aims to preserve the environment so that all we are really thankful,” added Lim. which will be conducted over 10
Through its month-long provide the best for our consumers, of us can have better chances to live For more information about sessions that began on Monday
campaign that was held the second we also believe that the state of the a healthy and fulfilling life,” said Lim, Hada Labo, visit and will end tomorrow The
year in collaboration with Malaysia environment plays a huge role in our who also expressed her gratitude to www.hadalabo.com.my or follow ceremony will be held physically
Nature Society (MNS) and Watsons overall health and more importantly, the public for supporting Hada their Facebook page @MyHadaLabo. in strict adherence to all the
Malaysia, RM1 from the sales the lives of generations to come. standard operating procedures,
proceed of each Hada Labo Supreme prioritising safety and health
Booster Serum sold at Watsons precautions as well as physical
outlet nationwide was channelled distancing.
towards the tree planting fund. We
have successfully raised RM50,000 to For the class of 2021, 1,366 will
support this campaign. be conferred bachelor’s degrees,
161 master’s degrees and 77
MNS Executive Director Mr I.S doctorate’s degrees.
Shanmugaraj said he is glad to have
joined forces with Hada Labo for the The ceremony also saw Tan
second year in giving back to nature. Sri (Dr) Mohd Hassan Marican
Hada Laba’s contribution came just was proclaimed as the fourth
in time as the park has recently lost a Chancellor of UTP. His
huge number of trees due to appointment represents a
ecotourism. homecoming, for it was during
his tenure as President and Chief
“Trees planted will take at least Executive Officer of PETRONAS
four years to grow into full-grown that the idea for UTP was first
trees of about 10 feet tall. So we are mooted, conceptualised and
hopeful to see the river bund area of eventually realised.
Kuala Selangor Nature Park, home to
the many wildlife and different He was the university’s first
species of birds again,” said Chairman of the Board of
Shanmugaraj. Directors and was very much
involved in the establishment
Hada Labo’s CSR fund that and development of the campus.
contributes to the replanting of the He was also the Pro Chancellor of
forest trees especially at the river UTP from 2003 until 2010.
bund area not only prevents
disruption of habitat belonging to Tan Sri Hassan also launched
the increasing number of bird UTP’s 25th Anniversary
species from different parts of the celebration, which fell on Jan 10,
world, but it also helps maintain the the first day of the convocation.
overall ecosystem of freshwater To commemorate the
organisms,” he added. university’s silver jubilee, UTP
organised various events and
Meanwhile, Lim Mei Yuen, who is activities throughout the year for
the General Manager of Rohto- the university’s staff, students
Mentholatum Malaysia said the and community.
brand hopes to have a long-term
working relationship with MNS to
contribute to its Green Canopy

9tthheeSSUuNn OONNWTHEUDRNSESDDAYAY| J|ANUARY 13, 2022

NEWS WITHOUT SBPOERADKERUSP

RUKUN NEGARA: THE PRINCIPLES THE OBJECTIVES

BELIEF LOYALTY TO KING TO achieve greater unity TO maintain a TO create a just society in which
IN GOD AND COUNTRY among Malaysians democratic way of life the wealth of the nation shall be equitably shared

THE SUPREMACY OF THE RULE COURTESY AND TO ensure a liberal approach to her rich TO build a progressive society which shall be
THE CONSTITUTION OF LAW MORALITY and diverse cultural traditions oriented to modern science and technology

Need for better flood rehabilitation
THE waters have not receded.
The ruins and remains are Prime Minister Datuk Seri Ismail
visibly piling up as rubbish. Sabri Yaakob had promised RM1.4
Many victims, especially those billion in cash aid and other forms of
in remote villages, are disheartened relief measures to at least 30,000 affected
that hardly any government households.
officer is accessible to help These include house and
them apply for the meagre vehicle repairs, death benefits,
funds promised. relief on utility bills and
damaged infrastructure.
Many were misdirected to Under the National
various departments in Disaster Management
Putrajaya because their Agency’s (Nadma) Bantuan
district officers and penghulus Wang Ihsan, RM1,000 will be
have washed their hands off, given to every head of
blaming the physical boundaries household.
beyond their jurisdiction. The prime minister also said he
would ensure the Social Welfare
All they want is just one government Department would facilitate and
officer they could reach out to within channel additional resources to the
their zip code. victims.
Although Nadma is slowly reaching
A frustrated victim from Kampung out to clusters of victims in halls and
Jawa summed it up: “If it was an relief centres for the handouts, it was the
election campaign, there would have volunteers who were cleaning the
been loads of representatives reaching drains, clearing the rubbish and helping
out to every single voter at every nook to resettle the victims in the last few
and corner. Candidates will personally weeks. The victims were unable to
wheel the old and disabled people to the reach any social welfare officers for aid.
polling system. Why can’t they reach us Initially, while the deadly waters were There is a need for a better response mechanism when dealing with floods. – ADIB RAWI YAHYA/THESUN
now?” still rising and victims were screaming to
be rescued, the federal and Selangor of flood disasters. Why is there no victims’ re-settlement as soon as
The flood victims are still reeling from governments were disagreeing about Considering the integrated flood risk management possible. People are heartened by acts of
one of the “worst floods in 100 years”. conflicting responsibilities. regularity at system for emergency response? initiative and heroism from their
Ignoring these disputes, it was highly which floods neighbours and volunteers.
They had watched their entire life- commendable that the Armed Forces occur, one would This time around, the hallmark of
savings float out of their doors and settle sprang into action to help evacuate flood imagine that the inefficiency was symbolically mirrored An inspiring story is about an
as spongy, rotten and unusable rubbish victims to relief centres, instead of government by two non-working pumps in the Indonesian who climbed a row of
beyond description. They have lost waiting for any directive from Nadma. would have the Taman Sri Muda floods. rooftops where victims were stranded,
everything. To date, the army officers were seen past experience and circulated just one stove and basic
ferrying children to school as well as and wisdom to We were surprised that engineers in utensils so that people could cook.
So far there has been no practical or distributing groceries to the families. implement a the Department of Irrigation and
specific narrative from the government Services in Johor and Pahang were better system of Drainage did not know there was a It was just one stove but it was a quick
on how the victims are going to be reported to be more sympathetic and management malfunction. innovative response to people who were
resettled. systematic, and had handled the crisis starving.
better. This malfunction had unlocked a
To date thousands are still staying in What is troubling is that the scourge whole range of fears and anxieties in the That small innovative gesture made a
temporary relief centres, and are even of floodwaters is not new to the country. public. great world of difference to a few people.
adapting to the lifestyle. Considering the regularity at which It was just one person and one stove.
floods occur, one would imagine that the We have no idea what else is flawed
Some have made their own makeshift government would have the past and has been left unattended. The 1.6 million staffed civil service
tents and have been complacently experience and wisdom to implement a has all the resources, the training and the
staying there for weeks. better system of management. Right now, every level of government expertise to redeem the people from
Every year, we hear disturbing stories and components within each level are their present suffering.
The people had so much hope with under scrutiny.
the daily announcements on millions of Surely, they could facilitate better
ringgit to be disbursed to victims. Undoubtedly, the victims should be flood risk governance strategies?
the most vital concern at the moment.
Since Dec 17, about 70,000 people Comments: [email protected]
have been displaced while at least 48 Public servants must rise up to this
drowned after the unusually high rainfall catastrophe and address this flood
that caused severe flooding in eight
states.

LETTERS [email protected] Do not abuse your car’s sunroof function

Critical to revive local government foundations THERE seems to be an increase in that fact.
parents allowing their children to stick I have always been an advocate for
THE media statement by urban planning is done now, they are all accountable and given the their heads out of the car’s sunroof
city planning expert Shuhana working in silos – there is no mandate by local government while the vehicle is in motion. This is safe and defensive driving.
Shamsuddin that apart from the communication among these few elections. very dangerous to say the least. We have already seen so much
wrath of Mother Nature, which was quarters – so they end up
one of the reasons behind the endangering their surroundings Having local government One can only imagine the worse wastage of dear life simply because of
recent flash floods in Kuala without knowing it,” Shuhana told elections would force local that could happen if an emergency reckless, drunk and careless drivers.
Lumpur, the design of the city has a daily in an interview. government politicians to compete brake situation were to take place.
failed to protect it from drowning. and formulate a better vision for I do not wish to see anymore just
Segambut MP Hannah Yeoh cities with appropriate designs and Regardless of emergency braking or because some parents thought that it
This statement requires a has also voiced out that low structure of implementation and not or even if the car is stationary, this was okay for their children to have
serious reflection on the part of income earners in Kuala Lumpur accountability that is clearly action must stop. some fun.
Malaysians on the foundations of have been put at risk where a missing in the current local
our local government operations proposed housing development is government administration. Parents need to be responsible for By now we all know of someone
around the country in regard to on land originally marked as their children’s safety. It is not only who has lost their life due to Covid-19.
governing vision, philosophy, retention ponds. Therefore, the Association for required by law, but it is the right thing The pandemic has robbed us of so
administrative competency and Community and Dialogue urges to do. much.
accountability. The statement by the city political parties that are against
planning expert and Segambut MP local government elections to I do not know what is going through The government has allowed
The advocate for urban design does not merely reveal the come to their senses and revive the their minds when they allow their interstate travel and even tourism, but
said it is time the government administrative and ecological local foundation of governance. children to commit such a dangerous this does not mean we can allow
started to seriously take concerted aspects of flooding, it also reveals act. This literally gives a new irresponsible actions such as the
efforts to prevent city centres from the current underlying weakness Unless there is an enlightened perspective to the term throwing sunroof manoeuvre to happen.
future flash floods, rather than of governance of local philosophy of governance besides caution to the wind.
allowing the current haphazard governments where it serves a administrative and structural We have just celebrated the New
development that does not take materialistic ideology, instead of reforms, we would end up a Please keep your children safely Year. All of us hope for a prosperous,
the disaster into account. building cities that are ecologically laughing stock to the world where strapped into their seats. It is already safe and healthy 2022.
sustainable and humanly we can’t even get the basics of risky enough during a normal ride
“What is happening now is that compassionate. governing our cities right. where accidents can happen at any However, it is a huge step backwards
there is no coordination between time. if there are still irresponsible,
developers, architects and the local What is obvious is the principle Ronald Benjamin immature and selfish individuals out
councils when it comes to foundational aspects of Secretary Allowing your children to stick their there, who do not practise good
development in the country. governance in local government head out of the sunroof screams parenting skills.
needs to be revived, made Association for Community danger. Do not even claim that it is only
“If you look at how the town and Dialogue for a short while. Be a responsible parent or guardian.
There is still time to change your ways.
It should not even happen for even
one second. A life lost is a life lost. Do not wait until there is blood on
your hands.
No amount of safety features in the
most sophisticated vehicle can change Yeap Ming Liong
Subang Jaya

S E C U R I T I E S S D N. B H D. SunBIZ THURSDAY
JANUARY 13, 2022
197201001092 (12738-U)
Editorial Tel: 03-7784 6688
A Participating Organisation of Bursa Malaysia Securities Berhad Fax: 03-7785 2624/5

A Trading Participant of Bursa Malaysia Derivatives Berhad Email: [email protected]
Advertising Tel: 03-7784 8888
12/01/2022 Fax: 03-7784 4424

Participation Bought Sold Net Email: [email protected]

% RM m RM m RM m

44.2 Institutions 804.9 884.9 -80.0

30.9 Retail 591.0 587.4 -3.6

24.9 Foreign 512.9 436.5 76.4 1.09
KLCI
100.0 1908.8 1908.8 0.0 1,563.20 8.61 663.11 29.99 543.18 87.19 45.10 48.80
STI HANG SENG SCI NIKKEI TSEC KOSPI S&P/ASX200
Preliminary stats (excluding trade amendments). For final data, please refer to www.bursamalaysia.com 3,254.98 28,765.66 18,375.40 2,972.48
Source: Bursa Malaysia 24,402.17 3,597.43 7,438.90

KL MARKET SUMMARY Hap Seng Consolidated
JANUARY 12, 2022 Bhd (HSCB) group
chairman Thomas Karl
INDICES 11,302.06 CHANGE +14.49 Rapp (centre) receiving
FBMEMAS the award from
FBMKLCI 1,563.20 -1.09 Malaysia Book of
CONSUMER PRODUCTS 582.52 +1.77 Records (MBR) brand
INDUSTRIAL PRODUCTS 205.32 +1.81 and marketing
CONSTRUCTION 154.17 +0.36 manager Aaron Bong.
FINANCIAL SERVICES 16,094.91 -82.22 From left are: Khor, MBR
ENERGY 740.66 +12.31 senior research
TELECOMMUNICATIONS 634.21 -2.46 consultant Edwin Yeoh,
HEALTH CARE 2,294.48 +1.52 Lee, HSCB group COO
TRANSPORTATION 871.62 +7.20 Harald Behrend and
PROPERTY 711.51 +1.46 Hap Seng Land general
PLANTATION 6,739.92 -28.70 manager Allan Teh.
FBMSHA 12,077.34 +40.97
FBMACE 6,582.64 -34.03 Hap Seng to start hospitality
TECHNOLOGY 91.19 +0.54 foray with five new hotels

TURNOVER VALUE
3.366 BIL RM1.908 BIL

5 MOST ACTIVES
JANUARY 12, 2022

STOCK VOL CLSG (sen) +/– (sen) o Group plans to build “This is our first venture in hospitality parcel of vacant leasehold commercial land
SMTRACK 110,603,000 30.0 UNCH three in Kuala Lumpur and development,” Khor told reporters after known as Met 3 in KL Metropolis and has
MQTECH 97,118,200 8.5 two in Sabah receiving an award from the Malaysia Book emerged as the new owner of Wisma KFC
TRIVE 84,722,000 11.5 -3.0 of Records for the highest indoor vertical after purchasing the asset from Singapore-
OCR 75,252,400 17.0 UNCH KUALA LUMPUR: In what will be Hap Seng green wall at Menara Hap Seng 3. based property developer and manager
SAPNRG 68,325,200 5.0 Consolidated Bhd’s first venture into the Royal Group.
-1.5 hospitality sector, the group is planning to The 91.55-metre high indoor green wall,
UNCH develop five hotels in the next few years via which spans vertically across all 20 levels of “Met 3 is the last of a large parcel in the
wholly owned subsidiary Hap Seng Land office space, was designed by architects Mont Kiara area. It is an area where locals and
5 TOP GAINERS Sdn Bhd. Skidmore, Owings and Merrill headquartered expatriates want to live in as it is only a short
JANUARY 12, 2022 in Chicago. The wall houses 10 plant species distance away from the city. It is also near
Chief operating officer David Khor said in more than 27,000 individual pots. affluent neighbourhoods like Damansara
STOCK VOL CLSG (RM) +/– RM three will be developed in Kuala Lumpur – Heights, Bukit Tunku and Bangsar,” he said.
MPI 236,200 47.00 0.44 at Jalan Kia Peng, KL Metropolis near the Besides the hotels, Khor said, the group
PMBTECH-WA 9.70 0.40 suburbs of Segambut where the Malaysia aims to build three residential projects this As for Wisma KFC, Lee said that building
PMBTECH 6,800 12.76 0.38 International Trade and Exhibition Centre year. The company will soft launch a holds a lot of synergy for the group’s existing
LPI 162,900 14.42 0.22 (Mitec) is located, and the newly purchased housing project in Lahad Datu, Sabah, three office buildings, namely Menara Hap
MSC 64,800 3.40 0.21 Wisma KFC in Jalan Sultan Ismail. Two will tomorrow. Two others in Peninsular Seng 1 (former MUI Plaza), Menara Hap
1,272,300 be developed in Sabah. Malaysia – one of which is in Sungai Buloh – Seng 2 and Menara Hap Seng 3 (formerly
are pending authorities’ approval. Hap Seng Star), as they are adjacent to it.
5 TOP LOSERS “The hotels will be managed by two
JANUARY 12, 2022 international hotel companies, namely, Khor said the company is still working Hap Seng intends to build a bridge to
Hyatt, which will operate four of our hotels, out the gross development value. connect Hap Seng 3 to its sister towers.
STOCK VOL CLSG (RM) +/– RM and one by Marriott.
SAM 48,600 22.78 0.42 As for the economy moving forward, Hap “This is an opportunity to link all these
HSI-HA3 28,000 0.84 0.40 Seng group managing director Datuk buildings together and having the hotel
HSI-HA9 12,000 0.60 0.255 Edward Lee Ming Foo said an economic here. It will benefit all the tenants and we
HSI-HMO 30,000 0.315 0.205 downturn represents an opportunity for the will also be able to enhance our food and
DIN040000223 102.20 0.20 company to acquire good assets. beverages outlets, which is a very important
30 in Hap Seng Plaza,” Lee said. – Bernama
The group has proposed to acquire a

EXCHANGE RATES JANUARY 12 2022 HSBC Malaysia appoints Omar Siddiq as CEO

Foreign currency Bank sell Bank buy Bank buy KUALA LUMPUR: HSBC Bank Malaysia the aviation and airport sectors. executive of HSBC Asia-Pacific.
has appointed Omar Siddiq (pix) as its new “We welcome Omar into his “Carrying on its strong heritage
1 US DOLLAR TT/OD TT OD CEO, taking over from Stuart Milne, who will and track record in serving
1 AUSTRALIAN DOLLAR 4.2375 4.1125 4.1025 retire at the end of March 2022 after a role as the CEO for HSBC Bank Malaysian clients, I look forward to
1 BRUNEI DOLLAR 3.0750 2.9510 2.9350 distinguished 40-year career with the HSBC Malaysia to lead us in our next working alongside the
1 CANADIAN DOLLAR 3.1380 3.0470 3.0390 Group. phase of growth. Malaysia management team and also the
1 EURO 3.3690 3.2780 3.2660 presents huge opportunities boards to build on the current
1 NEWZEALAND DOLLAR 4.8250 4.6710 4.6510 Omar was most recently deputy CEO, across some of HSBC’s key momentum to fulfil its even
1 SINGAPORE DOLLAR 2.8890 2.7840 2.7680 Malaysia and CIMB Group Holdings Bhd strategic focus areas – growth in greater potential,” Omar said on
1 STERLING POUND 3.1380 3.0470 3.0390 group wholesale banking CEO. Prior to Asean, sustainable finance and his appointment.
1 SWISS FRANC 5.7880 5.6050 5.5850 joining CIMB, he was the head of group digital innovation. Omar’s Omar, who will report to
100 UAE DIRHAM 4.5770 4.4710 4.4560 wholesale banking at RHB Bank Bhd and extensive experience and in-depth Surendra, will join the boards of
100 BANGLADESHTAKA 116.7300 110.6900 110.4900 was also executive director and group chief knowledge of the local market will HSBC Bank Malaysia Bhd and HSBC
100 CHINESE RENMINBI 5.0210 4.7030 4.5030 financial officer at Malaysia Airlines. He has be invaluable as we strengthen our Amanah Malaysia Bhd as an executive
100 HONGKONG DOLLAR also held roles in the investments division at Malaysian operations to support the director as well as a member of the Asia-
100 INDIAN RUPEE N/A N/A N/A Khazanah Nasional Bhd and was a member Group’s Asian growth ambitions,” Pacific executive committee.
100 INDONESIAN RUPIAH 54.9400 52.2100 52.0100 of the senior management team focusing on commented Surendra Rosha, co-chief
100 JAPANESE YEN 5.8400 5.4800 5.2800
100 NEWTAIWAN DOLLAR 0.0278 0.0228 SYNC PR bags Best Startup PR Agency of 2021 award
100 PAKISTAN RUPEE 0.0307 3.5640 3.5540
100 PHILIPPINE PESO 3.6800 KUALA LUMPUR: Leading startup public agencies in the region. in another award for the company,” said
100 QATAR RIYAL N/A N/A relations agency SYNC PR has been named “While we do not measure ourselves by SYNC founder and CEO Terng Shing Chen.
100 SAUDI RIYAL N/A 2.2800 2.0800 Best Startup PR agency Southeast Asia at the
100THAI BAHT 2.4400 7.9500 7.7500 2021 APAC Insider Business Awards. awards, this is a reflection of the team’s SYNC’s accomplishment can be attributed
8.4300 111.7300 111.5300 strong dedication to bridging the gap to their bold approach to innovation and new
117.6900 108.3700 108.1700 This caps a strong year for the PR and between PR and Southeast Asia’s startup PR methods, which has enabled them to stay
114.1600 11.8000 11.4000 content marketing startup that has and SME industries. Despite the challenges significant in the digital age and make PR
13.3100 continued to expand and grow despite a that we have all faced, the team has more accessible to businesses. The agency has
slow recovery from the pandemic. It was continued to focus on what’s best for our amassed a client base of over 250 companies,
Source: Malayan Banking Berhad/Bernama chosen from a competitive pool of PR clients and partners, which has culminated and built a strong list of recurring clients.

FOLLOW ON TWITTER SCAN 11theSUN ON THURSDAY | JANUARY 13, 2022
ME * SUNBIZ
@thesundaily

MDEC: Malaysia Digital to

MSC Malaysia is nowcome with refreshed
Bill of Guarantees, incentives called Malaysia Digital
KUALA LUMPUR: Malaysia Digital, the Malaysia Digital Economy Week
the successor programme to MSC at Expo 2020 Dubai.
Malaysia, will be equipped with a In addition, Malaysia Digital will
refreshed Bill of Guarantees and non- also feature improved governance o Enhanced programme will help drive growth of country’s digital
location-based incentives. and processes to meet the industries’
The framework will also see an diverse needs at speed to accelerate economy, which currently account for 22.6% of the national GDP
expansion of locations for MSC Malaysia’s digital economy.
Malaysia-promoted activities, said the With greater agility, flexibility, and
CEO of Malaysia Digital Economy relevance, MDEC believes Malaysia DUBAI: Communications and catchment within the identified while ensuring shared prosperity
Corp (MDEC) Mahadhir Aziz. will be able to better deliver the needs Multimedia Minister Tan Sri Annuar corridors,” he said in a speech during through fair and equitable
He said Malaysia Digital will focus of its global and regional investors. Musa has announced that MSC the opening of the Malaysia Digital distribution across income groups,
on three pillars, namely agility, “What started off as the driver of Malaysia will be enhanced and Economy Week at Expo 2020 Dubai. ethnicities and regions.
flexibility, and relevance. MSC Malaysia, creating Malaysia’s renamed as Malaysia Digital. Annuar said MSC Malaysia helped According to the 12th Malaysia
“The new Malaysia Digital own version of Silicon Valley, we have He said MSC Malaysia needs to to drive the growth of the country’s Plan, the digital economy is projected
initiative will offer greater agility to gone through a few iterations, evolve following the rapid shift of digital economy, which currently to contribute 25.5% to Malaysia’s
local and international tech reflecting on the dynamic nature and socio-economic norms in response to account for 22.6% of the national gross GDP by 2025.
companies by providing more options challenge of technology and digital. the constant advancements of digital domestic product (GDP). Additionally, the government – via
and flexibility for companies to “But the challenges in the past two technology. “It was indeed a programme that the Malaysia Digital Economy Corp –
choose from competitive fiscal and/or years will, and have, altered the way “Since its introduction in 1996, was never before seen in the world back will continue to drive the digital
non-fiscal incentives. we conduct business, the way we MSC Malaysia has catalysed and in 1996 – a game-changer. In many economy forward towards making
“It also seeks to expand beyond connect and the way we live our lives,“ transformed Malaysia into a ways, MSC Malaysia was the original Malaysia a globally competitive digital
designated locations into a Mahadhir said and stressed that knowledge-based economy. startup at a time when the term ‘startup’ nation and digital hub of Asean.
nationwide initiative, providing more Malaysia must adapt, and adapt “It was created to foster a had yet to be coined,“ he added. “The pandemic has tested us in
flexibility and opportunity for quickly, in order to stay ahead. conducive ecosystem driven by high- He said the government has many forms and restricted our ability
companies to grow, expand, or “Today, we are embarking on the end infrastructure development and identified the digital economy as one to grow.
reinvest anywhere in Malaysia,“ he next leg of our race towards information and communications of Malaysia’s key economic growth “However, it has also served as a
said in a speech during the opening of excellence. technology (ICT) companies’ areas to achieve sustainable growth great boon for the digital economy,
paving the way for eCommerce and
the Fourth Industrial Revolution
BRIEFS CONSUMER SPENDING technologies to achieve tremendous
LOOKING GOOD FOR 2022 growth,” he noted.
Annuar said Malaysia has also
SINGAPORE: Consumer been riding on the digital wave,
spending in Malaysia will post building an ecosystem filled with
good growth in 2022, with real
household spending projected advanced technologies such as
to grow 5.1% year-on-year, artificial intelligence, the Internet of
according to Fitch Solutions Things and Big Data analytics.
Country Risk and Industry Citing the e-Conomy Southeast
Research yesterday. “This is a Asia (SEA) Report by Google,
notable improvement from the Temasek and Bain & Company, he
0.5% growth estimated for 2021 said Malaysia saw three million new
as impacts from Covid-19 digital consumers since the start of
continued to weigh on domestic the pandemic in 2020, and 81% of all
demand.” The research house internet users are now consumers of
said the recovery in consumer digital services.
spending over 2022 will come as
the wider economy recovers, Early last year, Malaysia launched
with growth mainly driven by the Malaysia Digital Economy
private consumption and fixed Blueprint, or MyDigital, an initiative to
investments. “At RM768.1 billion steer digital transformation and drive
over 2022, real household the growth of the digital economy.
spending will be 1.8% higher
than the RM754.6 billion posted It offers a solid framework that will
help create 500,000 job opportunities
in 2019, pre-Covid-19,” it said. – in the digital economy, assist 5,000
Bernama start-ups to begin operations in the
next five years and attract RM70
GALAXY RACER TO INVEST billion worth of new investment in
RM42M IN MALAYSIA’S Govt has identified the digital economy as one of Malaysia’s key economic growth areas to achieve sustainable growth. – the digital sector. – Bernama
E-SPORTS ECOSYSTEM REUTERSPIX

DUBAI: Dubai-based e-sports HIL Industries receives shareholders’ AmInvest launches global small caps fund
organisation, Galaxy Racer expects
to invest RM42 million (US$10
million) within a five-year period in
Malaysia’s e-sports ecosystem. Chief nod for housing projects in Selangor PETALING JAYA: AmInvest from global small-cap stocks have
marketing officer Allan Phang said unveiled its Global Smaller surpassed large-cap stocks over the
the company aims to position PETALING JAYA: One-stop plastic units town houses in Amverton Companies Fund offering investors long term as they have higher
Malaysia as a regional digital hub solutions provider and property Cove, Carey Island. to tap into the potential capital growth and more opportunities for
with the opening of its Asia-Pacific developer HIL Industries Bhd growth of small companies listed future growth and have
headquarters in the country. He said yesterday received its shareholders’ On the rationale of the exercise, globally. outperformed large caps by over
to spur the development of e-sports approval at its EGM to undertake HIL Industries president and CEO 220% over the last 24 years.
in Malaysia, Galaxy Racer also aims residential development Datuk Milton Ng (pix) said the JVs It elaborated the fund will feed
to boost the involvement of females into the target fund, Janus It also noted smaller companies
are in line with the Henderson Horizon Fund – Global are targets for mergers and
in e-sports, adding that it had joint ventures (JVs) on company’s aim to expand Smaller Companies Fund, which acquisitions. To complete a takeover,
organised the Girl Gamer Festival five parcels of land in its property business in aims to identify good quality and the acquirer normally has to offer a
World Finals in Dubai. – Bernama Sungai Buloh, Klang and the Klang Valley. potentially undervalued small-cap valuation over and above where the
Jugra, Selangor. The JVs is an stocks. share price has been trading. This
With the approval, opportunity for the The fund management firm’s premium has averaged between 21%
GRAND HOOVER’S NAME HIL Industries will company to replenish its CEO Goh Wee Peng believes the and 40% in recent years.
CHANGE ATTRACTS partner Unik Sejati Sdn property development fund benefits from structural drivers
INVESTOR INTEREST Bhd (Unik Sejati), projects with minimal that will continue to support global The firm said the target fund
utilises fundamental and value-
PETALING JAYA: Grand Hoover Pembinaan Kesentosaan costs upfront and are small-cap growth and has partnered biased screening tools by identifying
Bhd has been renamed PTT Sdn Bhd and Amverton expected to increase the with investment manager a narrow investable universe of
Synergy Group and will be traded Carey Golf & Island revenue and profit Henderson Global Investors Ltd around 100 to 200 quality stocks with
on Bursa Malaysia under the new Resort Sdn Bhd (Amverton Carey) contribution from the property which has a team of regional growth potential. The fund’s risks are
name with effect on Jan 14. On in JVs to develop residential development segment. specialists in the US, Europe, managed by diversifying exposures
Wednesday, the counter ended developments with an estimated Based on the management Singapore and Japan. by geography and market sector.
trade 6.73% or seven sen higher gross development value (GDV) of
at RM1.11 per share with 1.39 RM471.1 million on 40.9ha of land feasibility studies, HIL Industries is “Since its inception in August It stated the Global Smaller
million shares traded hands. In in Selangor. expected to generate an estimated 2019 and until Nov 30, 2021, the Companies Fund’s base currency is
the previous week, the group was gross development profit of RM96.1 target fund has delivered returns of US dollars and it is being offered to
appointed as the main contractor The developments will million from the JVs which would 63.5% which is 17.1% higher sophisticated investors in US dollar
for three projects by Widad comprise 154 units of stratified also allow it to participate in the compared to its benchmark,” she and ringgit as well as an ringgit-
Builders Sdn Bhd for a total double-storey terrace houses in developments without an outright said in a statement. hedged classes at an initial offer
contract sum of RM373.83 Sungai Buloh, 78 units double- purchase of the land which will price of US$1 and RM1 per unit
million. storey terrace houses in Klang, 141 otherwise require significant cash “This has translated to returns of respectively during the initial offer
units stratified bungalows and 428 outlay. 23.6% per year by the target fund.” period until Jan 30, 2022.

AmInvest pointed out returns

BRIEFS12 theSUN ON THURSDAY | JANUARY 13, 2022 China’s annual auto sales
SUNBIZ climb for first time since 2017

SINGAPORE AIRLINES ISSUES o New energy vehicles a bright spot amid country’s push to NEVs as part of its efforts to curb air pollution.
7-YEAR US DOLLAR BOND curb air pollution Last month, CAAM said it expects

SYDNEY: Singapore Airlines Ltd BEIJING: China’s auto sales last year grew for The market had started to bounce back by automobile sales to rise 5.4% to 27.5 million this
launched a seven-year US dollar bond the first time since 2017, industry data showed mid-2020, but was pulled down by a global year, and for NEV sales to grow 47% to five
offering yesterday, according to a term yesterday, boosted partly by a jump of 1.5 times shortage of semiconductors, used in million.
sheet seen by Reuters. The issue in sales of new energy vehicles (NEVs). everything from brake sensors to power
consists of one tranche, and price steering to entertainment systems, which led China will cut subsidies on NEVs, such as
guidance to investors has been set at Overall sales in the world’s biggest car automakers around the world to cut or electric cars, by 30% in 2022 and withdraw them
Treasuries plus 210 basis points. market rose 3.8% year-on-year, after monthly suspend production. altogether at the end of the year, deeming that
Singapore Airlines did not immediately sales of 2.79 million vehicles in December the market has matured enough in terms of
respond to a request for comment from brought total sales for 2021 to 26.28 million, data China’s auto sales in December fell 1.6% demand to grow without the aid of government
Reuters. It plans to use the cash raised from the China Association of Automobile from a year-ago period, the eight consecutive help.
to buy new planes, make aircraft Manufacturers (CAAM) showed. monthly drop, CAAM data showed.
related payments and refinance some But while China’s EV market is seeing a very
existing debt. Final pricing for the bond Production and sales are expected to be But the sales of NEVs were a bright spot, strong growth, most foreign automakers have
was due to be set later yesterday. better in 2022 than last year on the prospect that including battery-powered electric vehicles, lagged their Chinese counterparts in designing
issues such as chip shortage and high prices of plug-in petrol-electric hybrids and hydrogen smart cars that appeal. Tesla is the only foreign
CHINA 2021 NEW BANK raw materials ease, CAAM said in a statement. fuel-cell vehicles, showing strong momentum brand among the top ten.
LOANS HIT RECORD HIGH with a growth of 157.5% to 3.52 million units in
After decades of upbeat growth, China’s car 2021. On Tuesday, data from another Chinese auto
BEIJING: New bank lending in China fell market started contracting in 2018 under association showed that US electric vehicle
more than expected in December from pressure from the phasing out of some tax cuts, In December alone, 531,000 NEVs were sold, maker Tesla Inc sold a record 70,847 China-
the previous month, but lending for the a trade war between Washington and Beijing representing a surge of 114% year-on-year. made vehicles in December.
full year of 2021 set a record. Chinese and amid the fallout of the Covid-19 pandemic. China has in recent years heavily promoted
banks extended 1.13 trillion yuan Volkswagen said it missed its goal of selling
(RM743 billion) in new yuan loans in 80,000 to 100,000 units from its ID battery
December, down from 1.27 trillion yuan electric series last year, having sold 70,625
in November, according to data vehicles, but that it would likely double sales this
released by the People’s Bank of China year. – Reuters
yesterday. The tally was lower than 1.27
trillion yuan a year earlier. However, Indonesia waiting
new bank lending hit a record 19.95 for coal supply
trillion yuan for the year, up 1.6% from assurance before
19.63 trillion yuan in 2020. – Reuters lifting export ban

VW’S VEHICLE DELIVERIES The government believes in focusing on ways to spur private sector innovation that creates wealth, JAKARTA: Indonesia’s government is waiting for
SLIP, BMW’S HIT NEW PEAK Japan’s economy minister said, – REUTERSPIX the state utility firm to declare that it has secured
enough coal before it can decide to end an
BERLIN: Volkswagen (VW) vehicle Japan’s govt to focus on innovation, export ban in the world’s biggest shipper of
deliveries fell 8.1% in 2021 to just under not monetary policy, to help economy thermal coal, the energy minister said yesterday.
4.9 million hurt by supply chain
bottlenecks, the carmaker said yesterday. TOKYO: Japanese Prime Minister Fumio choose Kuroda’s successor if his party wins an The suspension was implemented on Jan 1
By contrast, luxury carmaker BMW saw Kishida’s administration will seek to revitalise upper house election later this year. to avoid widespread domestic power outages,
record deliveries of 2.21 million vehicles the economy by nurturing private-sector after state-run Perusahaan Listrik Negara (PLN)
from the BMW brand, a success attributed innovation rather than “interfering” in Hand-picked by Abe to push through bold reported critically low coal stockpiles, amid
in part to its ability to adapt to supply monetary policy, its economy minister said monetary easing, Kuroda’s term as head of the complaints that miners were not fulfilling
chain shortages. BMW rival Daimler came yesterday. Bank of Japan (BOJ) is due to end in April 2023. commitments to supply fuel to the firm.
out in between, with a smaller sales drop
than VW of 5%, but losing its crown to The remark underscores the difference in In another development, the BOJ yesterday The ban has concerned major coal importers,
BMW for the first time in five years as the approach between Kishida’s administration offered its most optimistic view of the like Japan, South Korea and the Philippines,
premium carmaker with most vehicles and that of former premier Shinzo Abe, whose country’s regional economy in more than which fear economic disruption at home.
sold worldwide. – Reuters “Abenomics” stimulus policy relied heavily on eight years.
aggressive monetary easing to defeat “PLN was the one who declared the
Philips shares slide deflation. “Japan‘s economy is picking up as a trend, shortage, while we helped secure the supply.
as shortages although it remains in a severe state due to the Hopefully this afternoon there will be a
and recall hit profit “We believe that instead of interfering in impact of the coronavirus pandemic,” Kuroda statement from PLN,” Energy Minister Arifin
monetary policy, the government should said in a speech to the bank’s regional branch Tasrif told a media briefing yesterday.
AMSTERDAM: Philips shares plunged focus on ways to spur innovation that creates managers.
more than 11% yesterday morning after the wealth,” Economy Minister Daishiro Should the government decide to remove the
Dutch health technology company Yamagiwa told a briefing. Kuroda also said consumer inflation was export ban, it will be done partially, he added.
increased the cost of its massive recall of likely to gradually accelerate on an expected
ventilators and said earnings would take a Kishida, who took office in October last increase in demand. “We will prioritise miners who has fulfilled
big hit from global supply chain shortages. year, has set a policy objective to achieve a 100% of their DMO,” Arifin added, referring to a
“new capitalism” that seeks to distribute more In a quarterly report on regional Japan, the “domestic market obligation” where miners
The supplier of hospital equipment and wealth to households through wage increases, central bank raised its economic assessment must sell 25% of their output to local market at a
personal health devices said it expected while stoking growth by promoting innovation for all nine regions – the first time it has done maximum price of US$70 (RM293) per tonne for
fourth-quarter core profit to drop almost in areas such as green technology. so since October 2013. power plants.
40% to about €650 million (RM3.09 billion),
as it continued to scramble for memory The administration’s stance on monetary “All of the regions said their economies Tasrif said Indonesia is targeting 663 million
chips and other parts. policy is being closely watched by markets were picking up or showing signs of a pick-up tonnes of coal output in 2022, up from 614
since Kishida will likely have the power to as the hit to service consumption from the million tonnes produced last year. Meanwhile,
“It’s a difficult situation,” CEO Frans van pandemic eases somewhat,” the BOJ said in 2021 output came in below the target of 625
Houten told reporters. “We had shortages of the report. – Reuters million tonnes.
several components and saw port
congestion, sometimes up to two or three PLN representatives did not immediately
weeks. All of this meant our manufactured respond to Reuters requests for comment.
goods couldn’t reach customers in time.”
PLN in a statement earlier yesterday said it
Comparable sales fell 10% on a yearly was working to ensure commitments secured
basis to €4.9 billion, Philips said, as during the export ban were delivered on time.
hospitals had to postpone the installation of
equipment due to a lack of parts. Separately, Tasrif said Indonesia’s oil lifting,
or ready-to-sell production, narrowly missed its
Van Houten said the supply chain target and fell for a fifth straight year in 2021,
problems had intensified over the fourth after a failure to tap new sources and as older
quarter, and were not expected to disappear fields matured.
in the first months of 2022. But he
maintained guidance that growth would Indonesia’s oil lifting came in at 660,000
resume over the course of the year. barrels per day (bpd) in 2021, he told a
conference, falling just short of an earlier target
Quarterly sales were around €350 million of 668,000 bpd. Oil lifting fell 6.6% from 707,000
lower than Philips had expected, taking bpd in 2020. Meanwhile, Indonesia aims to
comparable sales over 2021 down 1%. increase oil lifting to 703,000 bpd this year.

The supply chain problems added to Meanwhile, gas lifting came at 982,000 bpd
worries over the recall of ventilators, which equivalent, slightly lower than the 983,000 bpd
has spooked investors and lopped over €18 equivalent last year. – Reuters
billion of the Amsterdam-based company’s
market value over the past nine months.

Philips said it had taken a new provision
of €225 million as it expected to take back
and repair over one million more devices
than previously anticipated. This took total
costs of the recall to €725 million. That
amount, however, does not cover the
possible costs of litigation.

The company will publish full quarterly
and yearly results on Jan 24. – Reuters

229966 OOtthheerrss 330022 JJoobbss 332222 NNoottiicceess ININTTHHEEHHIGIGHHCCOOUURRTTOOFFMMAALLAAYYAAAATT 13theSUN ON THURSDAY | JANUARY 13, 2022
KKAANNGGAARR SPORTS
YYoouurr iinntteellliiggeennccee WE ARE HIRING DDAALLAAMMMMAAHHKKAAMMAAHHTTININGGGGII
iinn uussiinngg 44DD TTiimmiinngg MMAALLAAYYAADDIISSHHAAHHAALLAAMM ININTTHHEESSTTAATTEEOOFFPPEERRLLISISININDDEERRAA Injury-hit England
SSyysstteemm mmaakkee yyoouu Manager – Finance and HR KKAAYYAANNGGAANN,,MMAALLAAYYSSIAIA fighting to turn corner
rreeaalllyy aattttrraaccttiivvee!! DDAALLAAMMNNEEGGEERRIISSEELLAANNGGOORR
IIff yyoouu aarree sseerriioouuss JJoobb DDeessccrriippttiioonn:: DDAARRUULLEEHHSSAANN,,MMAALLAAYYSSIAIA CCOOMMPPAANNIEIESSWWININDDININGG--UUPP A PATCHED-UP England head to an Ashes
PPEENNGGGGUULLUUNNGGAANNSSYYAARRIKIKAATT--SSYYAARRIKIKAATT NNOO.:.:RRAA--2288NNCCCC--11--0011//22002222 finale against Australia under lights in Hobart
ttoo wwiinn,, vviissiitt:: ••TToohhaannddlleeffuulllsseettooffaaccccoouunnttssffoollloowwiinnggaaccccoouunnttiinnggpprriinncciipplleess,,ccoommpplliiaanncceewwiitthh NNOO..BBAA--2288NNCCCC--661166--1122//22002211 tomorrow buoyed by a fighting draw in Sydney,
wwwwww..44ddppooddiiuumm..ccoomm aapppplliiccaabblleessttaannddaarrddssaannddrreegguullaattiioonnss.. DDaalalamm ppeerrkkaarraaAAGGRRI IAASSIAIA RREEFFININEERRYY SSDDNN InIn ththee mmaatteterr ooff SSeecctitoionn 446655 (1(1)) (e(e)) ooff but consumed by injury worries and selection
BBHHDD(N(Noo..SSyyaarrikikaat:t8:84400663344--PP)) ththeeCCoommppaannieiessAAcctt22001166,,ththeepprroovvisisioionnss dilemmas.
001122--667733 22886677 ••PPrreeppaarree&&oovveerrsseeeeffuulllssppeeccttrruummooffaaccccoouunnttiinngg,,mmoonntthh--eennddcclloossiinngg,,yyeeaarr--eenndd ooff ththee CCoommppaannieiess AAcctt 22001166 aanndd ththee
001122--223399 22777755 cclloossiinngg,,aauuddiittsscchheedduulleess,,ttaaxx,,ssttoocckkccoonnttrrooll,,eettcc.. DDaann CCoommppaannieiess(W(Wininddiningg--uupp))RRuuleless11997722 The tourists finally stopped the rot on a
DDaalalammppeerrkkaarraaSSeekkssyyeenn446655(1(1))(e(e)) aanndd gruelling tour last week with their nail-biting
BBaayyInInssppirireeEEnntteerrpprrisisee(C(Coo. .NNoo. .00001515883300771-1-MM)) ••RReessppoonnssiibblleeffoorrmmaannaaggeemmeenntt,,ssttaattuuttoorryyaannddggrroouupprreeppoorrttiinnggrreeqquuiirreemmeennttss.. SSeekkssyyeenn446666(1(1))(a(a))AAkktataSSyyaarrikikaatt22001166 AANNDD last-wicket hold-out at the Sydney Cricket
••RReessppoonnssiibblleeffoorrffiinnddiinnggssoolluuttiioonnssaannddrreessoollvviinnggddaaiillyyooppeerraattiioonnaalliissssuueessiiffaannyy.. InInththeemmaatteterrooffFFeelilaiaSSddnn..BBhhdd..[C[Coommppaannyy Ground to prevent a 5-0 whitewash.
332222 NNoottiicceess ••RReessppoonnssiibblleeffoorrtthheeddeevveellooppmmeennttooffbbuussiinneessssppllaannss,,bbuuddggeettaannddccaasshhffllooww AANNTTAARRAA NNoo..220011110011002233992288(9(95522006644--XX)])]
NNAASSHHGGAARRSSOONNRREESSOOUURRCCEESS(M(M))SSDDNN.B.BHHDD.. But it came at a price with wicketkeeper Jos
332222 NNoottiicceess ffoorreeccaasstt.. (N(NOO..SSYYAARRIKIKAATT::665544770088--HH)) BBEETTWWEEEENN Buttler sent home with a fractured finger and
••PPeerriiooddiiccaalllyyrreevviieewwffiinnaanncciiaallrreeppoorrttssaannddiiddeennttiiffyyooppppoorrttuunniittiieessffoorrccoossttrreedduuccttiioonn.. experienced pair Jonny Bairstow and Ben
DDAALLAAMMMMAAHHKKAAMMAAHHTTININGGGGII ••EEnnssuurreeiinntteerrnnaallccoonnttrroollaannddaaccccoouunnttiinnggccoonnttrroollpprroocceedduurreessaarreeiinnppllaaccee.. ……PPEEMMPPEETTISISYYEENN PPEERRBBAADDAANNAANN UUSSAAHHAAWWAANN NNAASSIOIONNAALL Stokes racing the clock to be fit.
MMAALLAAYYAADDIIKKUUAALLAALLUUMMPPUURR ••AAddmmiinniisstteerrccrreeddiittccoonnttrroollaannddddeebbttccoollleeccttiioonn.. DDAANN BBEERRHHAADD
••RReessppoonnssiibblleeffoorrFFiinnaanncceeaauuddiittaannddttaaxxmmaattteerrss.. AAGGRRI IAASSIAIARREEFFININEERRYYSSDDNNBBHHDD [C[COOMMPPAANNYY NNOO.:.: 119999110011001100774455 England captain Joe Root said not losing
DDAALLAAMMWWILILAAYYAAHH ••OOvveerrsseeeetthheerreeccrruuiittmmeennttaannddsseelleeccttiioonnpprroocceessssttooaatttrraacctt,,rreeccrruuiittaannddrreettaaiinn (N(NOO..SSYYAARRIKIKAATT::220000880011003399228866 (2(22211005577--VV)])] was “hugely important” and he hoped it had
PPEERRSSEEKKUUTTUUAANN,M,MAALLAAYYSSIAIA (8(84400663344--PP))) turned the tide after three heavy and
PPEENNGGGGUULLUUNNGGAANNSSYYAARRIKIKAATTNNOO.. ttaalleennttss.. PPEETTITITIOIONNEERR humiliating defeats in Brisbane, Adelaide and
WWAA--2288NNCCCC--889966--1122//22002211 ••TToommaannaaggeeppaayyrroolllssyysstteemm,,ssttaafffbbeenneeffiitt,,yyeeaarrllyyppeerrffoorrmmaanncceeaannddaapppprraaiissaall.. ……RREESSPPOONNDDEENN AANNDD Melbourne.
DDaalalamm PPeerrkkaarraa SSeecctitoionn 446666 (1(1)) (a(a)) ••DDeevveelloopp,,ddeessiiggnn&&iimmpplleemmeennttooffHHRRppoolliicciieessttoossuuppppoorrtttthheeccoommppaannyybbuussiinneessss IKIKLLAANNPPEETTISISYYEENN FFEELLIAIASSDDNN..BBHHDD..
AAkktataSSyyaarrikikaatt22001166 NNOOTTISISAADDAALLAAHHDDEENNGGAANNININI IDDIBIBEERRI Ibbaahhaawwaa [C[COOMMPPAANNYYNNOO.:.:220011110011002233992288(9(95522006644-- However, it can’t disguise their still appalling
oobbjjeeccttiivveessaannddccoommpplliiaanncceewwiitthhllaawwaannddrreegguullaattoorryy.. ssuuaatutu PPeetitsisyyeenn uunntutukk ppeenngggguululunnggaann XX)])] record in Australia with 12 defeats in 14 Tests,
DDaann ••TToohhaannddlleeddiisscciipplliinnaarryymmaattteerriinncclluuddiinnggssttaafffssccoouunnsseellliinngg,,ggrriieevvaanncceesshhaannddlliinngg,, SSyyaarrikikaatt yyaanngg ddininaammaakkaann ddii aatatass oolelehh with England reduced to celebrating a draw.
DDaalalamm PPeerrkkaarraa TTOOTTITITHHEE SSDDNN BBHHDD MMaahhkkaammaahh TTininggggi i SShhaahh AAlalamm tetelalahh ppaaddaa RREESSPPOONNDDEENNTT
(N(Noo..SSyyaarrikikaatt::991166885500--UU)) ddoommeessttiicciinnqquuiirreess&&tteerrmmiinnaattiioonnpprroocceessss&&ootthheerriinndduussttrriiaallrreellaattiioonnpprroocceedduurreessiinn 0088/1/122/2/2002211 ddikikeemmuukkaakkaann oolelehh NNAASSHH AADDVVEERRTTISISEEMMEENNTTOOFFPPEETTITITIOIONN Former skipper Michael Atherton said in a
ccoommpplliiaanncceesswwiitthhllooccaallLLaabboouurrLLaaww.. GGAARRSSOONN RREESSOOUURRCCEESS (M(M)) SSDDNN.B.BHHDD.. (N(NOO.. NNOOTTICICEE isis hheerreebbyy ggiviveenn ththaatt aa PPeetittiitoionn column for The Times this week that avoiding a
AANNTTAARRAA ••TToohhaannddlleessttaannddaarrddHHRRlleettteerrss,,ddooccuummeennttss,,mmeemmoorraanndduummssaannddootthheerr SSYYAARRIKIKAATT::665544770088--HH).). foforr ththee WWininddiningg--UUpp ooff ththee aabboovveennaammeedd whitewash was “a small mercy”.
RRICICOOHH(M(MAALLAAYYSSIAIA))SSDDNNBBHHDD ccoorrrreessppoonnddeenncceess,,ssuucchhaasswwaarrnniinngglleettteerrss,,aappppooiinnttmmeennttlleettteerrss,,ccoonnffiirrmmaattiioonn DDAANNbbaahhaawwaaPPeetitsisyyeennteterrsseebbuuttddiaiarraahhkkaann CCoommppaannyy bbyy ththee HHigighh CCoouurrtt aatt KKaannggaarr
(N(Noo.S.Syyaarrikikaatt::770033220099--MM)) lleettteerrssaannddrreellaatteeddccoorrrreessppoonnddeenncceeaassrreeqquueesstteedd.. ssuuppaayyaa ddibibicicaarraakkaann ddii hhaaddaappaann wwaass oonn ththee 33rrdd ddaayy ooff JJaannuuaarryy “Sober assessment of the fourth Test would
••OOtthheerraaddmmiinniissttrraattiioonndduuttiieesswwhheerreerreeqquuiirreeddaannddppaarrttoofftthheessccooppee.. MMaahhkkaammaahhyyaannggbbeerrssididaannggddi iSShhaahhAAlalamm 22002222 pprreesseenntetedd toto ththee ssaaidid CCoouurrtt bbyy stress that Australia declared in both innings
....PPEEMMPPEETTISISYYEENN ••AAnnyyootthheerrdduuttiieessaassaassssiiggnneeddbbyytthheessuuppeerriioorr//mmaannaaggeemmeennttffrroommttiimmeettoottiimmee.. ppaaddaappuukkuul l99ppaaggi,i,ppaaddaa0077/0/033/2/2002222. . PPeerrbbaaddaannaannUUssaahhaawwaannNNaassioionnaallBBeerrhhaadd.. and that there were two sessions lost to rain,”
DDAANN DDAANN mmaannaa--mmaannaa ppihihaakk ppeemmiuiutatanngg aatatauu AAnnddththaattththeessaaididPPeetittiitoionnisisddirireeccteteddtotobbee he added. “England were second best by a
TTOOTTITITHHEESSDDNNBBHHDD RReeqquuiirreemmeennttss:: ppeennyyuummbbaannggSSyyaarrikikaattteterrsseebbuuttyyaanngginingginin hheeaarrddbbeefoforreeththeeHHigighhCCoouurrttooffInInssoolvlveennccyy yawning distance.”
(N(Noo.S.Syyaarrikikaatt::991166885500--UU)) mmeennyyookkoonngg aatatauu mmeenneenntatanngg sseessuuaatutu ssitititningg aatt KKaannggaarr oonnTThhuurrssddaayy, ,ththee 2244thth
••CCaannddiiddaatteemmuussttpprroocceessssaattlleeaassttPPrrooffeessssiioonnaalloorrDDeeggrreeeeiinnFFiinnaannccee// ppeerrinintatahh mmeennggikikuutt PPeetitsisyyeenn teterrsseebbuutt ddaayyooffMMaarrcchh22002222aatt99:0:000oo’c’clolocckkininththee Hobart’s Bellerive Oval will play host to its
……RREESSPPOONNDDEENN AAccccoouunnttaannccyyoorreeqquuiivvaalleenntt.. bboolelehh hhaaddirir ddeennggaann tutujujuaann itiutu sseeccaarraa foforreennoooonnaannddaannyyccrreedditiotorroorrccoonntrtribibuutotorryy first Ashes Test after winning the race to replace
NNOOTTISISPPEENNGGIKIKLLAANNAANN ppeerribibaaddii aatatauu mmeelalaluluii ppeegguuaammbbeelalannyyaa ooffththeessaaididccoommppaannyyddeessiriroouusstotossuuppppoorrtt Perth. – AFP
NNOOTTISIS aaddaalalahh ddeennggaann ininii ddibibeerrikikaann ••AAttlleeaasstt55YYeeaarr((ss))mmaannaaggeerriiaall//ssuuppeerrvviissiinnggooffwwoorrkkiinnggeexxppeerriieenncceeiinnaauuddiitt,, ppaaddaammaassaappeerrbbicicaarraaaann..SSaalilninaannPPeetitsisyyeenn oorrooppppoosseeththeemmaakkininggooffaannoorrddeerroonnththee
bbaahhaawwaa ssuuaatutu ppeetitsisyyeenn uunntutukk ffiinnaanncciiaallaaccccoouunnttiinnggaannddHHRR.. teterrsseebbuutt aakkaann ddibibeekkaalklkaann oolelehh ppihihaakk ssaaididPPeetittiitoionnmmaayyaappppeeaarraattththeetitmimeeooff 332222 NNoottiicceess 332222 NNoottiicceess
mmeenngggguululunnggkkaann ssyyaarrikikaatt yyaanngg yyaanngg bbeerrtatannddaatatannggaann ddii bbaawwaahh ininii hheeaarrininggbbyyhhimimsseelflfoorrhhisisCCoouunnsseellfoforrththaatt
ddininaammaakkaann ddiaiatatass oolelehh MMaahhkkaammaahh ••FFaammiilliiaarrwwiitthhAAccccppaacc,,EERRPPAAccccoouunnttiinngg&&HHRRssooffttwwaarreewwoouullddbbeeaannaaddddeedd kkeeppaaddaa mmaannaa--mmaannaa ppeemmiuiutatanngg aatatauu ppuurrppoosseeaannddaaccooppyyooffththeePPeetittiitoionnwwilillbbee NNOOTTIICCEE IINNTTHHEEMMAATTTTEERROOFF
TTininggggii tetelalahh ppaaddaa 66.1.122.2.2002211 aaddvvaannttaaggee.. ppeennyyuummbbaanngg SSyyaarrikikaatt teterrsseebbuutt yyaanngg fufurrnnisishheeddtotoaannyyCCrreedditiotorroorrccoonntrtribibuutotorryy TTHHEECCOOMMPPAANNIIEESSAACCTT,,22001166
ddipipeerrsseerraahhkkaann oolelehh PPeemmppeetitsisyyeenn mmeemminintatannyyaa ddeennggaann mmeemmbbuuaatt bbaayyaarraann ooffththeessaaididCCoommppaannyyrreeqquuiririninggththeessaammee TTAAKKEE NNOOTTIICCEE tthhaatt
yyaannggddininaammaakkaannddiaiatatassddaannPPeetitsisyyeenn ••CCoommppuutteerrlliitteerraatteeaannddkknnoowwlleeddggeeaabblleeooffMMssEExxcceell,,WWoorrdd&&PPoowweerrPPooiinntt.. yyaannggdditietetatappkkaann.. bbyy ththee uunnddeerrssigignneedd oonn ppaayymmeenntt ooff ththee MMaahhWWeennggKKwwaaii AANNDD
teterrsseebbuutt ddiaiarraahhkkaann uunntutukk ddidideennggaarr ••GGooooddccoommmmaannddooffwwrriittteennaannddssppookkeenniinnEEnngglliisshh..PPrrooffiicciieennccyyiinnBBaahhaassaaMMaallaayyssiiaa AAlalammaatt PPeemmppeetitsisyyeenn iaialalahh ddii NNoo.2.233--11,, rreegguulalateteddcchhaarrggeefoforrththeessaammee.. &&AAssssoocciiaatteess IINNTTHHEEMMAATTTTEERROOFF
oolelehhMMaahhkkaammaahhTTininggggiiyyaannggbbeerrssididaanngg JJaalalann DDeelilmimaa 1188/K/KSS99,,BBaannddaarr PPaarrkklalannddss,, TThheePPeetittiitoionneerr’s’saaddddrreessssisisaatt1100ththFFlolooor,r, iiss aatttteemmppttiinngg CCOONNSSTTUURRFFEEQQUUIIPPMMEENNTT((MM))
ddiiKKuuaalalaLLuummppuurrppaaddaa55.4.4.2.2002222ppaaddaa &&MMaannddaarriinnwwiilllbbeeaannaaddddeeddaaddvvaannttaaggee.. 4411220000, ,KKlalanngg, ,SSeelalannggoorrDDaarruul lEEhhssaann. . BBlolocckk 11BB,, PPlalazzaa SSeenntrtraal,l, JJaalalann SStetesseenn ttoo llooccaattee tthhee SSDDNN..BBHHDD..[[119999660011003366117722
ppuukkuull 99.0.000 ppaaggii ddaann mmaannaa--mmaannaa PPeegguuaammccaarraa PPeemmppeetitsisyyeenn iaialalahh TTeetutuaann SSeenntrtraall55,,KKuuaalalaLLuummppuurrSSeenntrtraal,l,5500447700 bbiioollooggiiccaall ppaarreennttss
ppeemmiuiutatannggaatatauuppeennyyuummbbaannggssyyaarrikikaatt Senior Executive – Digital Marketing MMoohhaannKKuummaarryyaannggbbeerraalalammaattddi iUUnnitit66DD KKuuaalalaLLuummppuur.r. ((440088552255--VV))]]
teterrsseebbuutt yyaanngg iningginin mmeennyyookkoonngg (3(3rrddFFlolooorr),),JJaalalannUUSSJJ1100/1/1JJ,,UUEEPPSSuubbaanngg TThheePPeetittiitoionneerr’s’sSSoolilcicitiotorrisisMMeessssrrss..AAmmirir ooff aa cchhiilldd ((IInnMMeemmbbeerrss’’
aatatauu mmeemmbbaanntatahh ppeerrinintatahh ddii JJoobb DDeessccrriippttiioonn:: JJaayyaa, ,4477662200, ,SSeelalannggoorrDDaarruul lEEhhssaann. . RRuuhhaannaa&&KKhhaairiruuddddinin,,wwhhoosseeaaddddrreessssisis ((mmaallee)) wwhhoo wwaass VVoolulunnttaarryyWWininddininggUUpp))
ddaalalamm PPeetitsisyyeenn itiutu bboolelehhlalahh hhaaddirir aatt 55--11--11, , JJaalalann MMeeddaann PPBB 44AA, , SSeekkssyyeenn bboorrnn oonn 1100..99..22000066 NNOOTTIICCEEOOFFFFIINNAALLMMEEEETTIINNGG
ppaaddaa wwaakktutu ppeerrbbicicaarraaaann ddeennggaann ••DDeessiiggnnaannddddeevveellooppoonnlliinneemmaarrkkeettiinnggssttrraatteeggiieess,,ddiiggiittaallrrooaaddmmaapp,,ccrreeaattiivvee --tatannddaatatannggaann-- 99,,4433665500 BBaannddaarr BBaarruu BBaannggi,i,SSeelalannggoorr aatt KKeelliinniikk GGeennggaa NNOOTTICICEE ISIS HHEERREEBBYY GGIVIVEENN TTHHAATT
sseennddiririninyyaa aatatauu mmeelalaluluii ppeegguuaammnnyyaa ccaammppaaiiggnnsstthhaattaalliiggnneeddwwiitthhtthheebbuussiinneessssggooaallssaannddddiirreeccttiioonnss.. …………………………………………………………………… DDaarruullEEhhssaann.. PPeettaalliinngg JJaayyaa.. ppuurrssuuaanntt ttoo SSeeccttioionn 445599 ooff tthhee
bbaaggii mmaakkssuudd itiutu ddaann sseessaalilninaann PPeegguuaammccaarraabbaaggi ippihihaakkPPeemmppeetitsisyyeenn AAnnyyoonnee wwhhoo hhaass CCoommppaannieiess AAcctt,, 22001166,, tthhee FFininaall
PPeetitsisyyeenn aakkaann ddibibeekkaalklkaann kkeeppaaddaa ••PPrroovviiddeeccrreeaattiivveeiiddeeaassffoorrccoonntteennttmmaarrkkeettiinngg.. ………………………………………………………… iinnffoorrmmaattiioonn oonn tthhee MMeeeettiningg ooff MMeemmbbeerrss ooff tthhee
mmaannaa--mmaannaa ppeemmiuiutatanngg aatatauuppuunn ••PPllaannaannddmmaannaaggeeoouurrssoocciiaallmmeeddiiaappllaattffoorrmmss.. TTeetutuaannMMoohhaannKKuummaarr MMeessssrrss..AAmmirirRRuuhhaannaa&& iiddeennttiittyy ooff tthhee CCoommppaannyywwilill bbee hheeldldaatt UUnnititNNoo..
ppeennyyuummbbaanngg ssyyaarrikikaatt teterrsseebbuutt ••AAbblleettooccrreeaatteeccoonntteenntt&&pprroodduucceeggrraapphhiiccssffoorrssoocciiaallmmeeddiiaappoossttiinnggss.. PPEERRININGGAATTAANN:-:- cchhiilldd’’ss bbiioollooggiiccaall 220033,,22nnddFFlolooor,r,BBlolocckkCC,,DDaammaannssaarraa
yyaanngg bbeerrkkeehheennddaakkkkaann yyaanngg ssaammaa ••PPrreeppaarreeccooppyywwrriittiinnggffoorrmmaarrkkeettiinnggccaammppaaiiggnn.. SSeessiaiappaa yyaanngg iningginin hhaaddirir ppaaddaa KKhhaairiruuddddininSSoolilcicitiotorrfoforrththeePPeetittiitoionneerr InInttaann,,NNoo11,,JJaalalann SSSS2200//2277,,4477440000
oolelehh bbeerrtatannddaatatannggaann ddii bbaawwaahh aatatass ppeerrbbicicaarraaaann PPeetitsisyyeenn teterrsseebbuutt hheennddaakklalahh NNOOTTEE:: ppaarreennttss iiss PPeettaalilningg JJaayyaa,, SSeelalannggoorr oonn 1188tthh
ppeemmbbaayyaarraann ccaajj yyaanngg dditietetatappkkaann RReeqquuiirreemmeennttss:: mmeennyyaammppaaikikaann,,aatatauummeenngghhaanntatarrddeennggaann AAnnyyppeerrssoonnwwhhooinintetennddsstotoaappppeeaarroonnththee rreeqquueesstteedd ttoo FFeebbrruuaarryy,,22002222aatt1111.0.000aa.m.m..ffoorrtthhee
uunntutukkyyaannggssaammaa.. ppooss,, kkeeppaaddaa PPeegguuaammccaarraa PPeemmppeetitsisyyeenn hheeaarrininggooffththeessaaididPPeetittiitoionnmmuussttsseerrvvee ccoonnttaacctt MMss ffoollolowwininggppuurrppoosseess:-:-
AAlalammaatt PPeemmppeetitsisyyeenn iaialalahh ddii LLoocckk ••DDiipplloommaa//DDeeggrreeeeiinnMMaarrkkeettiinngg,,DDiiggiittaallMMaarrkkeettiinnggoorreeqquuiivvaalleenntt.. yyaanngg ddininaammaakkaann ddiaiatatass ssuuaatutu nnootitsis oonnoorrsseennddbbyyppoosstttotoththeeaabboovveennaammeedd JJaassmmiinnee aatt 11..TToo rreecceeivivee aanndd ccoonnssidideerr tthhee
++SStotorree,,LLeevveell11,,NNoo.5.5,,JJaalalannPPeennyyaairir ••EExxcceellleennttuunnddeerrssttaannddiinnggooffddiiggiittaallmmaarrkkeettiinnggccoonncceeppttssaannddbbeessttpprraaccttiicceess.. bbeerrtutulilsis tetenntatanngg nniaiatntnyyaa sseebbeeggitiutu NNootitsis MMeessssrrss.. AAmmirir RRuuhhaannaa && KKhhaairiruuddddinin,, 0033--7788887722770022 bbyy LLiqiquuididaattoorr’s’s SSttaatteemmeenntt ooff
UU11//4444,, OOfff JJaalalann GGlelennmmaarrieie,, 4400115500 ••RReeqquuiirreeddSSkkiilll((ss))::GGoooogglleeAAddwwoorrddss,,GGoooogglleeAAnnaallyyttiiccss,,SSEEOO//SSEEMM,,SSoocciiaallmmeeddiiaa teterrsseebbuutt mmeesstitlialahh mmeennyyaatatakkaann nnaammaa nnootitcicee inin wwrritiitningg ooff hhisis inintetenntitoionn ssoo toto 2277..11..22002222.. AAccccoouunnttss sshhoowwiningg tthhee mmaannnneerr
SShhaahhAAlalamm,,SSeelalannggoorr ddaannaalalammaattppihihaakkbbeerrkkeennaaaann,,aatatauujijkikaaiaia ddoo.. TThhee nnootitcicee mmuusstt sstatatete ththee nnaammee inin wwhhicichh tthhee wwininddiningg--uupp hhaass
PPeegguuaammccaarraa PPeemmppeetitsisyyeenn iaialalahh mmaarrkkeettiinnggaannddooppttiimmiizzaattiioonn.. sseebbuuaahhfifrirmmaa,,nnaammaaddaannaalalammaattfifrimrmaa,,ddaann aannddaaddddrreessssooffththeeppeerrssoonn,,oor,r,ififaafifrirmm,, SSAAUUJJAANNAAGGLLOOBBAALLCCUUIISSIINNEE bbeeeennccoonndduucctteeddaannddtthheepprrooppeerrttyy
LLaacchhaammaann LLaalclchhaanndd && AAssssoocciaiatetess mmeesstitlialahh dditiatannddaatatannggaannii oolelehh ppihihaakk aatatauu ththeennaammeeaannddaaddddrreessssooffththeefifrirmm aanndd SSDDNNBBHHDD ddisisppoosseedd ooff aanndd ooff hheeaarriningg aannyy
yyaannggbbeerraalalammaattddii55--11,,JJaalalann2266//7700AA,, OOffffiiccee bbaasseedd iinn PPeettaalliinngg JJaayyaa ((55 ddaayyss aa wweeeekk)) fifrirmmaa bbeerrkkeennaaaann aatatauu ppeegguuaammccaarraannyyaa,, mmuusstt bbee ssigignneedd bbyy ththee ppeerrssoonn oorr fifrirmm eexxpplalannaattioionntthhaattmmaayybbeeggiviveennbbyy
DDeessaa SSrrii HHaarrtatammaass,, 5500448800 KKuuaalala jijkikaa aaddaa NNootitsis hheennddaakklalahh ddisisaammppaaikikaann,, oorr hhisis oorr ththeeirir SSoolilcicitiotorrss (i(fif aannyy)) aanndd 220011330011004422887711 tthheeLLiqiquuididaattoor.r.
LLuummppuur.r. SSeenndd iinn yyoouurr CCVV wwiitthh yyoouurr pphhoottoo vviiaa eemmaaiill ttoo :: aatatauujijkikaaddihihaanntatarrddeennggaannppooss,,hheennddaakklalahh mmuusstt bbee sseerrvveedd,,oorr ifif ppoosstetedd,,mmuusstt bbee ((11007722669933--DD)) 22..TToo ddeetteerrmmininee bbyy oorrddininaarryy
BBeerrtatarrikikhh1133hhbbJJaannuuaarrii22002222 tthheessuunn..hhrrll@@ggmmaaiill..ccoomm ddihihaanntatarrddaalalammjajannggkkaammaassaa mmeennccuukkuuppi,i, sseennttbbyyppoossttininssuuffifcicieienntttitmimeetotorreeaacchh ((IINNVVOOLLUUNNTTAARRYY rreessooluluttioionntthheemmaannnneerraannddppeerrioiodd
..….…..….……………t.tt.…t……………………… ssuuppaayyaa ssaammppaaii kkeeppaaddaa ppihihaakk yyaanngg ththee aabboovveennaammeedd nnoott lalateterr ththaatt 1122:0:000 LLIIQQUUIIDDAATTIIOONN)) inin wwhhicichh tthhee bbooookkss,, aaccccoouunnttss
LLaacchhaammaannLLaalclchhaanndd&&AAssssoocciaiatetess ddininaammaakkaann ddiaiatatass sseebbeelulumm ppuukkuull 1122 oo’c’clolocckk inin ththee nnoooonn ooff ththee 2233rrdd ddaayy ooff aanndd ddooccuummeennttss ooff tthhee CCoommppaannyy
PPeegguuaammccaarraabbaaggiippihihaakkPPeemmppeetitsisyyeenn tetennggaahhaarri ippaaddaa0066/0/033/2/2002222. . MMaarrcchh22002222.. NNOOTTIICCEE iiss hheerreebbyy ggiivveenn tthhaatt,, aanndd ooff tthhee LLiqiquuididaattoorr sshhaalll bbee
NNOOTTAA:: TThhisis AAddvveerrtitsiseemmeenntt ooff PPeetittiitoionn isis fiflieledd ppuurrssuuaanntt ttoo SSeeccttiioonn 445599((11)) ddeessttrrooyyeedd..
SSeessiaiappaa yyaanngg iningginin hhaaddirir ppaaddaa hhaarrii bbyy MMeessssrrss..AAmmirir RRuuhhaannaa && KKhhaairiruuddddinin,, ((bb)) ooff tthhee CCoommppaanniieess AAcctt,, CChhuuaaYYookkeeBBeeee
ppeennddeennggaarraann PPeetitsisyyeenn hheennddaakklalahh AAddvvooccaatete && SSoolilcicitiotorr oonn bbeehhaalflf ooff 22001166,,aa ffiinnaall mmeeeettiinngg ooff tthhee LLiqiquuididaattoorr
mmeennyyaammppaaikikaann aatatauuppuunn mmeenngghhaanntatarr PPeetittiitoionneerrooffNNoo..55--11--11,,JJaalalannMMeeddaannPPBB mmeemmbbeerr ooff SSaauujjaannaa GGlloobbaall PPeettaalilninggJJaayyaa
ddeennggaann ppooss kkee LLaacchhaammaann LLaalclchhaanndd 44AA,,SSeekkssyyeenn99,,4433665500BBaannddaarrBBaarruuBBaannggi,i, CCuussiinneeSSddnnBBhhdd((““CCoommppaannyy””)) DDaattee::1133tthhJJaannuuaarryy,,22002222
&&AAssssoocciaiatetessyyaannggddininaammaakkaannddiiaatatass SSeelalannggoorrDDaarruullEEhhssaann.. wwiilll bbee hheellddaatt NNoo 11,,TTiinnggkkaatt
nnootitsis bbeerrtutulilsis nniaiatntnyyaa uunntutukk bbeerrbbuuaatt (R(Reef.f.NNoo.:.:WWSS/P/PUUNNBB/F/FSSBB/5/54499(L(L))) 11,, PPeerrssiiaarraann GGoollff,, SSaauujjaannaa IINNTTHHEEMMAATTTTEERROOFFTTHHEE
bbeeggitiutu.. NNootitsis teterrsseebbuutt mmeesstitlialahh RReessoorrtt,, SSeekkssyyeenn UU22,, 4400115500 CCOOMMPPAANNIIEESSAACCTT,,22001166
mmeennyyaatatakkaann nnaammaa ddaann aalalammaatt PPEERRISISYYTTIHIHAARRAANNJJUUAALLAANN SShhaahh AAllaamm,, SSeellaannggoorr DDaarruull AANNDDIINNTTHHEEMMAATTTTEERROOFF
oorraanngg teterrsseebbuutt ddaann jijkikaa ssuuaatutu fifrirmmaa,, DDAALLAAMMMMAAHHKKAAMMAAHHTTININGGGGIIMMAALLAAYYAADDIIPPUULLAAUUPPININAANNGG EEhhssaann oonn MMoonnddaayy,, 1144
nnaammaa ddaann aalalammaatt fifrirmmaa teterrsseebbuutt PPEERRMMOOHHOONNAANNUUNNTTUUKKPPEERRLLAAKKSSAANNAAAANNNNOO::PPAA--3388--226699--1111//22002211 FFeebbrruuaarryy 22002222 aatt 1100..3300 aamm TTLLSSBBUUIILLDDIINNGG
ddaannmmeesstitidditiatannddaatatannggaanniioolelehhoorraanngg ttoo rreecceeiivvee aann aaccccoouunntt ffrroomm MMAATTEERRIIAALLSSSSDDNNBBHHDD
teterrsseebbuutt aatatauuppuunn fifrirmmaa aatatauuppuunn DDaalalammppeerkrkaararammeennggeennaai iSSeekkssyyeenn225566ddaann225577KKaannuunnTTaannaahhNNeeggaarara, ,11996655 tthhee lliiqquuiiddaattoorrss sshhoowwiinngg tthhee
aatatauu ppeegguuaammccaarraannyyaa (J(Jikikaa aaddaa)) ddaann DDaann mmaannnneerriinnwwhhiicchhtthheewwiinnddiinngg CCoommppaannyyNNoo..
mmeesstitlialahh ddisiseerraahhkkaann,, aatatauuppuunn jijkikaa DDaalalammppeerkrkaararammeennggeennaai iGGaaddaaiaiannPPeersrseerarahhaannNNoo: :00779999SSCC22001144003344228800( (bbeertratarirkikhh: :2244/0/099/2/2001144) ) uupp hhaass bbeeeenn ccoonndduucctteedd 220000330011001199991122
ddipipoosskkaann ddaalalamm mmaassaa mmuunnaassaabbaahh kkeeaatatasssseemmuuaabbaahhaaggiaianntatannaahhyyaannggddipipeeggaannggddi ibbaawwaahhGGRRNN5533008866, ,33442288, ,MMuukkimim1111, ,DDaaeerraahh aanndd ttoo hheeaarr eexxppllaannaattiioonnss
ssuuppaayyaa ssaammppaaii yyaanngg ddininaammaakkaann SSeebbeerraannggPPeerraaiiUUtatarraa,,PPuulalauuPPininaanngg tthhaatt mmaayy bbee ggiivveenn bbyy tthhee ((662222333322--KK))
ddiaiatatass titdidaakk lelewwaatt ddaarrii ppuukkuull 1122.0.000 DDaann lliiqquuiiddaattoorrss.. ((IINNMMEEMMBBEERRSS’’
tetennggaahhaarriippaaddaa44.4.4.2.2002222.. DDaalalammppeerkrkaararammeennggeennaai iAAtuturarann8833KKaaeeddaahh--KKaaeeddaahhMMaahhkkaammaahh, ,22001122 AA mmeemmbbeerr eennttiittlleedd ttoo aattteenndd VVOOLLUUNNTTAARRYYWWIINNDDIINNGGUUPP))
(R(Ruujj::LLLL//RRSS//44443377//22001188)) aanndd vvoottee aatt tthhee aabboovvee
AANNTTAARRAA mmeeeettiinnggiisseennttiittlleeddttooaappppooiinntt NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN
aa pprrooxxyy ttoo aattteenndd aanndd vvoottee tthhaatt ppuurrssuuaanntt ttoo SSeeccttiioonn
PPuubblilcicBBaannkkBBeerrhhaadd(N(Noo..SSyyaarrikikaat:t:66446633--HH)) .....PPLLAAININTTIFIF iinnsstteeaaddooffhhiimm..AApprrooxxyynneeeedd 445599 ooff tthhee CCoommppaanniieess AAcctt,,
nnoott bbee aa mmeemmbbeerr ooff tthhee 22001166tthhaattaaFFiinnaallmmeeeettiinnggooff
DDAANN CCoommppaannyy.. tthhee MMeemmbbeerrss ooff tthhee aabboovvee
BBYYOORRDDEERROOFFTTHHEE ccoommppaannyy wwiilll bbee hheelldd aatt
LLoowwKKuueennggCChheeww(N(Noo..KKaaddPPeennggeennaalalann::556600990088007755335599)) ...D.DEEFFEENNDDAANN LLIIQQUUIIDDAATTOORRSS NNoo.. 22--2299,, PPVV 112288,, JJaallaann
LLoowwEEaannLLiningg(N(Noo..KKaaddPPeennggeennaalalann::992200662277007755118800)) KKhhooiiHHooaayyLLiinngg&& GGeennttiinngg KKeellaanngg,, 5533330000
LLLLoooowwwwEKKEauaunenenTnTghghoCoCnhnhgegew(wN(Nsosoe.e.bKbKaaaagdgdaaPiPiePePnenegmgmeeenengagaalaalnanngng::A9A9m3m30a09an9n2a2a5h5h00k7k7e5e5p9p9a5a5d4d4a)a)LLoowwEEaannJJiuiunn KKaarreennYYoonnggSSyyeewwCCiiinn KKuuaallaa LLuummppuurr,, WWiillaayyaahh
(N(Noo..KKaadd..PPeennggeennaalalann::556600990088007755335599)) SShhaahhAAllaamm,, PPeerrsseekkuuttuuaann oonn tthhee 1122tthh
SSeellaannggoorrDDaarruullEEhhssaann FFeebbrruuaarryy 22002222,, aatt 1111..0000 aamm
MMeennuururuttPPeerirnintatahhMMaahhkkaammaahhTTininggggi iMMaalalayyaaddi iPPUULLAAUUPPININAANNGGmmeennggeennaai iPPeerirnintatahhJJuuaalalannddaann DDaatteedd::1133JJaannuuaarryy22002222 ffoorrtthheeffoollloowwiinnggppuurrppoosseess::
PPeerirnintatahhbbeertratarirkikhh33SSeepptetemmbbeerr22002200ddaann2200DDisiseemmbbeerr22002211, ,aaddaalalahhddeennggaanninini iddiisisyytithihaarkrkaann 11..TToo rreecceeiivvee aanndd ccoonnssiiddeerr
bbaahhaawwaaTTimimbbaalalannPPeennddaaftfatar/rP/PeennoololonnggKKaannaannPPeennddaaftfatarrPPuussaattOOppeerarassi iee--LLeelolonnggddi iKKuuaanntatann
tthhee LLiiqquuiiddaattoorr’s’s
AAKKAANLNLEMEMLLEOEONNNNJGJGUUAAAAWLWLASASMEMECCAARRAA SSttaatteemmeenntt ooff AAccccoouunnttss
PPaaddaaHHaarriiIsIsnninin,,3311JJaannuuaarrii22002222,,PPaaddaaJJaamm1111:0:000ppaaggi,i, aanndd aannyy eexxppllaannaattiioonnss
SSEECCAARRAAEELLEEKKTTRROONNIKIKDDllLLAAMMAANNWWEEBBee--LLEELLOONNGG,,PPUUSSAATTOOPPEERRAASSIIee--LLEELLOONNGG,, tthheerreeffrroomm..
KKOOMMPPLLEEKKSSMMAAHHKKAAMMAAHHKKUUAANNTTAANN,,PPAAHHAANNGGDDAARRUULLMMAAKKMMUURR 22..TTooddeetteerrmmiinneetthheeddiissppoossaall
ooff tthhee bbooookkss,, aaccccoouunnttss
NNOOTTAA::BBaakkaallppeemmbbeeliliaaddaalalahhddininaassihihaatktkaannaaggaarrmmeemmbbuuaattccaarriaiannHHaakkmmiliilkiksseeccaarraarraassmmiiddii aanndd ddooccuummeennttss ooff tthhee
tPetPeepejpaajaabtbtahahtataTrTartaatnannanaahahhhddtaetanernrsmsemebebemumutetserseriekibkbsesaelaulsumsememmjujuuuaaalaaltaatnannlngelgeglogluonunngnggagaanannnd,d,bibjieajeablbalaaannnnkakaanannns.s.eerrtatammeennggeennaallppaasstitiddeennggaann CCoommppaannyy..

SSilialalalayyaaririhhttptpss:/:/e/elelelolonngg.k.keehhaakkimimaann.g.goovv.m.myy/b/bididddeerwrweebb SSiiggnneedd
……………………………………
BBUUTTIRIR--BBUUTTIRIRHHAAKKMMILILIKIK:: HHOORRYYUUEENNFFOOOONNGG

Advertise with us & connect to our urban readers. NNoo..HHaakkmmiliilkik :: GGRRNN5533008866 LLIIQQUUIIDDAATTOORR
MPNNPMeoueog.ukg.aLkiaLnominomtgtg/a/DaDnanaeerraahh//NNeeggeerrii :::::: 33442288 DDaatteeddtthhiiss::
NNoo..PPeetatakk//NNoo..TTininggkkaat/t/NNoo.. :: 1111//SSeebbeerarannggPPeerarai iUUtatarara//PPuulalauuPPininaanngg 1133tthhJJaannuuaarryy22002222
BBaanngguunnaann HHaakkmmiliilkikKKeekkaal l
KKeeluluaassaannTTaannaahh
PPeemmiliilkikBBeerrddaaftfatarr ::
KKLLAANNGGVVAALLLLEEYY :: 888822.6.644kkaakkiippeersrseeggii
PPEENNAANNGG||KKEEDDAAHH :: 8822.0.000mmeeteterrppeersrseeggii
PPEERRAAKK||PPEERRLLIISS :: LLoowwKKuueennggCChheeww,,LLoowwEEaannLLiningg,,LLoowwEEaannTThhoonngg,,LLooww
KKuueennggCChheewwsseebbaaggaai iPPeemmeeggaannggAAmmaannaahhkkeeppaaddaaLLooww
PPAAHHAANNGG|| EEaannJJiuiunn
KKEELLAANNTTAANN
TTEERREENNGGGGAANNUU SSyyaarraattNNyyaatata :: (F(FIRIRSSTT GGRRAADDEE)) TThhee LLaanndd ccoommpprirsiseedd inin ththisis tittiltele:: (a(a))
MMAALLAACCCCAA MMSS..SShhoobbaa JJOOHHOORRBBAAHHRRUU SBBSeeeekbkbaaaatnatnaanannnK/Ke/LepLapeaienninnt-it-LniLangaiganiannn sshhaall l nnoott bbee aaffefecctetedd bbyy aannyy pprorovvisisioionn ooff ththee NNaatitoionnaal l
MMRR..RRaajjaahh TTEELL::0033--7777884488888888 MMSS..AAnnnneeLLiimm KKaawwaassaannRRizizaabb LLaanndd CCooddee lilmimitiitningg ththee ccoommppeennssaatitoionn ppaayyaabblele oonn ththee
TTEELL::001122--66228822884444 FFAAXX::0033--7777884444442244 TTEELL::001133--77770066669999 KKaavveeaatt eexxeercrcisiseebbyyththeeSStatateteAAuuththoorirtiytyooffaarirgighhttooffaacccceessssoorr
FFAAXX::0066--77664422005511 FFAAXX::0077--33555555554499 uusseeccoonnfeferrereddbbyyCChhaappteterr33ooffPPaartrtTThhrereeeooffththeeCCooddeeoorr
oonnththeeccrereaatitoionnooffaaLLaannddAAddmmininisistrtaratotor’rs’srirgighhttooffwwaayy; ;
:::: TTiaiaddaa

::
::

LLOOKKAASSIIDDAANNPPEERRIHIHAALLHHAARRTTAANNAAHH::
HHaartratannaahh tetersrseebbuutt aaddaalalahh sseebbuuaahh rruummaahh teterreess dduuaa titninggkkaatt yyaanngg bbeerraalalammaatt ddii NNoo.. 1111,,
pLLpoooosrsrodondingiNgNoMoM..u1u1r1rn1,ni,LiL1o1o4r4ro,o,nTnTgagamMmMauaunrnrnDniDie1e1s4sa4,a,TMTaMamumurarnannin,i,D1D1e3e3s8sa80a00M0MuBuBrurnutnit,iet,e1r1rw3w38o80or0r0t0hthB,B,uPuPtutuetlaelraurwuwoPoPrirtnihtnah,an,PngPugulyalyaauanungPgPibnibneaeranarnaglagl.am.maatt
HHAARRGGAARRIZIZAABB::
HHaartratannaahhtetersrseebbuuttaakkaannddijiujuaallaatatass““sseeppeerrtitmimaannaa sseeddiaia aaddaa””tetertratakklulukkkkeeppaaddaassaatutuhhaargrgaa
rirzizaabb sseebbaannyyaakk RRMM 228800,0,00000.0.000 (R(RININGGGGITIT MMAALLAAYYSSIAIA:: DDUUAA RRAATTUUSS LLAAPPAANN PPUULLUUHH RRIBIBUU
SSAAHHAAJJAA))ddaannkkeeppaaddaassyyaararat-t-ssyyaararattjujuaalalannyyaannggddilialammppirikrkaann. .PPeemmbbididaayyaannggbbeermrmininaatthheennddaakklalahh
mmeennddeeppoossitiktkaann1100%%ddaarirpipaaddaahhaargrgaarirzizaabbddaalalammbbeenntutukkBBaannkkDDrraaffddi iaatatassnnaammaaPPUUBBLLICICBBAANNKK
BBEERRHHAADD11HHAARRIIBBEEKKEERRJJAAsseebbeelulummtatarirkikhhlelelolonnggaawwaamm. .BBaakki ihhaargrgaabbeelilaiannhheennddaakklalahhddibibaayyaarr
(o1(ol1el2eh20h0)p)pehehmamarbribiiddiddaaaaryiryiataatnanrgirgkibkhbheejrujjruajaaaylyalaaannk.k.eUeUpnpantadutduakakbPbPuUuUtBitBriL-rL-bIbCIuCutBitrBirAsAsNeNelKalKanBnjBujEuEtRntRnHyHyaAaA,D,sDsidliadlaaablableamermhrhtuetubembumunpnpgogohdhdesesnenegrgraaaatnutn:u-s:-sdduuaappuululuhh

FFirirmmaaGGuuaammaann :: WWOONNGG--CCHHOOOOII&&MMOOHHDDNNOORR
AAlalammaatt :: NNOO..2277,,11SSTTFFLLOOOORR
JJAALLAANNMMAAJJUUJJAAYYAA
NNNNNNoooooo......FTRRFTeauealuxjelxujefukofkoanannn :::::: PPUUSSAATT PPEERRNNIAIAGGAAAANN MMAAJJUU JJAAYYAA,, 1144000000 BBUUKKITIT MMEERRTTAAJJAAMM,,
PPUULLAAUUPPININAANNGG
0W000W44C44--CM--55M5533N33N99(9985B(85B88M88M5555)55/)55/PPBBBB--HHLL//22002200--227744//LLKKCC--LLEETT(R(RSS//j)j)

14 theSUN ON THURSDAY | JANUARY 13, 2022 Barty time? know where that level is until you test yourself
Aussie hot favourite to win Down Under against the very best.
SPORTS
matches for four months, Barty appears to be “When my back was against the wall I was “And it’s been really nice to have some good
ASHLEIGH BARTY will be hot favourite back in the groove already. able to produce some pretty good stuff,” she told hit-outs this week and I feel like I’m ready.”
to win her home Australian Open for the WTA.
the first time, but even with Serena Barty won the French Open in 2019 and While men’s tennis has been dominated by
Williams absent the world No. 1 faces Wimbledon last year but her best performance “Pre-seasons are good but you never quite the “Big Three”, women’s tennis remains wide
threats from all angles. in Melbourne was reaching the semifinals in open.
2020, where she lost to eventual champion Sofia
For the first time in a quarter of a century the Kenin. Last year’s four Grand Slams were won by
first Grand Slam of the year will not feature four different women – Osaka (Australian),
either of the Williams sisters – Serena would However, she fired a warning to the rest of Barbora Krejcikova (French), Barty
have been pursuing a record-equalling 24th the Australian Open field on Sunday, claiming (Wimbledon) and Emma Raducanu (US) and
major crown but she is not fit. the singles and doubles titles at the Adelaide Osaka and Barty’s early exits at the US Open
International. underlined the point.
With defending champion Naomi Osaka still
working her way back to top form and fitness Barty pulled out of this week’s Sydney Osaka, a two-time Melbourne champion,
after a long break, the 25-year-old Barty has Classic, explaining that she needed to recover went out to eventual New York finalist Leylah
emerged as the clear favourite at Melbourne from her exploits, but said that her 14th career Fernandez, who lost to fellow unseeded
Park. singles crown was a huge confidence boost. teenager Raducanu in the title decider.

Like her rival Osaka, Barty was dumped out The Briton Raducanu, who is embarking on
of the third round of the US Open in September her first full WTA Tour season, has struggled
and did not play the rest of the year, returning since her stunning emergence at Flushing
home to Australia because of the coronavirus Meadows and last month tested positive for
pandemic. Covid-19.

Unlike the Japanese star, who pulled out of a She pulled out of a Melbourne build-up
warm-up tournament last week saying her event last week saying that it was “too soon for
“body got a shock” after playing her first me, having just returned from isolation”.

TRAMLINES Raducanu should be fine for the Australian
Open, and Fernandez will also be there, as will
5402/2022 12/01/2022 (WED) another prodigious young talent in the form of
17-year-old American Coco Gauff. – AFP
SPORTS TOTO MALAYSIA SDN BHD (8420 - D)
DrawDate:12/01/22(Wed) DrawNo:5349/22 Venue: PERAK TURF CLUB
TOTO 4D PRIZE PAYMENTS GUARANTEED IN FULL
4487
1st Prize 7350 5327
2678
2nd Prize 8200

3rd Prize 9549

Special Consolation

6836 9989 1020 5156
0613 2985 4637 7142
8406 7860 4230 3661
5175 0858 9760 4562
5913 0679 7967 7700

3,296,395.82 6173 + 6592 5081 + 0346
3714 + 8842 7794 + 9065
7350 8200 8200 7350 Garbine Muguruza 7480 + 2707 4054 + 8895
7350 9549 9549 7350 hits a return 1698 + 1793 5129 + 6059
8200 9549 9549 8200 against Ekaterina 0369 + 6945 8788 + 6529
Alexandrova
114,343.35 (unseen) during RM22,819,751.80
their women’s
Winning combination of any 1 of Top 3 & any 1 of Special prizes. singles second
round match at the
1st Prize 7350 + Sydney Classic 4487 + 5327 5327 + 4487
2nd Prize 8200 yesterday. – AFPPIX 4487 + 2678 2678 + 4487
3rd Prize + 5327 + 2678 2678 + 5327
9549
+ ROOSTER RM697,582.60

4th Prize Special Prize + Muguruza makes winning start the first Arab player to crack the top 10 of
the world rankings, told reporters. “The
5th Prize Consolation Prize + AUSTRALIAN OPEN third seed Garbine end of the season also a little bit tough
Muguruza made a confident start to her with Covid. It didn’t help much for me to
6th Prize Any 4D drawn number season with a straight-sets win over train and everything. I was honestly just 264 487 + DOG RM1,303,333.30
battling Ekaterina Alexandrova yesterday playing match by match and seeing how I
TOTO 5D & 6D PRIZE PAYMENTS GUARANTEED IN FULL at the Sydney Classic. The Spanish world feel. Sometimes with adrenaline and the
No. 3, who had a first-round bye in way you play on the court, the pain
67382 Sydney, withstood a fightback from the disappears a little bit. So I’m really glad 165 327 + HORSE RM2,845,381.20
7382 40th-ranked Russian in the second set to that it’s the case.”
41256 382 win 6-1, 7-6 (7-4). Playing her first match 242 678 + OX RM860,000.00
40473 82 since winning the WTA Finals in ‘Voracova did nothing wrong’
November, the 28-year-old Muguruza said
762372 she was encouraged by the way she had THE Women’s Tennis Association said 066 173 906 592 925 081 610 346
stayed strong when facing five set points yesterday that Renata Voracova did 763 714 488 842 357 794 999 065
76237 62372 in the second set. “I was most pleased that nothing wrong after the Czech player was 937 480 632 707 484 054 268 895
7623 2372 I stood very calmly in the second set detained on the same “unfortunate” 801 698 311 793 275 129 676 059
762 372 when I was, you know, 5-4 down and grounds as Novak Djokovic and deported 150 369 586 945 288 788 576 529
76 72 serving and having all those set points, from Australia. The 38-year-old was
where you can get a little bit upset,” she initially permitted to enter the country and
TOTO GAMES GIVES YOU MORE WINNING CHANCES! said. “So to manage the anxiety, playing even managed a doubles match at a 487 327 678
the first match of the year and you want Melbourne tournament in the run-up to
2 24 37 42 45 48 to win and you want to start on the right the opening Grand Slam of the year, which RM1,496,479.10
foot. The last match was two months ago starts on Monday. But she was then put in 487 + 327 + 678 327 + 678 + 487
41,776,275.08 so it’s been a while.” a detention facility in Melbourne with 487 + 678 + 327 678 + 487 + 327
Djokovic pending a decision by Australian 327 + 487 + 678 678 + 327 + 487
3 7 13 33 40 48 Jabeur not back to full fitness authorities. While Voracova left Australia
8,487,372.38 on Saturday, Djokovic stayed and won a Avoid crowds, stay safe, play safe
ONS JABEUR said she is not yet 100% battle court to remain. “The complications with dmcGO.
Jackpot 1 7 20 26 31 36 47 49 heading into next week’s Australian Open experienced over the past few days where
Jackpot 2 6,468,355.40 after suffering an elbow injury and testing athletes have followed the approved and
100,000.00 positive for Covid-19 late last year. The authorised process of receiving a medical
Tunisian, who beat Petra Kvitova 6-4, 6-4 exemption for entry into the country are
Toto 4D Jackpot 2 yesterday to reach the quarterfinals of the unfortunate,”WTA said in a statement.
Sydney Tennis Classic, had to skip the “Renata (Voracova) followed these rules
RM121,364 season-ending WTA Finals in Guadalajara and procedures, was cleared for entry
due to a right elbow issue. The world No. upon her arrival, competed in an event
won on 09/01/2022 ! 10 tested positive for Covid-19 after and then suddenly had her visa cancelled
competing in the Mubadala World Tennis when she had done nothing wrong. We
Visit www.sportstoto.com.my for e-Results and more info. Championship exhibition tournament last will continue to work with all authorities
month. “I’m not going to lie to you, I’m not on addressing this unfortunate situation in
100% but I’m trying to get there,” Jabeur, an appropriate manner.”

FOLLOW ON TELEGRAM SCAN 15theSUN ON THURSDAY | JANUARY 13, 2022
ME * SPORTS
/thesuntelegram

I’m not asking for █ JONATHAN VEAL January blueprint
crazy stuff, says Salah Conte holds meeting with Spurs bosses over transfer plans
TOTTENHAM HOTSPUR head coach
LIVERPOOL forward Mohamed Salah insists he is Antonio Conte says the club will “We’ll see the decision of the club, if we be a free agent.
not asking for “crazy stuff” but wants to be have the “last word” over any want to improve in other aspects or not. If Reports in Holland say that Ajax have
appreciated in his new contract. potential activity in the January there’s the possibility or not.
transfer window. made a bid for Steven Bergwijn, but Conte
The Egypt international has less than 18 “It was a good meeting. A good meeting has suggested he wants to keep the Dutch
months remaining on his current deal and has Conte has met with chairman Daniel Levy because the owner and Paratici, they started winger at the club as he offers something
reiterated whether he stays or goes remains in the and managing director of football Fabio together this season from the start. different to Son Heung-min, Lucas Moura
hands of the club. Paratici to provide his assessment of the and Harry Kane.
squad following his first two months in “I arrived in the middle of the season and
Reports have claimed Salah is looking for a charge. for sure they know the situation much better “Honestly, Bergwijn, he knows very well
weekly salary of more than £300,000 (RM1.7m), than me. what I think about him,” Conte added.
which would smash the Reds’ wage structure and And, given the Italian has said there is an
would represent a significant departure as owner “important gap” between Spurs and the likes “A good meeting, a good meeting to speak “I consider him a player that can play in
Fenway Sports Group is reluctant to hand out of Manchester City, Chelsea and Liverpool, it and tell them my thoughts about after two all three roles, as a No. 9 and as a No. 10 as
lucrative contracts to players once they reach 30, seems likely that he will have asked for months I spent in Tottenham. It’s OK. well.
which he does in June. reinforcements.
“Now I am working in the present. I can “For sure, in my period at Tottenham, he
However, for a player who has scored 111 goals “I spoke with the club and I had my give this and then the decisions are for the was injured for a long time but I showed him
in 165 Premier League matches and leads the race thoughts about the situation and this is the club, not for me because the last word is that when he’s in a good physical condition, I
for a third Golden Boot in five years, it is not most important thing,” he said ahead of this always for the club.” gave him the chance to show that he’s a good
necessarily about the cash but what it represents. morning’s Carabao Cup semifinal second leg player.
against Chelsea. Spurs are understood to be trying to sign
“I want to stay, but it’s not in my hands. It’s in Adama Traore from Wolves, while they have “He’s very good in one on ones, he’s a
their hands. They know what I want. I’m not asking “Then the club has to decide the best way been linked with a summer move for creative player that we don’t have in our
for crazy stuff,” said Salah, speaking to GQ’s first to go. I don’t have expectations. I am a coach Manchester United’s Jesse Lingard, who will squad.” – The Independent
global sports issue. and I know that we have to solve many
problems.
“The thing is when you ask for something and
they show you they can give you something (they “For me, the most important thing was
should) because they appreciate what you did for speak to the club. I did this and now the club
the club. has to decide what we have to do.

“I’ve been here for my fifth year now. I know the Southampton’s Armando Broja 638/22 12/01/2022
club very well. I love the fans. The fans love me. (left) vies with Brentford’s
Kristoffer Ajer (centre) during 0302
“But with the administration, they have (been) the English Premier League 5940
told the situation. It’s in their hands.” – AFP match at St Mary’s Stadium 0813
yesterday. – AFPPIX
TOUCHLINES
Saints make owners proud 5556 1406 3115 7899
BORUSSIA DORTMUND are set to meet 2195 9647 5415 0649
Norway striker Erling Braut Haaland’s rep- SOUTHAMPTON’S new owners watched 9883 9070 1179 9990
resentatives next week as they try to find from the stands as the club registered 2547 0746 6185 7607
out what the 21-year-old’s plans are regard- their biggest Premier League win of the 9915 3419 4413 5797
ing his future. season by thrashing Brentford 4-1.
SEVILLA’S interest in France striker Anthony This was their first outing on home soil RM 5,768,576.77
Martial has cooled as they cannot afford to Goals from Jan Bednarek Armando since investment firm Sport Republic
meet Manchester United’s demands to sign Broja and Che Adams plus an own-goal acquired an 80% stake and proved to be a 0302 + 5940 0302 + 0813
the 26-year-old on loan. from Bees goalkeeper Alvaro Fernandez, far more fitting occasion. 5940 + 0302 5940 + 0813
PARIS ST-GERMAIN midfielder Georginio secured a resounding victory in Saints’ first 0813 + 0302 0813 + 5940
Wijnaldum has been linked with Newcastle top-flight outing since last week’s Speaking to BBC’s Match of the Day,
United but the 31-year-old Dutch interna- takeover. Saints boss Hasenhuttl said: “They (the RM 221,651.85
tional is not interested in a return to his new owners) saw an interesting game, a
former club. Brentford midfielder Vitaly Janelt briefly lot of goals. 04 07 11 16 18 29 31 36
FORMER Tottenham boss Jose Mourinho has levelled proceedings with a fine first half 05 28
contacted Spurs midfielder Tanguy Ndombele volley but the evening belonged to Ralph “It was a fantastic game to watch with
in an effort to convince the 25-year-old France Hasenhuttl’s rampant hosts. intensity, we had a lot of energy and I’m
midfielder to join him at Roma, with the Italian most proud of that against a strong side.
club wanting a loan deal with an option to Victory for Southampton – secured in
buy. front of lead investor Dragan Solak – “We had absolute control over the
AC MILAN are trying to sign a centreback moved them to 11th in the table, a point game and managed a new shape on the
and Manchester United’s Eric Bailly, 27, is and two places above their opponents. pitch with not much time to prepare. It
on their list while Paris St-Germain’s was fantastic.
Senegal defender Abdou Diallo, 25, is an The emphatic result was the first time
option on loan. Saints had managed more than three “It’s important we have this cleanness
CRYSTAL PALACE are in talks to sign English League goals in a game under Hasenhuttl. in the box and 2017 was the last time we
striker Eddie Nketiah from Arsenal, with the scored four goals (in a home match). It
22-year-old’s contract running out in the A new era for the south-coast club was a deserved win because of the
summer. started in rather subdued fashion with fantastic performance.
ARSENAL’S England youth international Saturday’s gruelling extra time FA Cup win
forward Folarin Balogun, 20, is set to join at Swansea, which was played behind “We don’t normally get a lot of chances
Championship side Middlesbrough on loan closed doors due to coronavirus but the game play we have worked on
for the rest of the season. restrictions in Wales. over the last few days has been different.

“Armando Broja was a threat all the
time and we took some good decisions for
how we want to play.” – The
Independent/Agencies

BRIGHTON and Newcastle are planning on Super Eagles down Pharaohs
trying to sign Argentine defender Marcos
Senesi, 24, from Dutch club Feyenoord. NIGERIA put behind their tumultuous In contrast, it was a disappointing day 024013 24013
BRENTFORD and Brighton have made bids build-up to the Africa Cup of Nations by for the north African heavyweights. 4013
for 19-year-old Reims striker Hugo Ekitike beating Egypt yesterday with a display that 02401 013
but Newcastle remain favourites to sign the sent out out an early warning to their rivals Champions Algeria were held to a 0240 13
Frenchman. in Cameroon. disappointing goalless draw in Group E by 024
Sierra Leone, making their return to the 02
RESULTS Kelechi Iheanacho struck a superb first finals for the first time since 1996.
half finish for a 1-0 victory at the start of 40
English Premier League: Southampton 4 Group D action in Garoua. Sierra Leone president Maadu Bio took
(Bednarek 5, Fernandez 37-og, Broja 49, Adams 70) to Twitter to express his delight. 03
Brentford 1 (Janelt 23). Nigeria had fired coach Gernot Rohr
Championship: Reading 0 Fulham 7. just weeks before the tournament, scraped “We are very proud of you, our Leone RM 7,361,512.53
Serie A: Cagliari 2 (Pavoletti 71, Pereiro 90+4) through the recent World Cup qualifiers in Stars,” he said.
Bologna 1 (Orsolini 54). unconvincing fashion and also lost key RM 254,436.97
Africa Cup of Nations forward Victor Osimhen to injury. The Egypt failed to shift out of first gear and
Group E: Algeria 0 Sierra Leone 0. Nigeria Football Federation also failed to could not get talisman forward Mohamed
Group D: Nigeria 1 (Iheanacho 30) Egypt 0, send out call up letters in time for strikers Salah into the game as he cut an isolated
Guinea-Bissau 0 Sudan 0. Emmanuel Dennis and Odion Ighalo, figure up front.
whose clubs then refused to relaese them
for the tournament in Cameroon. “The performance in the first half was
very poor, and that’s the truth, we weren’t
But despite all the setbacks, Nigeria on the pitch,” said Egypt coach Carlos
gave their supporters much to enthuse Queiroz.
over with yesterday’s showing.
In yesterday’s other Group D game,
Guinea Bissau and Sudan played out a
goalless draw. – Reuters

THURSDAY • JANUARY 13, 2022 QUOTE OF THE DAY

When my back was against the wall I was
able to produce some pretty good stuff.
Pre-seasons are good but you never quite know where
that level is until you test yourself against the very
best. And it’s been really nice to have some good
hit-outs this week and I feel like I’m ready.”

WTA world No. 1 Ashleigh Barty

Liverpool enter new year wrestling with old midfield woes

█ MELISSA REDDY happen all the time and I improved. Since then, Liverpool are without their main men in
IT WAS after the evisceration of Manchester have no problem with points have been Mohamed Salah, Sadio Mane and Naby Keita,
United that Jurgen Klopp delivered winning a game 1-0. dropped at Anfield to who are on African Cup of Nations duty. So
assessments which still, three months later, That is where we Brighton and a trip overpowering opponents offensively is off the
offer the brush strokes of Liverpool’s have to be ready. to West Ham was table at a juncture where nothing else has been
conflict in evolution. “We have to marked by a first on it for Liverpool.
be that stable defeat of the
At the height of their blitzing this and consistent season. How and why? When the Merseysiders finally
season, a period in which they blazed when the December was ended a three-decade wait for the title, their
37 goals in 11 games across all opponent has a calamity and design for progressing centred around evolving
competitions, having gone on their the ball. That is coupled with the the approach.
longest undefeated run since 1989, the where we can turn of the year has
manager purposely zoned in on their 100% improve.” left the club 11 Liverpool knew teams would focus on stifling
flaws. That is where points off top spot. creation from their fullbacks and needed the
Liverpool have Chaos rather than ability to control and craft from midfield: enter
Liverpool were a free-scoring machine in a 100% not stability and Thiago, the replacement for Gini Wijnaldum.
throwback to their 2017-18 vintage, but there consistency coloured
was little sign of the control, steel and surety the matches against Thiago represented a shift in how the centre
that delivered the status: champions of Tottenham, of the pitch would dominate and design games,
England, Europe and the world. Leicester, and which was a fine enough idea given his
Chelsea. brilliance, but discounted his absences.
By that point, the clues of underlying Now
struggle showed itself against Milan at Thiago Alcantara (left) Fabinho-Thiago is fundamental to Liverpool
Anfield, plus away to Brentford and and Fabinho. but they have only started nine and seven
Atletico Madrid. matches respectively this season. Was it wise to
pin an entire midfield shift – and wider evolution
Liverpool twice led against – on such limited availability?
Manchester City on
Merseyside only to draw, and Without Thiago in the XI, Liverpool can’t be
failed to exert superiority who they want to be and revert to who they
over 10-man Chelsea at were before the transformation into a truly elite
home too but flawlessness side: showcasing attacking blurs that can maim
wasn’t expected against opponents, but are open to being smacked
title rivals. themselves.

The high-definition In summary, a key component to Liverpool
picture from a wide lens, being in control centres around a supreme
however, did not make
pretty viewing for Klopp. player in Thiago, who is simply not
available enough.
And so when Old The midfield needs surgery. It is
Trafford was brought to its not the sole area of concern,
knees, he took his shot: “The although it has a significant impact
world is a bit like this: you on the structure – including the
win 5-0 against United and high line. Without pressure
everything is perfect. Well, against the ball, it screams
it was not. United had punishment.
clear-cut chances which It is a new year, but
we gave them. Liverpool are still grappling
with that old problem. They
“We have some are not quite who they were,
really impressive not quite who they want to
scorelines but you be and so are not quite
don’t expect that to enough to trouble City. – The
Independent

Nowhacked!
Mystery surrounds Djokovic’s positive Covid test, visa still in doubt ahead of Australian Open

THE VALIDITY of Novak misinformation” about his activity the event came back negative. scapegoat by the Australian around him. To go out when you
Djokovic’s positive Covid test after testing positive. Social media posts showed authorities, Djokovic is expected to know you’re Covid-positive... well, I
continues to come under face a tough crowd at the Open. don’t think he was even Covid-
scrutiny after an The Serbian conceded that he Djokovic posing with the children, positive.”
investigation suggested the test was “should have rescheduled” an without wearing a mask. Public opinion in Australia, which
returned 10 days after originally interview and photoshoot with is battling an Omicron wave of “That’s it, he’s an a***ole. He got a
claimed. L’Equipe on Dec 18 after receiving The 20-time Grand Slam winner infections and where more than 90% bullsh*t f*****g excuse and then fell
notice of his positive PCR result, but also sought to clarify seemingly of the adult population is double over his own f*****g lies.
German newspaper Der Spiegel insisted he remained socially incorrect information about his travel vaccinated, has been largely against
alleged that their analysis of the distanced and wore a mask other movements in the two weeks prior to the player. “It’s just what happens, right,
digital version of the test showed a than when being photographed. arriving in Melbourne. that’s what happened,’ Amor replied.
timestamp from the Dec 26. A leaked video showing two news
“While I went home after the He claimed that a member of his anchors on top-rating television The two suggested Djokovic
Djokovic received a medical interview to isolate for the required team had made an error on the travel network 7News Melbourne attacking would “get away with it”, while Amor
exemption to enter the Australian period, on reflection, this was an declaration in stating that Djokovic Djokovic off-air went viral on social claimed “most fair-minded people
Open as an unvaccinated player on error of judgement and I accept that I had not travelled during that period media yesterday. would say the bloke’s an a***ole” and
the basis of a positive test on Dec 16, should have rescheduled this on his immigration form to enter stated “they f***ed it up”, presumably
and has since admitted to knowingly commitment,” Djokovic said. Australia, with social media posts Rebecca Maddern and Mike aimed at the immigration authorities
breaking isolation rules to attend an showing Djokovic in both Spain and Amor’s comments were caught on and those involved in his appeal and
interview two days after. Djokovic denied media reports he the Serbian capital of Belgrade in microphone and camera as they sat initial detention.
also knew he had contracted the virus those weeks. behind the newsdesk, with a large
However Der Spiegel have also when he attended a tennis event in image of Djokovic mounted on a Amor also noted the “poor Czech
claimed that the digital test showed a Belgrade to present awards to “This was human error and screen behind them. girl who was sent home”, referencing
negative result for some time, though children a day earlier. certainly not deliberate,” Djokovic fellow tennis player Renata Voracova
a scan of the QR code does now show said on Instagram. “We are living in “Whatever way you look at it, who was detained by officials and
a Covid positive. “I was asymptomatic and felt challenging times in a global Novak Djokovic is a lying, sneaky, subsequently left the country over the
good, and I had not received the pandemic and sometimes these a***ole,” Maddern can be heard weekend after her visa was cancelled,
Djokovic released a statement via notification of a positive PCR result mistakes can occur.” saying. having used the same vaccine
Instagram yesterday morning to until after that event,” he said, adding exemption reasoning as Djokovic. –
“address the continuing that a rapid antigen test taken before While supporters of the Serbian “Whatever way you look at it… It is The Independent
star allege he is being made a unfortunate that everyone stuffed up

theSun is published and printed by Sun Media Corporation Sdn Bhd (221220-K) of Lot 6, Jalan 51/217, 46050 Petaling Jaya, Selangor. Tel: 03-7784 6688 Fax: 03-7783 7435 • Tel (Editorial): 03-7784 6688 Fax: 03-7785 2624/5 Email: [email protected] • Tel (Advertising): 03-7784 8888 Fax: 03-7784 4424 Email: [email protected]


Click to View FlipBook Version