His 11aster's Voice - British Library - Sounds

" His 11aster's Voice "

ýn oaß MMOTST"o vu tos fl9

12-inch Records, 5s. 6d.; 10-inch, 3s. 6d.

Two more enthralling Bizet numbers

qýý(( Iýýýý,ýýýý, uý
ýýýýI
ýJA'ýXý,IýIýýýkýiýýý'ýýIillýf'Ilýiýiýiý!IýýIýIIýý(Iniýý ýý
I
Iliil.lýiliýllll
.:ýI I iý iý, .
ülr.,ý

A

O°onducr'd by LANPON F: NALD

12-inch Records, 5s. 6d.

" L'Arlesienne Suite "-Prelude and Bizet
Minuet (2nd Movement)

L AST month IVweof had the stirring " Farandole "
from Part Bizet's symphonic masterpiece.

and The records here offered pPreasret ntII the Prelude
Minuet that together make up and the slow

movement, Part III.

It is safe to say that these two records are perfect

examples of orchestral playing and recording ; they
the very highest standard of New Symphony
aOrrechuepstrtao reproductions. Mr. Landon Ronald has
drawn the very soul from
his accomplished organisation.

The Prelude is delivered allegro deciso, and is
based upon the strongly rhythmic melody in the minor
mode-the theme that struck one so markedly in the
" Farandole " and which runs through the whole Suite.
The rich orchestration here and in the Prelude gives

play to the artists' perfect ensemble.
The Menuetto is rendered with extreme brilliance

and clarity, showing off sectionally the talents of the

renowned orchestra.
The suavely-flowing wind passages are punctuated

by brusque string phrases of a dramatic trend, the
interest being quickened almost to the last. The
(Speed 78)
concluding strains are given pianissimo.

0837 " L'Arlesienne Suite "-Adagietto
for Strings
Bizet

T HE Adagietto earns for itself a place unique in
music. The devotional effect of this record
have good fortune to
hear must toucfheelianlgls,whaos one the attentive to the
it-one's sits

rendering, are touched as by a great organ in a vast

cathedral.The

orchestration, remarkably rich and sonorous,
is for strings alone. The movement alternates in
character between the reverie and the hymn ; the
opening bars-

Adagio. C-4 t^ ý
` ý

x

_#-ý-- - y- ýý-ý- ý
grip the attention at once. The tone of the rendition
is heaven-like. The New Symphony Orchestra
Landon Ronald are here inspired. (Speed 77) and

There is a very beautiful record of this Adagietto
as a 'cello solo, by Mr. W. H. Squire (with
(No. 07867, 12-inch, 5s. 6d.) organ

accompaniment).

6ß Hnoff) mmazzT"o v©3©&9

10-inch Record (Violet Label), 4s. 6d.

4-2382 Say au revoir, but not good-bye Kennedy

T HE fulsome measures of
"Say au revoir, but not
good-bye," that haunting

old favourite, are delivered in
McCormack's most mellow tones.
The song is one that will remain
popular for many a long day, and
the singer here could not be
excelled. The refrain is breathed

with passionate earnestness, and
the record is one that will make a
deep impression on every listener.
The orchestral accompaniment
is strikingly beautiful and the
general ensemble perfect. A

record that will appeal to every.
body. (Speed 79)

Say au revoir, but not good-bye, TBBTSTAWhhhhuuhaeiettrselilrpTI'StsTewwhptaholwilolyoloaeniilvevtnreeaderegawmrenpdusggaeyfoseiowstrolybrseghndaeosveley-ivtupiosabtdeeeofriyeea,rretktdre,,rahesere,,asa,ntfbtdhhham,uw,arrettftlohhuoolbIeseohrlnotsodlalsamoovdpdrtvebiasewedteseehwgtaticalolreiidatoyeoseinuaodsngrnucw-swtoaabodtoiltsiiyitleyanlttlelh,ase-,t,,tmdrtd,.e.ieapetd,,a,in.
T'WIOOFTholwnuhoreeraevtrS'ITeTpeddpahlcawuoyalremittvseinytnyberiageggdpoeuihtauinctstsegatrrbylgetbleohsohvrit,iuheanostnfneeveigarra,dle,str,orhetveahItfenbbdhaaal,ute,orodhet'mbvenihIelt,unmwotalesofovdreetuhytvemtoaeudwunognrcsoerooieayygtotfynohadennumgt-ltoeoeb.lietivatyyvted,eeeds,m.ts.de.,cieerte,, ed,

Published by 7: S. Kennedy, Manchester

Sentimental ditty rendered in dulcet tones

10-inch Record, 3s. 61.

4-2385 Drink to me only with
thine eyes
Hullah

EN JONSON'S " Old

B English ditty" has
come through the ages

with unwaning popularity.
The simple yet plaintive

measure is admirably suited
to the art of our favourite
tenor, Mr. John Harrison,

who lavishes his loveliest
notes upon the song. The

simplicity and sentiment of Ruskin, \lelboiirn
this favourite air are brought
out in exquisite fashion by John Harrison
the delightful singing of the
present artist, and no better
rendering indeed could be imagined.

Drink to me only with thine eyes, I sent thee late a rosy wreath,
And I will pledge with mine, Not so much hon'ring thee,
As giving it a hope that there
Or leave a kiss within the cup, It could not wither'd be.
And I'll not ask for wine; But thou thereon didst only breathe
And sent'st it back to me;
The thirst that from the soul doth rise, Since when it grows, and smells,
Doth ask a drink divine, Not of itself but thee.(Ben I swear,

But might I of Jove's nectar sip, Jonson)
I would not change for thine.
Williams, Ltd.
Published by joseM

aßýný M m0 T,0 ýýý ýoncýcý ý9

Enchanting number by the universal
favourite

Mr. HUBERT EISDELL (Tenor)
(With 'Cello and Pianoforte Accompaniment)
12-inch Record, 5s. 6d.

02492 Angels guard thee Godard

T HE celebrated " Berceuse de Jocelyn " is perhaps
the best-known example of cloying melody and
haunting harmony in music to-day. The vast
number of admirers of Mr. Hubert Eisdell's individual
art will be prepared for tr"eaAt ngoefls
when an Eisdell record a an unusual order
of guard thee " is
offered ; the popu'ar light tenor has scored a triumph
equal to any of his previous ones in this exquisite
number. From the dreamy opening bars in which 'cello
and piano combine with lovely_ effect, the pure fresh
voice of the soloist ripples on, phras-
ing the placid measures with perfect
artistry ; nothing could be more
appealing, more truly human than
his golden notes in the passage :-
Angels guard thee, sweet love, till morn.

The combination of voice, 'cello
and piano is beautifully balanced
throughout, and the record has
lasting charm that will endear it a
to
all lovers of inspired singing and
Photo Holman & Paget

Hubert Eisdell playing. (Speed 77)

AH0B!leelnr emsaastydwhneeleosttvshee,eysqcienuaskilvms'prirnitssoghoenressl'etdl,eaevnpoeossrw, gblwieidnnheeestahrteehiinrtsohtsheotelfhtteertrseiplmkcasoebtnmline;gsbaras,tstalrass.t.

AWheavA!Tihnwrgfoaakuireghadrnweodaetmrbeyaemotfslpafngirrodoitm'lsd thy repose, bear thee !
hovers near thee,
Sleep, love, it is not yet anhdaprpoyse, isles to
Angels guard thee, the dawn,
sweet love, till morn

Far from the thneoisbyrantchhroensg hbiyghsobnyg birds lull'd to rest, ;
Where rock breezes soft caress'd

Softly the days bgeotoonthbeye sorrow all unharm'd,
Thus may life
a sweet existence charm'd.(S.
J. Reilly)

Words printed by kind permission of the publishers, Metzler &' Co.

Another celebrity makes his bow

Mr. EDMUND BURKE (Baritone)
(With Pianoforte Accompaniment)

12-inch Record. 5s. 6d. 4
Needham
My Dark Rosaleen

T HE well-known concert and
operatic baritone, Mr. Edmund
Burke, made his operatic
debut in 1906 in France, and first
appeared at the Royal Opera,
Covent Garden, in 1910. His voice,
as will be seen from this excellent
and characteristic record, is robust
and full of quality. The artist is
especially known for his many
appearances at Melba Concerts in
London and in the Provinces,
and is now touring in his native
Canada diva. " My Dark
Rosaleen w"ith the charming little
is a
ballad tenderly dealt with by
Edmund Burke Mr. Edmund Burke. (Speed 78)

OTTAhhnhTeeUDMd,rhopeyemopySnrndiypseoaastrmdtwntkhsaiaisesnrrihgckeRhahoor,cResafearladaooellnooemsoenansnnglhgtetoahhrteleeeltn!ehwn,eorgeocievey;dpaeaenlepy!.Poguorpeeehnope;, WTooALeriskeeeeanmdtyoyouptlrhaoeitnb,rnmigipgohahutirtnnffauanalcnded woe, so,
noon ;
clouded
moon.
'BTiuAsMt gyyayeiontduarIskiwhnaillRglloolsrdraeeelainegrenn,ysohsueh!reanllthr:roenigen alone,
My Rosaleen ! 'TTiiMsMs yyyyoooduuwarnskshhaaRlRllloosshraaeallieevgeeennn,
own yyoRouuorsahlheeaeelnatrht,, hope, !
Shall glad shall give you hope, the golden throne,
Shall gdiavrek and help, and and reign alone,
!
My !

TATMhhlTlTyeeMIsoodylwhviafaeteyaedhnarsayidrtnoretlkkfdonhfilrgeinoRofaeafro,miltdnslyoamyolfwuueyoIe,bnirtnormhemsysiasoonoytimvnu!et,q,mulofoeyafveinensbtarsie!na!tsst, TAOEhnrhWeeAWdMni!yatydhektgoaheuudretfnarhlre-asmkpdEhmeuarsaaennlhnRllsde,ayoallsnfwaascaalhdenrreaeaodegl,pcnllkesenorlrhoubefi!gnesllaenbynrelraooe-aencuontddhrde,y,,s,hwaololuorddtiree;,ad,
TMoMMhyyleifaeodr,warnymkoyuRrRlooossvsaweal,leeeeeentmn y TEhrMeeMyyyJououddwgamrcnkaennRRt ofoassdaaelHle,eoeeunenrre!m!yuosut
! complaints, first be nigh,
saints, can die.
and sad
saint of
!

(From the Irish br James Clarence Mangan)

Words printed by kind permission of the publishers, Boosey &' Co.

66 ýýý 9S v©©© S)9

Mr. THORPE BATES (Baritone)

(With Pianoforte Accompaniment)

10-inch Record, 3s. 6d.

A JOYOUS song that goes

ti!IF1II!I!II!tlü indeed " with a right good

swing," as the chorus says.
Dashing Thorpe Bates enjoys his
breezy ballad thoroughly, and

voices the stories with a zest
that cheers. Here is a record
to draw you out - it sparkles
throughout. The rich, full bari-
tone of Mr. Thorpe Bates is

delightfully used for this song.
(Speed 80)

When achlthleraeamrewtrphyoinwgintphoasdos'ejroIymbtehibdee-ab"wtyGs.inodoihdni-ggdha, yr"oad YIOOeffs'IOWaNisnfcbehgoa!lieuntumnhaeraltamlliydeyscsltyoahaevnsasbshagtooaleinnwsegdiaross.snfdlioncanhanthglirdllveuoalaevnd;l-etrasyrmse,sy'wreogasulaysoy,r-e ; vows,
My

With

To

A-swinging, a-singing

A roundelay their lasses
Of lads that woo
In Love's old way.

With a right good swing I sing of dauntless heroes
My song I sing OfAWmbhaoidttleusnthkenfoowutegnmhtpesst'eg'saasinsteroxaprwl.oirned. and wave
OfOnbramveanydeeads long,
ramble
done A-rolling, a-bowling.

AnSduchfairtalemsaidIs tellwonin, song, Through crested foam,
Tra la Ia, tra la lay, TheSailgsoopdrousdhliyp
WAMniTdthras,oaanIgadr,eigrIrhlyats.inggd.ooowdn day ! crowned with victory
swing home.

With a right good swing, etc.

(Hilton Schofield)

Words published bypermission of the publishers, Boosey &' Co.

Mr. HARRY DEARTH (Bass

(With Pianoforte Accompaniment)

12-inch Record, 5s. 6d.

02489 Ships' Tales Barratt

W EATHERLEY'S breezy words abrreeeziessett to
breezy music, and voiced by the of
basses. Popular Harry Dearth is always
heard at his best in a song of the sea, and he spins
these yarns with a zest and an interest that are just
This is
wonderful. round the a grand nudmarbkerevetnoingens.l(iSvepneed the
home circle fire these

80)

AJBOFauonncA(AtrdekCnhsdoteShghoneeaoinrntttiSuhglhyruMemdanadwoadynrbnahraoydiiameycadhysetm,osnothhgroaensieufnhn,mee,ttChoaahrenasseaewpnaegdsIvdnh'aaevotinlesnada'wtnhwthedaieesmsvadBarrdldalaaSi'ylenslaet,eylrlsya!t;yo)a,!cono,ka-t, YMChoaYeurere'WdyBroi-luhyhtab,oatedtotMebny!ro'eotHyrumsera,'alxalixltduo,Jkcamkntchokeewi,mf fyarmyoe!suyhbepHenl.ieenaagsretiesb.!reeze !
WIf eylol-ugowantbeltoowk, now,
note, Jack
So on Tuesday quite got safe oaffloSaatl.ly. And judge for yourselves, my Hearties
For he'd had enough
FAJNaonocAS(rdwkChhest'ehsfhdfeoheairnuecigntlahsydamdtweiasmobdhauoiepfctyae,htscor,thwnsit,gamhiwtuehenmaoos,srualstenheaIe'envpadedmvtoheunoathacnn'eatihanl rdtdShvadeaasorllal'ueycwslblea,oyet.yl,ld,l,!)wet
Cheerily, bebogyos,ingthenwhemnakethe her spin,
Time to ! squalls

begin

BuYt eAOiot-'s'shhocoosraeufr!esreWyoeouynoknuctohawnemassye!taay,! ! Hearties ! stones,
my
All among and the dead
IWf eylol,u-yoauxes bones, the crabs men's

mjuest why, AnAdndsheI'llsanyost "No fear ! I've gSoatllyyou! " here !
try, give you up for
I've tried it myself, my Hearties.

So(Cheheesraiillye,d boaywsa, yt,hena,s I've heard say, Cheerily, boys, to the freshening breeze !
heave-ho-hearty !) MSoaYrsreAtyBoic-ukhtwoaiatfMoe!MeyWmreomruaemayriakdinwdfou'siwsvsiefsy,!wouumssyp, leHaseeartie! s

Till Jack was 'ware of a lmittelremapidarty. fair,
And on the top of
For she she was a hsims asritde the !
swam to

tide, dmeyepHebaerltoyw, ! ThereTO'shreymSoohumathevtsehnin'tglikeginoat gwhtaahitl,asle'sm, y Hearties,
AAnnAddndyIo'lulshreoschkacnr'iteydouha"vtCeo osmlweeeoprryalionnotghr,e work or
woe! "
And Jack-well, o' course-he was bound (Fred. E. Weatherley)

to go l an amiable party !
He was such

Words printed by kind permission of Boosey &' Co.

An old favourite rousingly rendered

Mr. ROBERT RADFORD

(Bass)

(With Pianoforte Accompaniment)
12-inch Record, 5s. 6d.

02490 Oh, oh, hear the wild

winds blow Mattei

T ITO MATTEI'S old classic,
"dedicated to and sung by my

friend, Signor Foli," could have
no better exponent than England's
renowned bass, Mr. Robert Radford.
This rousing Italian boatman's song is
a favourite of robust bassos. The
lilting tempo is excellently suited to
Mr. Robert Radford's grand voice, and
he delivers the brio
that the Italian verses with all the him-
master-composer
self would have wished.

DHeaAArrknnddheaQSLarasmreuotncewyotltalrlOOOhHysnbeehhhseret,,,MaahmIrcveotooaleskhorhhhneiuif,,,ateid,etbehhsbsowraleewlc,roaaioetqilrrwhntfduhthreeoawabrtttbvghhei!enueenidsnssdath,oewwstmfewdliiytlleaddhitrwnnhecsdgaiykhltwnwalwdeicibaoaneongaevrndwdolefem,osmrbebrelelttonho,ohwdwetnehi.,newhsgeeialfrdi,eelraecsceeeh,a.gsaaliel,.
OLOOnahnu,,, ghtoohnno,,saemtmyythbebrbiagarrhwqqtuiuneed,,e,yedwtshaeesarhewSattiohtnirrnemogaurglyhKminhegtohmethweef,reoe'al,lm,dare.
AITnhnInedthSQHdesawapuunnimeadrgtltiaaOOlceHbOtrrhlkhhehy,,toa,MhrfanitoooashnilrIhhhgoedii,,,haftvi,teersssbssahhhrtltcyoaoooooose,rsuuuwrnemmllledddhImsbat!eposvrtnaoreitttdsmhhhceeteeeetodhmtettwathgeeehnarmmiueVlcdtkadyppnrieerldemogcssewnattioynleinmmndbegmgyrdrarteooeoavhbcuw,nweelk'old.,,lwwb,psaialrrdayqy,u.esea.may
wreck,

On, othnno,ostemtyhberbigawrhqitnude,eytehdsaatshawbartiihntrignosgughusmehthoemtheefor, ea.m,
Fear
Oh,

On, on, the storm and wild wind we'll dare. (Mme Foli)

Published by H. Beresford

The favourite " Hiawatha " number fervently performed

Miss RUBY HELFER(Lady
Tenor)

(With Pianoforte Accompaniment)

12-inch Record, 5s. 6d.

03345 Onaway, awake beloved
Coleridge-
Taylos-

L ONGFELLOW'S eloquent

words are set to music by the
late fitCtohleeirridbgeeaut-yT. ayloOr n in a
fashion to every

concert platform the famous air,
" Onaway, awake beloved," is heard
perennially, and a rendering of it by
the renowned lady tenor, Miss Ruby

Helder, will excite keen anticipations.
Herwonderfully suave and expressive
voice could find no better vehicle

than this well-known excerpt, which
she sings with striking beauty of tone.
The song is one to tax the capacity of
finest ballad
t-hh-aev- e ----h-e--ard -------- la-sd-iy-n-gýert.enoar'nsd all wh_o_
the records Miss Ruby Helder

will realise that in this record she has a song worthy
of her calibre. The final passage, " Onaway, awake,
awake," is delivered fortissimo with perfect brilliance,
bringing to a conclusion a record of quite exceptional
merit. (Speed 79)

AWTTTIIOfhhhsanhoootmaheuuuwtnohuaehywttahh,tioheletinehliyleaywwysweii,fllaylddekIooee--efsobflalkimotrehdwtsshboeteeherlapsoopdoravfpaeftetiwyodrtm,ihfaeeen,tu,hdp!peoranffaiorwiretenhs-etlmi!ke! ! ! BWSSTATWWAmmhhusshhhaetiieeetnllitnnneenIhsetlmhotsttthusethhhsyheenhoeoesciuuthncotrchiilolenlnodaseouaegumrubrtdtdlwihwlelseenrdaigsisonyvsltade,ednarlrdohomomfsenmpkadgassriyaeetktmmrrhssekbheiisellieaiennsanldrsoebgio,ibavpotnwrrhepviedslgere,ihmsvtw,eeeuernassnte,.e!dri,st, !
AIDLnseoaetphstheentomostpomroianenlelgtswththeheteoneb,lmonoleiedegathptswthtieotahrimensuenebmstrhieginhthet,eeset,?
IADLnseoaetphstehentomostopmoraiennlelgtswththeheteoneb,lmonoelideegathptswthtioteahrimensuenebmstrhieginhthet,eeset, ?
Onaway ! awake, awake !
Onaway ! Onaway ! awake beloved !
When beloved.
'PA Ll1C_il_ _illty_h_ouLilG_a".a.r_e.:L..nLAot,D.0..Lp.a, leaa.ll.sL_eL.d], aL.a.a.l..i_lL..C.1_1C..Laa,

Fublished bv Novella &'' Co.

ý

ýßß ýný° ýaýýýý o , Von,0zý 99

ý

A song of exceptional worth grandly voiced
Miss LUCY MARSH (Soprano)

(With Orchestral Accompaniment)

10-inch Record, 3s. 6d.

His Lullaby Jacobs-Bond

MISSLUCY MARSH, whose
impressive singing of

favourite soprano airs has
recently been such a feature of
our supplementary lists, has chosen
a particularly pretty melody for
November. The charmingly original
music by Carrie Jacobs-Bond has
leaped into popularity in the United
States,
wMhaedraeme the celebrated con-
tralto, Schumann-Heink,

makes it one of the features of
her repertoire. The sentiment of
is pretty and real, andMoreh'o
the worTds £V au1011
Lul.., itrv Yr.unara.Ea Timr' .-l
Micc
*1111 JJt%4
LTaa00 0

notes give it poignant expression.
The eloquent words give one a
good idea of the beauty of the song, but to know the
beauty of the singing one must hear the record, which
is perhaps the finest example we have yet heard of this
famous American artist's rendering of a ballad. The

recording is quite perfect and the record a charming
one in every way. (Sneed 78)

You crBieadby,in Baobuyr. sleep for your mother dear,

I wouldBabyyo,u Bcaobuyld. call her back to us here,

The little olwamn bslamabrkein'assleebpegionnnintghe sod, God,
And my to nod,
And oBvearby,theBasbtyar.light your mother's with

Sleep hBaasby,comBeabyt.o the birds with the dew,

Her eyBeasbyw, erBeabyas. blue as the eyes of you,

Dreams for syhoeurlovseldumbtielrls come up from the deep,
I'll love as morning i peep,

And mother Baabboyv.e(Carursiewill watch while we sleep,
Baby,

Jacobs. Bond)

11'ords printed by permission of the publishers, Messrs. Jacobs-Bond

Old English ballad makes a lovely record
Mdme. EDNA THORNTON
(Contralto)

(With Pianoforte Accompaniment)

10-inch Record, 3s. 6d.

Barbara Allen Macfarren

T H E well - known traditional air
" Barbara Allen," a record of which

is already on the catalogue by
Madame Clara Butt, is offered as a black
label number by the popular concert
contralto, Madame Edna Thornton, whose
voice, which records so unusually well, is
as well known to record lovers as to
concert goers. "Barbara Allen" is an
old English ballad of the seventeenth
century, and is, as the music says,
" arranged with symphonies and accom-
paniments by G. A. Macfarren." The
ringing, mellow tones of this fine contralto
voice are beautifully heard in the simple
lines of this and the rendering is
marked with song,
a high order. feeling and understanding of Edna Thornton
demand for this type
The

Tofhosronntogn'snevebreauwtaifnuels, and Madame Edna Allen
version of " Barbara
will become a classic. (Speed 78)

MInTaHdSheecerarerlenevta'mrwyaeTsoywwoanuatsfhaiwrBhcamreryr6ae'irda" I dwwaesllinb'o, rn, W"OhFHeoenmrr oIthhhseeeharra,wtllasmwdioadetsehaetdosr,t-rmuacopnkridrtoywwl.ami"itdhe, in grave ;
weAlll-lae-nw. ay! sorrow

YAollFWuonhirgnenltohJveegemrmemoeeynfrrBy Gabrurbmod'rvsoaentthhAeoylnloefnhw.iMseraedye,astwh-eblelidn', lay, She, on her death-bed bays she lay.
Begg'd to be buried him;

AnTdhatsorseheredpiednteed'er odfentyhe day
him.

TAhnA"edYnnodauslnllsgolwsohwleyml,yasnasisldoh,Iwetlhwyci,nahmkensehyet'anhriceegarhemdehysiihmnuegp, .,"came, HeFAOnancfredecwforeursltelhhl,"unBtastahrhkbeee'rafsawauiadlAtr,nllieIn"ngyt.ee"ll virgins all,
in fall
by ;
the

Another lovely number by the captivating
American star

MISS GRACE LA RUE (Lyric Comedienne)

(With Orchestral Accompaniment)

12-inch Record, 5s. 6d.

Highland Mary Von Tilze

MISS GRACE LA

RUE'S first song,
" You made me

love you," which formed

the subject of a two-column
article on the front of the
" Pall Mall Gazette," and
which has since been used
for a delightful Home Rule

cartoon, made the great

hit we anticipated and is
still enjoying a huge vogue.
The other great song in
her programme
at the
Palace Theatre, London,

is "Highland Mary," which

makes as pleasing a record
as her previous number.
The artist's voice is un-

commonly sweet, and she
certainly has a " taking "
manner of singing. The
record is capital. Miss

La Rue will probably be
figuring as leading lady
in a West End musical
comedy before long.
(S_')e2d 79)

The first GRACE LA RUE Record

03343 "You made me love you" 12-inch 5/6

This enchanting record has attained enormous sales

04572 A feast of tuneful singing

GRAND OPERA COMPANY

(With Orchestral Accompaniment)
12-inch Record, 5s. 6d.

Gems from " Tales of Hoffmann " Offenbach

THEREare no
more popular
issues on our

supplementary lists

than the various
operatic " gems " by
our Grand Opera
Company, and our

offering of this
month could not be

of a more popular "Venetian Scene" in
nature. "Tales of
Hoffmann "

Hoffmann " teems with melody, and our talented
combination have a rare chance of showing off their
combined singing. Many of the effects they attain
are glorious, and the melodious " Barcarolle," for
which we all look as the record proceeds, is sung
with enchanting sweetness. The whole record is one
of the very best that we have ever issued in this
series, and there can be no doubt of its popularity.
(Speed 80)

OPERATIC GEMS PREVIOUSLY ISSUED

GRAND OPERA COMPANY

12-inch Records, 5s. 6d.

0453904537Gems from "Cavalleria Rusticana"(Dl(iscaani)
Gems from "Mignon" (Tkonras)

2-054024045270S4e5x5t3e0tt4e562(" Lucia di Lammermoor ") (Donizetti)
The Bridal Chcrur from " Lohengrin" (Ii 'ac nei )
Gems from " Pagliacci" (Leoncavallo)
Gems from " Faust " (Gounod)

ßaýR0) M ao T0 T'o

rr1trttp 3&ccorbo

An exquisite record that will charm the world

(Pianoforte MELBA

Accompaniment by Prof. Lapierre)

2-033037 Le Temps des Lilas
(Lilac-time)
Chausson
12-inch Record, 128; 6d.

L O V ELY beyond

L description - no

words could con-
vey the beauty of this
charming number by

the world's greatest

soprano. It is essen-

tially a French air with

its appealing rhythm-

in some parts its lack

of rhythm - and is
carolled with a beauty

of voice which could
belong only to the
peerless Melba.

The impression one
gets is of absolute

pastoral placidity ; the

celebrated artist's phrasing and diction are as flawless
as her inspired interpretation of these pretty verses
of Ernest Chausson, the well-known French ballad-
writer. As we have said, we cannot hope to describe
the record adequately, for its beauty is celestial.

From the crystalline opening notes, miraculously
produced, perfectly phrased-

ýý

ý

b.. ýý 1 1\ _.J__ I . iý ý1_. ý _-ý __ 1ý
_ýgy:1rý-I . _ -ý-ý
ý- d01- - ý-
- -i --Z-/--ý--'1_ i --`` --ý-
- ý9- ý - ý -Fi-- \J

ý / ses

Le temps des li - las ..................... et le temps des ro -

one's interest is held to the last limpid note.

One thing that will especially strike the listener is
the exquisite pianoforte accompaniment by Professor

Lapierre, who is in perfect harmony with the Golden
Voice. (Speed 78)

Le temps des lilas et le temps des roses Lilac-time and rose-time will come back no
more this spring ; lilac-time and rose-
ve reviendra plus ä ce printemps-ci ;

Le temps des Was et le temps des roses time are gone-forget-me-nots, too.

Est passe le temps des ceillets aussi. The wind has changed, the skies are

Le vent a change, les cieux sont, moroses. sombre ; no more shall we run and
Et nous n'irons plus courir, et cueillir, gather the lilac in bloom and the lovely
Les Was en fleur et les belles roses ; roses. Spring is gloomy, cannot bloom
Le printemps est triste et ne peut fleurir.
forth.

Dh joyeux et doux printemps de l'annee, Oh, joyous and sweet spring-time of the
:)ui vins, 1'an passe, nous ensoleiller, year, thou who didst come last year
Notre fleur d'amour est si bien fanee. and bathe us in sunshine.
Las I que ton baiser ne peut 1'eveiller I
jEt toi, que Pais tu ? Pas de fleurs ecloses, Our flower of love is so faded, tired one,
Point de gai soleil ni d'ombrages frais that thy kiss cannot awaken it !
Le temps des Was et le temps des roses,
And thou ! What doest thou? No springing
vec notre amour est mort ä jamais. flowers, no happy sunshine, no cool
shade. Lilac-time and rose-time are
(Maurice Bouchor) dead for ever-dead with our love.

A record that really approa
in so
ALMA
G

AND ZIMB
10-inch R

7-33005 ýle'gie (So

(Sung irr
TULES Emile Frederic Mac,,e,

Alma Gluck I one of the best-known of
J He wrote prolifically for t
If for nothing else, his nam
the voice and the piano. " Elegie," here performed by
of the indescribably lovely

Madame Alma Gluck needs no introduction-her
advance ; her concert appearances this spring in Engla
Hall next month, and we might eventually see her
Metropolitan Opera House, New York. (By the w
she first achieved renown ; that bright morning, two ye
find herself famous.)

(I Since Elman's debut perhaps no new violinist has crea
as Efrem Zimbalist. Born at Rostoff, Russia, in 1890,
age of seventeen and is now reckoned among the fire

gloomT,hesorrmouwsicareof dethpeicte"dE1iengiiets " is at once entrancing and dev
pregnant notes, yet a celestial sw
Epveolmriscuaenad'sberdeabtohtwehsaint gtnhoeitnhminlaogsutrnbimentgotenrthso'sonfgnitewswikthin"dinAehvfafesablMbeeaernfiearva"ochu(irCe, vaeradun.sdo-Ethl(meSap

aches perfection-a poem
ound

GLUCK

BALIST

Record, 6s.

ong of Mourning)ý. as the composer

r Masse net

e,Fnreetnch)who died in 1912 was
f modern French composers.
the lyric stage, the orchestra,
me will surely go down to posterity
Alma Gluck and Efrem Zimbalist.

sparkling ballad records have carried her fame in
and are to be followed by further ones at the Albert
r at Covent Garden-she is a prima donna of the
way, it was in a Massenet opera-" Werther "-that
ears ago, after she first sang as Sophie, she awoke to

ated such a stir here, on the Continent and in America,
he made a sensational debut at St. Petersburg at the
violinists of the day.

votional. Its measured flow has a melancholy beauty ; grief,
weetness pervades every page. Gluck's flexible and appealing
violin obbligato is so lovely as to invite direct
an record). The reproduction is a perfect comparison with
peed 78) one, and we are

7-52042 10-inch Record, 8s. Leoncavallo

Lasciati Amar (Let me love thee)

(Sung in Italian)

T H E great Neapolitan

revels in the little pas-

sionate ballads which

Leoncavallo pens from time to

time, and there have been no

more remarkable sellers among
Caruso records than the folk-

songs and typical Italian airs.

The new one we present
this month is a tuneful example
cf Leoncavallo's ballad writing,

and the world's greatest tenor
voices its strains with a fire

and voluptuousness that could
be equalled by no other singer
to-day. Surely it is the living

Caruso that utters those great
thrilling high notes, so skilfully

reached and so marvellously

Caruso as Dick Johnson in cut off-no other vocal organ
" Girl of the Golden West " could be equal to it !

Leoncavallo, happily enough, has dedicated the air
to Caruso himself. (Speed 79)

Scotti in a charming serenade

SCOTTI

10-inch Record, 8s.

7-52019 Scetate-Serenade (Awake!) T. Mario Costa

(Neapolitan Song : sung in Italian)

T HIS is a little Nea-

politan song of the
type that Scotti

sings so well. Its form is
not familiar to the English
ear, but its fascination
and quaintness cannot be

denied, and the voice of
the great baritone treats
it with ineffable fire and

skill. It is quite an ex-

ceptional piece of singing

in its way, and the flexi-

bility of Scotti's robust

voice is most marked. Scotti as Scarpia in " Tosca "
This should be one of

the most popular ten-inch records of Scotti's that we
have yet issued. (Speed 78)

SSCPiiheeidntutoetoorcmapvenöetänbuoennsamei uncmauasnnesnzautidoenucoerlsmlctaaheme,smtadibeoezcvl'eloace!ämvi!ai,a, Whether you sleep or not, my fair one,
Listen for one to this voice,
fomr oymouentas I walk,
Which longs

And has sent you already a song of love.

SEMSctieantafufsteetran,iiecsatmdbeuelolrlemlaesntmannuoianm,, annsdneuuunlnvioncnatctnoahoisüi scetata, ! YATBhwoueutarkyemo,wuainnrddmeoomylwianiefnaidroseoilsesneeap,ninfoigwnt.ehoypyaeoncduc.oodmyidpoaunniosmtleeenaptw, ak?e,
apri,
!
durmi

N'cielo se sö arrucchiate ciente stelle, TAAI hllehhyautvonedslraiesiddtheenatrhdsittsoarsptthahiseshsiaovsnteohnreggme;aethaenfraseirdesdteaitnho.neh[secaovuerdnsie,s,-
Tutte
Aggio pe sta a asreläntili ctthreestacchciüanzbobneelle,;
ntiso
Dicevano : N'ce tene passione !

EPaspsaassiolunemuncnao,nunesspaassnaun maie, ! This diasysa paasresiopnassinwgh, ichbutneivtenrevedries, will pass,
passara The

Tu certo a chesto nun ce penzarraie, You certainly will not think of this,
Ma tu nasciste pe m affattura ! You who are the fairy who enchants me.
(Ferdinando Russo)

Words by permission of the publishers, Ricordi &' Co.

ßa TL5Týý5 OD

THE Prime Minister of Mirth,

whose record of " The

Barrister " tickled the whole

kingdom last month, has a worthy

successor to it in "You've a very

nice day for it too." You can get

some inkling of its. racy contents y

from the airy title, which is, we

must all admit, quite Robeyesque.

You'll laugh at Ilka verse---
och ay!

HARRY LAUDER

(With Orchestral Accompaniment)

T HE highest-salaried enter-
tainer in the world has the
rare gift of combining
homely sentiment with delightful
humour, and in this new record
we have a scintillating specimen
of Lauder's typical humour and
song. Verse after verse is rolled
out in Lauder's rich baritone to
a lilting Scottish measure, and the
artist has never been pawkier and
more telling in his delivery of a
song than he is in this splendid
record. You simply can't help
joining in with him at his long
drawn " O-o," as he scampers
off into the comical refrain, with
its Lauder-like expression in the
last line. (Speed 79)

Published by Francis, Day S' Hunter

6ß HA. mcýotCýT"o v©©©fl9

A record with a champagne flavour

THE RAGTIME CHORUS
(With Orchestral Accompaniment)

12-inch Record, 5s. 6d.

04570 Song Medley-No. 1

Containing " When the Midnight Choo-Choo," " When I
lost you," " Snookey Ookums," " Take me back to
the Garden of Love," " At the Devil's Ball."

T HE champagne of ragtime and topical hits by
a chorus of amazing talent. The dashing
singing in this record is a thing to remember.
From the time the needle slips into the first groove
Such singing as
you sit attentive-more -delighted.
this is refreshing : whether you're a ragtimer or not,
record. The " When
you'll welcome this " is excellently piquant (Speed the
midnight choo-choo featured. 80)

Have you ever met Sybil ?

Mr. TOM CLARE

(With Pianoforte Accompaniment)

10-inch Record, 3s. 6d.

4-2383 Sybil Archie Naish

THIS celebrated entertainer at
the piano, whose " Version of
the Telephone " has become
a classic, sings us a song of the day
in " Sybil." With a sure light comedy
touch Tom Clare descants upon the
ways of his Sybil-you laugh as
heartily as if you were in the front row
of the stalls at the Pavilion in Picca-
dilly Circus. A capital little song.
(Speed 78) Published by Reynolds 71Co.

3Eiitruintntat

HE Garden Scene
T of " Faust " is un-
doubtedly Gounod's

finest inspiration ; the
sensuous beauty of the

music with which the
composer has surrounded
the story of Marguerite's

innocence and trust

betrayed, has held many
millions in rapt attention
during the fifty years since
it was first heard. The

many exquisite melodies
of the Third Act have here
been bound up into a pot-

pourri which the great
Russian violinist, Mischa
Elman, plays, with piano.
forte accompaniment,
his finest manner. in

Mischa Elman

In this record the young artist does not show us
feats of execution, but brings out the full beauty of the
music which Gounod composed for this immortal
scene. The artist's is of loveliest,
phrasing faultless. tone 78) the and the
(Speed

ßýýýý ýºvýcýýýCs`'ýý ýýýý ýýý ýý

PIANO

Celebrated pianist in a Chopin Polonaise

Mr. MARK HAMBOURG

12-inch Record, 5s. 6d.

Polonaise in B flat

R. MARK HAMBOURG,

whose younger brother

Boris is represented with a

'cello solo in this list, often makes

Chopin's beautiful Polonaise in

B flat a part of his programme,
and his rendition of the classical
morceau is a brilliant piece of
work. He caresses his keyboard enchantingly in
the difficult runs and cadenzas and his tone never
falters in its limpidity. The crisp touch of the artist
is marvellously recorded, and the resulting disc is one
of the finest pianoforte records that have been
offered recently. (Speed 79)

'CELLO

7893 A 'cello of exceptional beauty

Mr. BORIS HAMBOURG

(Pianoforte Accompaniment by Mr. J. A. Warner)

10-inch Record, 3s. 6d.

From the Land of the Sky Blue Water
Cadman, arr. by Hannbourg

T HIS striking 'cello solo
is from the American
Indian Songs, composed
by Chas. Wakefield Cadman.

The picturesque title gives a

hint of its quaint melody.

The youngest of the talented

Hambourg family, whose

recitals at leading concert halls

in London and the provinces

are so well known, gives us a rendering instinct

with understanding and feeling. His tone is big and

round, and the record is exceptionally good in every

way. (Speed 78)

Published by White Smith Music Co., Boston

r©©© ,

The finest military band in the
world renders Fidelio overture

THE BAND OF H.M.
COLDSTREAM GUARDS

(Conducted by
Lieut. Dr. J. Mackenzie Rogan, M.V.O.)

12-inch Records, 5s. 6d.
Fidelio- OvertureBeethoven

C. 311 Published by Chappell &' Co.

Le Dieu et la
Bayadere -OvertureA

uber
l Published by Boosey &' Co.

only

was pro-
BEETHOVEN'Sopera,"
Fidelio,"

duced in Vienna in 1805.

The composer was then 35-

he had ný_la~v--ed a-t a coa-n_t c--et'w'r-t-elveat
-ý-e -__ of eight, ýd
age

Lieut. Mackenzie Rogan `V "O `'" "J1 "A `'"""
(S.,d,rBa br fMh,British Am pay 1).
Opera Orchestra (without

-v)

Beethoven, after the celebrated picture of Balestrikri

His influence on the art of music was

greater than that of any other m" uFsiidceilaion. " is
The majestic overture to

pompously and proudly performed by the
Coldstreamers, who, under Mackenzie

Rogan's magic baton, excel themselves.
Coupled with this is a spirited Auber
overture. (Speed 79)

C. 310 f Fugue in G Gminmoirnor... ...
Fantasia in
...

TWOBach classics magnificently inter-
preted. It is obvious to all hearers
that our celebrated band can boast of
every man being an artist, for the present
playing. The
pieces are models of classical (Speed 78)
recording is beyond praise.

Bach jV-111VL1 i%VVVL"N1 VqI V{L.

B. 204 Reveil ... Pub.l.is"hed by. .M. ahillon""" Co".".." Hubner
Twilight Dreams Thurban

Published by Boosey &j Co.

A COUPLE of happy band-pieces played with
fine tone and febieenlainuwgty.h. ich"(SRthpeeeveedilCo"7ld9sh)taresarnmerasn' y

happy passages
a thing of
ensemble is

aßHn0 mmoToy"o v©©© fl9

METROPOLITAN ORCHESTRA

(Conducted by Mr. Dan Godfrey)

12-inch Record, 5s. 6d.

f "Suite Algerienne" March ... Saint-Satins
Grieg
Published by Durand, Paris

C. 309Homage March "Sigurd Jorsalfar"
(Op.
56) ..b.y Peters,... Leipzi;-...

Published

T HE attack, phrasing, understanding and finished
execution of this fine orchestra under Mr. Dan
Godfrey are something to admire. The two

marches, so different in composition, are delivered

with splendid elan. (Speed 79)

MAYFAIR ORCHESTRA

(Conducted by Mr. James Sale)

12-inch Record, Ss. 6d.

Incidental Music "Monsieur Beaucaire "
-Part
I ... No. ... Rosse, arr. by Bucalossi
Incidental
1 Intermezzo
-Part
No. 2 Leit Motif

Music " Monsieur Beaucaire "

2 ... ... Rosse, arr. by Bucalossi
No. 3 Gavotte

No. 5 Music of the Love
No. 6 March Theme

Published by Hawkcs & Son

The Duel Scene from "Monsieur Beaucaire," with Mr. Lewis
Waller

THEremarkably pretty and interesting music
written for Lewis Waller's great costume-play
some years ago makes splendid material for a
record, and the performance of the Intermezzo,
Gavotte and March theme are perfect in their way.
(Speed 78)

VVOOýýCý99 ý

MAYFAIR DANCE ORCHESTRA

12-inch Records, 5s. 6d.

C. 308 Aisha One-StepPublishe.d"" by Fel.d..man -S.r.'.Co. ... Lindsay

LThe Parisienne Glide ...Day S'...Hunter von Tilzer

Published by Francis,

A ISHA has haunted the seaside resorts right

through the fine months : it will long remain a

favourite, as it has every essential of quick-

reaching and lasting popularity. Play it but twice and

you'll have started humming. The companion title,

self-explanatory, is charmingly played. (Speed 78)

C Smiles then Kisses ... ... ... Ancliffe

lvliglity like a Kose waltz Churc.h.. Co.

Published byJohn

NCLIFFE'S little gem is given with a swing and M

A a lilt and a dash. The popular song, Mighty
"like a Rose," makes a first-class orchestral

piece. The Mayfair Dance Orchestra excel them.
selves in this double-sided record. (Speed 78)

12-inch Double-eided Record, 5s. 6d. """ Ponce
Chispa Tango PwblisAsd by Max""Bsdkip, Pan , ... Ponce
Ma bonnie bear One-Step
ArblisAed by Max"."Bschi.l.," Paris...

OUR October Supplementary Issue of Records included

many numbers of exceptional merit by artists of

world renown. We reprint this list for convenience sake.

CELEBRITY

12-inch Record (Buff Label), 16s. 6d.

02472 Ave Maria (" Hail Mary ") Caruso and Elman
(Percy B. Kahn)

12-inch Records, 12s. 6d.

2-053088 Aria-Rendi'l sereno al GiMglaioda(m"eSosaCrmlaera" )
(Handel) Butt

022223 "Boris Godounov "-Finale, Part 11,
2-053087 Death of Boris (with Chorus) Chaliapine

Grande Valse (Op. 10) (Venzano)Madame
Tetrazzini

ORCHESTRAL

12-inch Records, 5s. 6d.

0834 " L'Arlesienne Suite "---Farandole
(Bizet-Ronald) New Symphony Orchestra
(Conducted by Landon Ronald)

uuý0841 "L'Africaine°-Marche Indienne
ý'-
(Meyerbeer) New Symphony Orchestra

(Conducted by Landon Ronald)

BALLADS

12-inch Record (Violet Label), 6s. 6d.
02482 Come into the garden, Maud

10-inch Records (Violet Label), 4s. 6d.

4-2373 A little love, a little kiss (Un peu d'amour) (Lao Silesu)
Mr. John McCormack

Red, red rose (Cottenet) Miss Alma Gluck

12-inch Records, 5s. 6d.

02483 The Anchor's Weighed Mr. John Harrison
03341 The Reaper and the Flowers Madame Edna Thornton
03342 Eleanore
Miss Ruby Helder

02486 Bashful Tom Mr. Harry Dearth

10-inch Records, 3s. 6d.

4-2376 Richard of Taunton Deane Mr. Charles Tree
4-2377 Your Smile Mr. Thorpe Bates

OPERATIC

12-inch Record, 5e. 6d. Grand Opera Company
04562 Gems from "Faust"

INSTRUMENTALPIANO

5573 Etude--A 10-inch Record. 3s. 6d.
major (Poldini) Mr. Mark Hambourg

07876 Valse 'CELLO 5s. 6d.
12-inch Record, Mr. W. H. Squire
Apache

VIOLIN

12-inch Record, 5s. 6d.

((a) Moment Musical (Schubert,I Miss
07973 Marie
Giguarer. by Jluer) I Hall
(b) (`De 4ngelis)
,

HUMOROUS

12-inch Records, 5s. 6d.

04108 You'reHulmloy, Baby (Hippodrome Revue,
Ragtime ! ")
02487 Lew Hearn and Bonita
02488
03343 The Barrister George Robey

The Portobello Lass Harry Lauder

You made me love you Miss Grace la Rue

12-inch Records, 5s. 6d.

Under my darling's window-Valse Mayfair Orchestraood)
C. 303 Sleeping Water-Valse (CondMu(cCtaeoydnadiurbctybeydArEthliurHuWdson)

C. 304{HTeahret to Heart-Bridal Valse } Mayfair Orchestra
Butterflies' Ball (Air de Ballet)

10-inch Records, 3s. 6d.

B. 200 { Swing Away March 1 The Band oLf iHeu.tM. . Coldstream Guards
Our irector March J (Conducted by Dr. J. Mackenzie-Rogan)

B. 201 My Lady Gracious- (ConTdhuectedBandbyofLiHeu.tM. . Coldstream Guards
Intermezzo Dr. J. Mackenzie-Rogan)

Little Gadabout

(Dream(s"Chauofffethuer Flowers-Waltz 1
In's Metropol")
189 I Palais de Danse Orchestra
Shall we re("veDrsaes ?-Waltz (Personally conducted by Giorgi Vintilescu)
Autoliebchen')

B. 202 { The Doll (Puppchen)-Waltz }Hungarian Gipsy Orchestra
The Doll (Puppchen)-Two-Step

v©©©9ßßý11 3- H ao T (BED'o

"You made me love you"

used for a diverting political caricature

PALL MALL GAZETTE.

HER. LATEST RAG TIME.

"ý
iýýýý

I
+KaW

.ý14ý.F I

uý rw

" Y mede m ltoovedo7mýtý. } tlýCO t went lo & it. I 'Y06 10wý
I did ýi
:äew.ýt ne,nytouýoknnew tt, ý(uese von ýIweyv iMw PA'KR wt 1ý1 ý bad," et,.,
Y«
And W tAeIt H

ý.ýsILONSOL1üAAON"OF LABOORI

O happier application of a song of the day to
N" Pall situation has been for some
the political that of Reginald Cmleaadveer in the
MyaelalrsGaztheattne
" of October 6th. Men of every

whsfaaahurameamrcndbooo'etluuiunsprglteohfesootnfohptgfweolotihvtqietecoulraesalaeipndsMi,tecortrsu.pwwrienoiRistrohcednor-dseumatmoowMnifbnidlrrg.l.eMlaykiaAs,psspTpqrfhoueGiecsittrtihauatctrheebeedesrtesLlti?uahtucpeataatRrintourtnlaeyr'osef:

0spu3rpo3Bpv4yle3ide, ,sthe1aw2s-ewirnweaceyh,,hguturh5reasise.tsde6drd,ed.c)ooawrdwnreecnfootrrfodmoGuortoafcuoerufnfiasqLctuotaeocrkieRfasau.ssec'isnfaatIsitt(oNhnao.ass.