May 2022

Inside this issue
. New Editor for the Magazine
. Jubilee & Festival update
. Heath Players
. Eden Surgery update
. Jean Foster
. Coffee Morning fund raiser

MAY 2022 YOUR FREE MAGAZINE - CREATED & DISTRIBUTED BY VOLUNTEERS
& PAID FOR THROUGH ADVERTISING
Est 1893 Our website:- http://hatfieldheathvillagemagazine.weebly.com

New Editor has been found and the Hatfield Our new Editor
Heath Magazine can continue.
Having recently moved back into the area, I am delighted
Thank you to those who came forward and offered
their services. I was also pleased that so many to become the new editor for the Hatfield Heath Village
people showed genuine concern that the Magazine
might be coming to an end and how much they Magazine. Mary has kindly offered ongoing support as I
enjoy having it.
learn the ropes and I am looking forward to becoming
This will be my last issue after 6 years. It seems to
have flown by, though I remember the early days more involved with this fantastic local community.
when I was sinking rather than swimming with the
technology of publishing! When I moved here last December, I found the magazine

Fortunately for Dawn Cox, our new editor, there invaluable as a source of information and I am now
are volunteers who she can call on if needed and
I will hope to contribute articles occasionally. looking forward to attending some of the many clubs and

I would like to use this opportunity to say a very activities on offer - it is just hard to choose which ones!
big thank you to Norman Groves for his very
efficient handling of the advertising and finance, to Dawn Cox
Michael Hockley for managing the distribution and
all the additional volunteers who drop the bags of Honorary Treasurer needed for the
mags off around the village and do the door to door Hatfield Heath Village Hall Trust
deliveries. Thanks also to Mark Ratcliff who
manages the Magazine website and gets it onto the This is a voluntary job that is an integral part of the
Village Facebook page. Finally to Jean Clarke who Village Hall Trust management team. The Trust manages
gathers us up for the AGMs and to Brendan Carrig two premises: the Village Hall and the Institute. In
for hosting the meetings and providing tea and addition to being a key member of the management team
jointly responsible for day to day running of the Village
cake! Hall and Institute, the Treasurer is responsible for
bookkeeping, initiating payment against authorised
My proudest moment invoices and expenses, analyses of receipts and payments
as Editor of the for preparing summary reports to the quarterly
Hatfield Village management committee meetings and collating data for
Magazine was when I the external Independent Examination provider at year
was interviewed along end.
with Mark on BBC The candidate should be IT literate and proficient with e-
Radio Essex in April mail, word processing and spreadsheets. Training for the
2019 about life in role of Treasurer is available and there will be a period of
Hatfield Heath. It was overlap.
slightly harrowing as
it went out live! The Village Hall Trust is a charity registered with the
Charity Commission.

If you want more information contact Mel Sullivan
[email protected] and if you are

interested in undertaking this important and fulfilling
community role please contact Hilary Allen
[email protected]

For Articles: [email protected] For Adverts: [email protected] Phone contacts p13

Blinds ad Local Handyman

Painting & Decorating. Fencing ,
Hedge cutting, Lawn mowing,
Gardening
Jet washing
General property maintenance
and odd jobs,
No job too big or too small.
Fast, reliable, domestic service,
Working the surrounding area.

CALL PATRICK on 07860638163
Or EMAIL – [email protected]

ANDREW SANFORD
BRICKWBrOickwRorKks

• BRICKWORK
• REPAIRS
• REPOINTING
• SLAB LAYING
• CONCRETE WORK
• BASE LAYING
• PATIOS
• FENCE WORK

ALL GENERAL BUILDING
WORK UNDERTAKEN

01279 833046 • 07974 842126
[email protected]

Polite, friendly service with over 35 years experience

22

BISHOP’S STORTFORD & DISTRICT TALKING NEWSPAPER

This article is a plea for help, and you may be able to provide it.

We are trying to recruit more listeners for our service. The Talking Newspaper is a weekly recording of local
news taken from the Bishop’s Stortford Independent and the Dunmow Broadcast. It is a free service, including
postage and all necessary equipment, for anyone who is visually impaired or who cannot manage a newspaper
because of some physical disability. The recording comes on a USB stick and we normally provide listeners
with a special player for the purpose.

The restrictions placed on all of us over the past two years have highlighted the problems of social isolation.
We know from our existing listeners how much they have appreciated the Talking Newspaper in keeping them
in touch with local news brought to them by local voices. We are sure that there are many others who would
feel the same if they were aware of it. These same restrictions have, however, made it much more difficult for
us to identify new listeners, so please give serious thought as to whether you know anyone who might benefit.
The Talking Newspaper is also available via a Listen Online facility on our website:
www.bstalkingnewspaper.co.uk

The website option can be used by anyone, whether visually impaired or not. It is also possible to access the
recordings via links such as Alexa or an app on your smartphone. If that appeals, please contact us and one of
our technicians would be able to provide assistance if required.

For more information or with suggestions about possible new listeners please ring Richard Barnett 01279
651270 or leave a message on our mobile: 07918 296764.
Maybe you’d like to volunteer? If so we’d like to hear from you. It’s very rewarding and not too time-
consuming!

Heal Yourself

Heal yourself with the light of the sun and the rays
of the moon. With the sound of the river and the
waterfall. With the swaying of the sea and the
fluttering of birds.

Heal yourself with mint, neem and eucalyptus.
Sweeten with lavender, rosemary and chamomile.
Hug yourself with the cocoa bean and a hint of
cinnamon. Put love in tea instead of sugar and drink
it looking at the stars.

Heal yourself with the kisses that the wind gives you
and the hugs of the rain. Stand strong with your bare
feet on the ground and with everything that comes
from it.

Be smarter every day by listening to your intuition,
looking at the world with your forehead. Jump,
dance, sing, so that you live happier. Heal yourself
with beautiful love and always remember:

YOU are the MEDICINE

By Maria Sabina, Mexican Healer & poet

Sent in by Kim Butler

33

STUMP GRINDER

Mowtivated Podiatrist – Nicola Pieropan

BSc 1st Hons - Podiatric Medicine

Foot Care Services on the Heath
NHS Experienced & HCPC Registered

Call 07498 947545

[email protected]
Compassionate & Patient Centred

AERIALS

Dear Readers
Please ensure that any items for the magazine, whether adverts, photographs, articles or notices, are

submitted at the latest by the 14th of the month preceding the next publication.

Thank you, Editor

44

HOLY TRINITY CHURCH HHPC Parish Council Forum

SUNDAY SERVICES IN MAY Dear all,
Thanks to those who attended our March
1 May at 10.30am - We are invited by the URC to attend Forum. We will by the time you have read
this followed up on all of your issues at our
their anniversary service - see information under URC. PC meeting and you will see that reflected in
the minutes and KTM which we will keep
8 May at 10.30 am Matins updated on the website.
Our next forum will be on May 14th 2022 from
8 May at 6.30pm Evensong 1000 to 1200 in the Institute.
Please join us to discuss your issues in full.
22 May at 10.30am Holy Communion As a guide you will as usual find the latest
minutes of the Parish Council meeting plus
SIX VILLAGES ZOOM SERVICES EACH SUNDAY the Key Task Monitor on the village website
AT 11.30AM so you can see what progress we are making
prior to the meeting.
You are very welcome to attend our Zoom service each Nigel Robley
Sunday. For log-in details please email Cllr, HHPC
[email protected]
United Reform Church
Diary May 2022

Sunday May 1st - Church 350 years anniversary
and 50th anniversary of Scottish Presbyterian. The
Hatfield Heath Congregational Church becoming
the United Reformed Church. 10.30 am
Communion. Service led by Rev. Janet Nicholls –
Agricultural Chaplain for Chelmsford. Planting of
a tree to celebrate our anniversary and the Queen’s
Jubilee.

Wednesday May 4th Leisure Hour 1.45 pm AGM
followed by a speaker

Sunday May 8th Family Service 10.30 am Rev
Blair

Sunday May 15th Family Service 10.30 am
Elizabeth Stockdale

Sunday May 22nd Family Service 10.30 am John
Biscoff

Sunday May 29th Family Service 10.30 am Rev
Blair

Leisure Hour see page 27

Weekend garden waste lorry service Library Van
Sundays 13:30 - 14:30
A library van comes to the village every 3 weeks,
Week 1 following a GREEN- lidded bin collection in from 12.00- 12.30, parking in Broomfields.
Broomfields.
The driver is extremely helpful, and if the book
Week 2 - following a BLACK -lidded bin collection in you'd like isn't on board, (obviously he's limited
Ardley Crescent . as to how many books he can bring) then he can
order it for you.
If you live on the Hallingbury Rd there is also
the lorry at Little Hallingbury car park Next visits 4th & 25 th May, 15th June,
Sundays 11.45 - 12:45 6 th & 27 th July.

55

Heath Computers SAVOURSue Burgess
For all your IT needs
Welcome to my treatment room at Samantha’s Beauty
Whether you run a business, or are a home user,
Heath Computers has an IT solution to suit your requirements. EVERY MOMENTRetreat. I am an ITEC qualified therapist with 15yrs +

 IT Solutions for home/office experience in beauty and holistic relaxation techniques. I
 Domain Registration and Web Design am fully insured with The Beauty Guild.
 Mac/PC Support, Repairs and Upgrades I believe it is important to treat yourself and your body.
 Smart Phone/Tablet configuration and setup Your body needs to heal itself of stress, aches, pains and
 Network Installation - Fixed and Wireless trauma. Your mind needs time to relax, unwind and repair.
 Internet - Email - Broadband B' usy lifestyles, over thinking, work and caring for others
Virus Protection and Spyware removal can result in feeling stressed, tired and exhausted. This
will show in your posture, your skin and your nails.
Web: www.heathcomputers.co.uk Office: 01279 912345 So whether it’s a relaxing massage, deep tissue massage or
Email: [email protected] Mobile: 07958 482889 a glycolic facial peel that you need.. Here at Samantha’s
we will take our time to help you be YOU again .
Grass Cutting, Hedge Trimming,
Planting, Spend time on yourself…..

OnTheisospffacTeiids y1/1U2tph s …...You deserve it!
ReguSlahorluyldWyoueweaknltytoMadavienrttiseen, ance
please email: [email protected] *Hydrafuse facial
*Glycolic Puramed facial *BYAS lifting facial
Patio Cleaning Wi*tAh rooumradtheelircaipoyusfafcrioazlen*Mmiecarolsdaernmdadberasssioenrts,
*Syloimu’mveinmg oderetotximweratpose*nGjo5y atnhtei-tcheilnluglsiteyotruealotmveen. t
Email: [email protected] For *yCouArCfrIeterebatrmocenhtusre *vSisiietnwnialtsXhsirperfaayrmtafnoods.com

Mobile 07956 524 586 or call 0137*L1V8L7l6as9h7es0 *Waxing
Home Tel 01279 830 960
*Deep tissue massage *Aromatherapy massage
*IPL hair removal *Appilsonix– stubborn grey/fair facial

OVER 300 DELICIOUShDaiISrHreEmS oval.
PleaFsReEcEoFnRtIEaNcDt LSYuDeELBIVuErRgYess on 07740433417 or 01279-

7T3R1U5S0T3EDfoLrOmCAoLrSeEiRnVfIoCrEmation/prices/availability.

GORDON EASTLAKE Attention to
BUILDHINEGACTOHNTRHAACTYORASNDDSetTaiRl AAssWured

TraditioonAnoalllrdtsyemprseaslolofbf5aB0leusbi,ladflirenesgeoWlromcoaroklrdee. livery
EveniPnegri&odwReeesktoernadtiodnelWivoerrkieas Suspueacilalylitpyossible.

TradTiteiol n0a7l9O7a6k80F1ra0m62ing

Michael HoAclkllAeys,pFecrtisarosfFJoairnme,ryHatfield Heath

07779 790975 01245 230926
www.heathhayandstraw.co.uk

High Easter Based

TNHEEEHDUANWTERINSDMOEWETCRLEESATNURERA?NT

01279 730549 CWAWBWAH.RHiEgUhTNSrTeEFaRRcSOhMwMEEinT1d.C2oO-w4.sUpKm HALF DAY SPA DAYS! £58pp
Pick 2 out of our treatments
AFTERNOON below
Mouth-watering 2Cconosuerrsveatsoraynddeeypoculeran Manicure,
entertainment juFsats£c2ia0anPdegruPteterrscolena.n

WednesdayBu2i2ldnidngMclaearcnh(cladding, pvc)

WednesdaSyign2a6gteh April Pedicure,

WednesdaShyo2p4frthonMtsay Swedish back,
WINDOW CLEANINDG-Day Cabarets Indian head Massage

5th 6th and 8th June David Deacon Or express facial.

19 wwDwo.ndd’tpFroopregretytcaOreu@r Nliveew.col.uunkch timTe: m01e27n9u4/3L6ig19h6t Make a day out of it…you can make full use of the
www.ddpropertycare.co.ukBites M: 07403443959 spa facilities, pool, sauna, steam room and
Lunch is served Tuesday – Friday 12pm-2pm Jacuzzi and even add lunch for £10pp.

66 Chesnut Drive Hatfield Heath

Hatfield Regis Local History Society
President: William Gosling - Lord of the Manor

AGM and Memories of Hatfield Heath Chat.

Our March AGM covered the years activities, re-election of the Chairman & Committee and overview of the
new seasons program of 6 meetings and an outing. With the annual subscription kept at the Covid reduced
rate of £5 for the year, this is a bargain! Contact David Parish to join (07483 276543) with full details on our
web page. All official business was completed within 15 minutes allowing plenty of time for the ‘Memories
of Hatfield Heath’ conversation with four villagers. The speakers had all grown up in the village in the 40’s
and 50’s and have happy memories of events and people.

Robin Whitbread was the senior boy, having arrived in the village in 1937 when aged 2 years, his mother
having taken up the position of District Nurse. They lived in Mill Cottage with a hand pump in the yard for
water, no electricity (so paraffin lamps and candles for lighting) and an outside toilet. During the war, two
ladies worked in the upstairs room making ladies stockings for the armed forces. Robin learnt to play the
cornet in the village band under Gilbert Hutchin and this ability allowed him to join the Welsh Guards band
in 1952 when called up for National Service and he ended up staying for 8 years. His first main parade was
the Coronation.

John Faulkner was born in 1942 in Ilford but the family soon moved to Hatfield Heath and lived at Hockleys
Cottage with 13 others! His father had employments at Browns Bakery as a Roundsman, which enabled the
family to move into the tied cottage adjacent to the Bakery (located between current day The Thatchers
and Broomfield). Ill health meant his father died after a few years and the family had to move out – initially
to Mrs Whitbread (Robins Mother) before getting a council house. His mother worked in Browns Bakery
shop and he remembers they had two Germans working in the bakery post war.

John Brown was also born in 1942 at 26 Ardley Crescent before the family moved into a tied cottage in
Audley End and finally to 1 Bentley Villas, only leaving the village on his marriage in 1964. He was in the
same village school classes as John Faulkner and then on to Stansted School. He remembers helping an
electrician who was wiring up Ardley Crescent for mains electricity and this experience caused him to
become an electrician. For many years he worked for Emery Electricians in Sawbridgeworth.

David Brown is Johns younger brother by 4 years. He grew up playing in the village football and cricket
teams, only moving out of the village in 2000. Village team selections were posted up in the Beehive shop
for 6d per week but those outside the village received a postcard notification. Selection required you lived
in the village, were born here or had married a local girl. He remembered that the Fox Inn as the only pub
with a Juke box.

The memories of village bonfires ‘was sparked’ by recalling the largest ever built was for the end of the
war, with a central air vent that you could walk through. There was intense rivalry between Broomfields
and Ardley Crescent for building the best bonfires post war but eventually they combined before the
Council stopped them in the late 60’s/70’s. Also punishment for being caught collecting conkers in the
Vicarage garden was 4 hours locked up in the Vicarage cellar! With additional contributions from the floor
by John Smith and Andrew Passfield the time soon passed with many more comments than I could catch
(being a newcomer!). A very enjoyable evening.

Our next meeting is on 17th May at 7.30pm at

the Hatfield Heath URC Church Hall when Patrick

Streeter will be talking about Daniel Quare (1648-

1724), a respected London Clockmaker and his

descendant farmers of Matching Green.

Photo: David Brown, John Brown,
Mark Ratcliff (Chair),
Robin Whitbread, John Faulkner.

Quentin Spear

77

De-Rigueur www.de-rigueur.co.uk

Micro-sclerotherapy treatment
Thread vein treatment for legs.
Lynton illumiFacial Treatment
Vascular, Pigmentation, Collagen Remodelling.
Fat Dissolve Mesotherapy Treatment
Cellulite, Stubborn fat, Sagging Skin.
Carboxy Therapy Treatment
Stretch Marks, Dark Circles, Scar Tissue.
Vitamin D, B12 and Biotin injections
07833 300255 / 01279 730791

Please Contact

Mark: 07734 885582 Liam: 07790 482450

8

Jean Foster 28 March 1919-29 March 2022 R.I.P.

Jean passed away in the early hours of yesterday morning. Our thoughts are with Steve, Judith, Abigail, Jessi-
ca and the rest of her family and friends.
Although she has been a resident at the Haven Care Home in recent years due to her declining health, I under-
stand that she joined Steve and Jess in a little sing-song just days before her passing.

I've written before about Jeans legacy to the Players but it truly cannot be overestimated. She kept the group
alive in the 1990s through to 2000 being our only director of eight consecutive full productions.
As well as acting and directing, she was a skilled make-up artist (always present backstage at pantomime
time), acted as secretary for the group and for many years kept our wardrobe of costumes at her house.
Before the Players were formed in 1969, she was active in another local troupe (Group 64 I think?) and was
also involved in village WI theatre productions.

She was not one to suffer fools gladly and many of us (me included) were subject to her withering looks and
comments if our behaviour did not come up to her own exacting standards... :) In general, such disagreements
were soon put behind her as she moved on with the production. Her priority was always to put on the best
show we possibly could-an ethos I hope and believe continues in the Players to this day.

I have many fond personal memories of Jean. She directed me in my first "proper" production (Alan Ayck-
bourn's Bedroom Farce); I remember watching her with buttons on a diagram of the set to help her with plot-
ting moves. She was also a delight to work with when designing sets and the like-she always had a very clear
idea of what she wanted. My first experience of directing was a one act (The Laboratory) in 1998 when Jean
was in the cast and was so helpful to a young man who had little idea at what he was doing!

After she stopped active involvement with the Players she would help out with Front of House duties and pro-
duced many lovely displays for the Foyer. I also spent many happy evenings round her dining table at the play
readings she hosted until just before she moved to Hatfield Haven.

This is just a small snapshot of her work with us. She did so much more in the village, active with the church
and hosting Cream Teas for the Festival are just a couple of examples that spring to mind.

We will not see her like again. Mark Ratcliff

An early portrait

Jean in the role of Mrs Terence in
“Night Must Fall “by Emlyn Williams-

our first production in 1969

With son Steve as Emilia in “The Laboratory” by David
Campton (1998)

99

Thank you to everyone who supports us in any way!!

BEAUTY LODGE

May & June Offer

Two’s Company &

BEACH BAR Afternoon tea
Now £74 per person.
Open from 11am

Looking to secure the school of your choice?7 Days a Week
This includes two pre-
arranged treatments and

afternoon tea.

School Appeals ServiPcLeAsTLTLERP &has 25 years experience of successfully advisinPgoppianrfeonr tas BornocShcuhreooolr
Admission appeals.
PROSECCO check our website!

Catching the Summer
OUTWe have vast experiencVeiboefsdealing with Essex anRdESHTeArUtsRSAcNhTools (both primary and secondary).
CWoenptarocvtiTdrMCeeSahaaSlitelthnsdtgagareaRrrlilinnlaSi’ga,cusCdmhMPvolamaeiccrtaektedeltrs,asrLasaio,lnsopn,dpnge! 0a1l d2r7a9SftniB7nareg3cOa1kapsk1n,fea8SdFnasr0otan7sDm,dfddoCivwn7aoroni:yc3cefasfh0aer!aaecenmsyswo,,L/eDuoerrneibkncpklhriseg,&saetniotantiocnhaatt hearings.

or email
CALL US ON 01279 730549 FORWANeYbFsmUiRtaeTtHt–E@RwIsNwcFOhwoR.MsocAlahTIpoOpoNelOaapRlspV.ceISoaITlmOs.UcRoWmEBSITE WWW.HUNTERSMEET.CO.UK

MEMORIALS

J. Day & Son

Station Road, Bishop’s Stortford

Bishop’s Stortford 01279 654 555 “Wendycot”,Chelmsford Road,
Edmonton 0208 807 3712 Hatfield Heath,

www.jdayandson.co.uk Bishop’S Stortford, Herts
Opening Hours
816016 Dec 2016
190 Mon - Fri 8am - 5.30pm
Sat 9am - 1pm

Tel: 01279 730 274

[email protected]
www.jewhitemotors.co.uk

Children’s Clubs There have been some
changes in the activity
groups so please check
and notify the Editor of
any further alterations

. BubbaCise (parent & child fitness class) 10:45- . Bridge Club Tues 2-5pm & Wed 7:45-
11:30 Wednesdays Contact 07940735773 10:45pm Village Hall723948 Michael Shine
[email protected] . Luncheon Club for senior citizens 730581
.Pre-school - 2-5years 07340 575792 . Open Coffee Morning at the Institute 730288
. School Football Club :- 812586 Tuesdays and Thursdays.
. Junior Cricket - Mark Welby 07717 204828 . Gardening Club 730425
. History Society- Frances Smith 718410
Tues 17:45 Cricket Pitch . Royal British Legion 730042
. Hatfield HeathScouts:- . Bell Ringers 730526
. Holy Trinity Choir 730288
[email protected] . Leisure Hour 730465
. Cubs – Chris Hancock :-731646 . W.I in Broad Oak Sue Brown 718620
. Brownies – in Sheering 734391 . Talking Newspapers 651270 or 653925
. Beavers, Cubs, Scouts,Guides - Little . Heath Players – Mark Ratcliff 503174
. Italian Language – Michelina 07786 341 754
Hallingbury Sally Bentley 658347 . Spanish Language – Ann Whale 731288
. Junior Karate – 01992 575679 V. Hall
. Farmers’Market 07956 563 710
Tel 07803 273 083 . Visiting Optician 443181
. Neighbourhood Watch - Hilary Allen
Sport & Fitness Groups
[email protected]
. Cricket Club – Mark Graves 07999 416424 . Uttlesford Badger Group- Derek Barry

. Football Club – 730212 On call 24/7 503332 or 07941 185 171

. Keep Fit for over 50s Wed 9:30-10:30 V.Hall Websites of Groups, Clubs & Institutions
Georgie 07940 735773
. Eden Surgery – repeat prescriptions etc
. Bootcamp – Village Hall, Mon & Fri (Men
Broomfields www.hatfieldheathsurgery.co.uk
& Women all ages, shapes & sizes)
Broad Oak www.hatfieldbroadoaksurgery.co.uk
07775 663 742 Wed 9:15 Institute
. School www.hatfieldheath.essex.sch.uk
. Bowls – Village Hall - Stan Fish 653715
. H.H Cricket Club – [email protected]
Evening sessions- Jack Sykes
[email protected] . H.H Football Club -
www.facebook.com/hatfieldfc
. Boxercise Tues 7-8pm 07766 963956
+ Crunch & Punch Thurs 7-8pm . Heath Players www.heathplayers.org and

. Seated Exercise - Fridays Village Hall https://www.facebook.com/groups/246923642002

Debbie Mousdale 07904 198309 583/ [email protected]

.Weekly 6 mile+ Walk in L.Hallingbury Mon .BridgeClub
10:00 Meet at L.H Village car park 899451 http://bridgewebs.com/hatfieldheath/

. Bounce Tues 9:15 and 18:30 Village Hall . Parish Council www.hatfieldheath.com
Sundays 9.00am tel. no 07971 299818
. Pilates - Monday Institute 9.30-10.30 . Footpaths Email:
[email protected]
Donna Leutchford tel: 07739012076
Yoga - Mondays in Institute 7:30-8:30 . Hatfield Regis History Society -

Jodie Parker [email protected] hatfieldregislocalhistorysociety.weebly.com

. Sound healing/Gong Bath 1st Sunday each . W.I in Broad Oak www.facebook.com/HBOWI.
month 07977225857 Institute 7pm [email protected]

. Zumba Gold -Thurs 10:00-11:00 Village 1111
Hall Petra Bonich 07884 336614

.Air Training Corps www.aircadets.org

Sawbridgeworth 01279 723517

Fed up with

HHaattffiieelldd HHeeaatthh mossFaendduwpeewdi?th Lawn Treatment Service

Are Available for I ofImfeorof:f-sesr:a- nd weed?
•Re•gRuelagrullaawr nlafweendsfeeds
Children’s Parties •We••WeAdeearenaddtiamonnodssmtroesastmtreenattment
•Ae•rSactiaornifying
Small tableAsreanAdvacihlaabirlse nfoorw available
•ScarifCyinAgLL ANDREWLawnNTreOatmWent SFervOiceR A
ChiClderleebnr’satPioanrsties
FREE LAWN SURVEY
Small tables ianncdlcuhdaiirnsgnow available
CALL AND0R7E7W91N1O2W8 F3O99R A
Wedding Receptions FREEwLwAwW.simNpSlyUlaRwnVs.EcoY.uk

ClCasesleebsreattcio.,nestc., 07791 128 399Approved Chimney Sweep
PWREedFdEiRniEngFcNluORTdRiIenAgcLepRtAioTnEsS
Bluebell Forest School
LOCAL ORGANISATIONS
AND www.simplylawns.co.ukALEX GLYNNS NACS No.95/352
Vacuum, Rods, Brushes,
ForLODCCleaAtsLaseiRlssEeStTcI.De, lEeetNpcT.h,Sone Pre School (2-5 yCealerasn) && HEof lidciaeyntClub (3-10 years)
01PR2EF7ER9EN7TI3AL0RA5TE4S 4
OUTMatchBi1n2glOuETrewmycbdhewaaoeiwVrlnd:li.nllablCaallFeurTg.oxpoeeefgibltkr.l,Heyee0Hnal@1lsfanl2oltr7bs&rl92oetSi4wns4pc22tt,rse6i4Ehvcr@9sanho8sgteoe3eomxto.lsclCa.eociMlcmo.cum2or0em35B6Awood.
FORRegistered Charity No. 268367
LOCAL ORGANISATIONS Pre SIcnhfrooeorgmla(2rad-t5iionyngeaftrrhsoe)m&CKoHroeolmindaai yvBiCarduluesbn((oC3c-O1h0VMyIeDPa-rs)
TRADLITOIOCNSATALELVWRAENEIWNSDDEISODTWE- CNLTESANER
19)
External and Internal window cleaning
Malb“MHbPitIoncieAcdahhklTLkoiaisnnFevw2tsigRDeocIoTAuptawuhyEurYmtdeeewtSoo,tEmwViPonfni.AgonolbltaesauloDuttg.rhupeuAetecibprkYrheHeeStaala@wol!ftlpol£midbatr&5ahetge8it.nsepe.npttrtseoipisnvcrnanfhomteoertomy.scl.eoawctcmoieuombSrnseifEt5reo6tRmhwaoatVolilndtIc.hlCeudveEasritSohues
For Details Telephone● Residential or Commercial wPaSPIndlwewedvadew•ii•scaide.ceknRi-Ffuseaohhrmeenleldledobil,buia-wangacdgucdtthiiekModiHn,snaaoelncisd••nchsgeka.eToPtgrcohreguuia.tnnuctinciknnei/gncsgsogarinto:d••nsaSShvathirupaumipnsi-gpncogRveidm-1o9v-al

● Regular Cleans or Just The One Off!! OMIfrayekoxuepdaroedhsaasvyfeaFoacrnuieayteloin.nfodiiotv…bildyiugoaatluicoconnaqcnueromntsea,skpleeafsuellduosceonotfatcht e
● Conservatory Cleaning mmWJsW paeyacvouiffafazizecTEcimeemialloiat:aninilei0dl0a7:st2,9eA0kp4vA7e0oemT2on21ir3l.e9,ab1esad1sa9d9ed6ue4r4vnnl3uioacnce,chossr.h@tmefopao0u@mr1tl£2por17aoo09rkopl.7imcap3om.0mae6nn5dt9.uk or call

01279 730 544FOR A FREE ESTIMATE CALL STEVE
Re0gi7st7er8e5d C3ha9r6ity70N0o. 268367

STEVE WEST - TREE SERVICES
TRADITIONAL WINDOW CLEANER
• RFeedlluincgtioHned••geTPchruuitnntininnignggand•• Shaping
External and Internal window cleaning • Stump Removal
● Residential or Commercial
● Regular Cleans or Just The One Off!! shaping
● Conservatory Cleaning
Free no obligation quotes
FOR A FREE ESTIMATE CALL STEVE
07785 396700 Tel: 07940 231 964 or 01279 730 659
Email: [email protected]

WW

1121

NEXT PARISH COUNCIL MEETING HHPC Parish Council Forum
Saturday 14th MAY
Wednesday 4th MAY 7.30pm 10am to 12 noon
At the URC Hall
in the Village Institute
PARISH COUNCIL CONTACTS

Parish Clerk :Richard Bowran Village Facebook Group created for residents of
E mail: .…[email protected] Hatfield Heath to share information and events within

Mark Bissell - Chairman ……………07966 154 401 the community. www.facebook.com/groups

Mark Lemon - Vice Chairman/District Councillor Alternatively search Facebook for Hatfield Heath
730581 The Village Group.

Sandra Saban………………………………… 730042 Please send any items of local interest to the Editor
Nigel Robley………………………………… 730568 by the 14th of the month.
Chris Overton...……………………………… 731036
Peter Brown...………………………………… 730859 If you send them well before that date you are
Roger Breavington…………………………… 730068 more likely to get your item included!
Sam King…………..…………..…730241 / 07984 401170
Niki Champion ………………..731104 / 07967 322053 As well as the paper version you can access the
magazine and previous copies on the website
PHONE NUMBERS www.hatfieldheathvillagemagazine.weebly.com
POLICE, DOCTORS, SAMARITANS Send your letters /articles/ reports /photographs by
Email :- [email protected]
SCHOOL & CHURCHES For advertising, email - [email protected]

PCSO Steve Sharma
Email: [email protected]
Essex Police Non Emergency 101, Emergency 999

DOCTORS Broomfields 01279 730 616
DOCTOR Broad Oak 01279 718 245
DOCTOR Sawbridgeworth 01279 603 180
THE SAMARITANS 01920 464 099

HATFIELD HEATH C.P. SCHOOL 01279 730 382

PRE-SCHOOL 07340 575 792 Telephone Contact Numbers

HOLY TRINITY 01279 730 288 Editor : -Dawn Cox 07505 506 716
Vicarage Office
01279 730 244 Treasurer and Advertising Manager:-
CHURCHWARDENS 01279 730 611
Catherine Hockley 07913 476934 Norman Groves 01279 730756
Diana Graves 01279 508 455
Secretary: - Jean Clarke 01279 730667
URC Rev Blair Kirkby-
URC Secretary - Betty Bennett Distributor- Michael Hockley 07976 801 062

Chairman - Brendan Carrig 01279 730 549

Printed by Panther Print 020 8592 1166

MOBILE LIBRARY Visits every 3rd week on a Please note that the Hatfield Heath Magazine is a
non profit organisation and everyone involved in
its production works on a voluntary basis.

Wednesday see page 5 for dates DISCLAIMER: The Editor and Printers do not
take responsibility for the information given or
Arrives Leaves views expressed in the Hatfield Heath Village
Broomfields 12:00 Magazine. Nor is any culpability accepted in
12:30 work carried out by any of the advertisers.

[No other stops in Hatfield Heath] 1133

To advertise in the magazine call Norman on Luxury Toilet Hire (UK) Ltd
01279 730756 or email
Whatever your special occasion, let
[email protected] Luxury Toilet Hire (UK) Ltd provide you
To send in an article or photo email with the perfect toilet facility to make

[email protected] your occasion a memorable success.

Your local service provider for all
liquid waste removal, including
Cesspools, Septic Tanks,
Klargesters and Bio Discs

Tel: 01279 504638 or 01371 873003
Email: [email protected]

ZOE PURDY’S PERSONAL TRAINING
PRIVATE STUDIO

Fully equipped private personal training ü Fat loss and/or muscle gain
studio in the Little Hallingbury countryside. ü Increased strength and mobility
ü Nutritional guidance
Perfect for those who need help reaching ü Variety of strength and conditioning
their fitness goals but don’t want to enter
a busy gym. workouts
ü Personalised training programme,

based on your goals
ü Suitable for all abilities

What are you waiting for?
Email me to book your FREE consultation!

[email protected]

zoepurdypt.co.uk @Z P T H E P T

14

InnInneerrHeaHlth eadalth www.uttlesfordfrontline.org.uk/

FOOD INTOLERANCE TESTING B SUSINESS UPPORT with Rob Sandys

TERESA POWELL • HR SupporAt dmin Tank

Tel: 07961 544534 • SSIP Accreditation CHAS/Construction
Email: [email protected] Line/Safe Contractor

~ Safe & non invasive ~ • H&S Support
• QUALITY & ENVIRONMENTAL
NEW TAPAS MENU – EAT IN OR TAKEAWAY
Support, Procedures, Systems, all meet
AVAILABLE FROM TUESDAY 19TH APRIL 2022 ISO British Standards
• WEBSITE Legal Policies
Pickled Pantry • COMMERCIAL PROPERTY Leases,
Deeds and Contracts.

www.theadmintank.co.uk

T: 01279-731701
M: 07507-493680
E: [email protected]
Call Rob for a friendly no
obligation chat.

15
15

01279 882 822 HUTLEY ELECTRICAL LTD

For over 30 years we have been DOMESTIC & INDUSTRIAL
carrying out local, national and ELECTRICAL CONTRACTORS
overseas relocations for personal
and business clients. We Hutley Electrical offers a full
understand that everyone's move is range of Electrical Services and
different and that is why we tailor has been established for over 20
our service to each individual years.
customers needs. From House re-wires to Industrial/
Kings Removals was set up as and still CoWmoomd eoorricngi,awlorktoppsr, soupjpelyc, ttsting awnd erenovpatironide
runs as a family business today. Great emphasis is put on customer ourselves on offering a competent,
satisfaction and this is why a high percentage of our work comes from polite, tidy professional service
recommendations and repeat business. and endeavour to work with the
minimum of disruption
www.kingsremovals.co.uk to you wherever possible.

Call Bob now for a free quotDaetcikoinng
TGEarLde:n F0ur1ni2tu7re9 722 351 or Decking

aMndOreBwILbaEn:k0s.7c7o7.u4k94- 101626789 626389

1165

THE MOBILE POST OFFICE IS UP AND RUNNING Jubilee Celebrations poster
AND WILL BE ON SITE IN THE
VILLAGE HALL CAR PARK Hatfield Heath Jubilee
10-11 AM EVERY FRIDAY
Celebrations 2022
Car parking on site and easy access
Thursday 2nd June 2022
6 – 10pm Hunters Meet Music and Entertainment with BBQ
10pm The Heath for the Lighting of the Beacon

Greenways Hatfield Heath are looking for an Friday 3rd June 2022
egg packer. URC Hall History Society Exhibition
Holy Trinity Flower Festival
Part time weekly 16 hours or full time up to 40
hours Saturday 4th June 2022
URC Hall History Society Exhibition plus
Please contact Simon 01279 730615 Art and Photography Exhibition with Jewellery and Craft Stall
Holy Trinity Flower Festival

Reliable gardener required to do general Sunday 5th June 2022
maintenance and upkeep of garden in The Heath Village Festival with Classic Car Show,
Hatfield Heath. Arena Events, Music and Fun Fair
URC Hall Art and Photography Exhibition with
Please contact 01279 730 539 Jewellery and Craft Stall in URC
Holy Trinity Flower Festival

1177

FREE Carpets 2 U
TASTER
SESSION ➢ Carpets & floorcoverings.
➢ Supplied and installed.
JOIN ME TODAY ➢ No hyped-up sales

Find out More on: FITNESS SERVICES We sell the best for your budget!
www.thefitnessbutler.com ➢ Wood, Vinyl, LVT, Karndean
➢ Samples brought to you.
1-2-1 Training Group Training ➢ Uplift and dispose.
Cardio Training
Weight Training Tailored Workout All your old rubbish removed!
Diet Help Plans
Boxing Training HIIT Training For more info call Steve on
Muscle Toning 07939 739845

www.thefitnessbutler.com Call Me Now:
07766963956 07766 963956
jack@thefitnessbutler.com
Hatfield Heath
based Personal Trainer

Train at home or at
Hatfield Heath

OUT

HOWE GREEN
HOUSE SCHOOL

Independent Co-ed Prep School
for 4 to 11 years
and

Little Oaks Nursery School
for 2 to 4 years

www.howegreenhouseschool.co.uk
01279 657706

18

SSaavvee tthhee ddaattee!! TTuueessddaayymmssooaarrnnnnddiinnTTggsshhuurrssddaayy
1C1C00hhaaaammrriitt--yynnooccoooonnffff..eeee mmoorrnniinngg oonn FFrriiddaayy 2200tthh MMaayy 1100 aamm ttoo 1122 nnoooonn
££55 ffoorr aa ccuuppppaa aanndd aa sslliiccee ooff ccaakkee!!
CCFFrrMMiiaa22rr22ssww77BBooooEEdd,, FFrriiaarrss LLaannee,, HHaattffiieelldd HHeeaatthh EEvveerryyoonnee iiss wweellccoommee
rTTraaeeffaaffll,,eeccppoorrffiiffzzeeeeeess,, aaoonnwwooooffnnffddeerree!!rrffuull sspprreeaadd ooff ccaakkeess aanndd IInn tthhee IInnssttiittuuttee
AAllll pprroocceeeeddss ggoo ttoowwaarrddss LLeeuukkaaeemmiiaa CCaarree..
pwhChwCplleeooooeerrmmuuaaeellss..eeddeeLLaallooggiillkkooooeeeennkktt ggttiiffoonnoo,, bbrrddttwwoorrooiiuuaannnnccrrggaaddhhttaaeettJJooffaaeerrnnssiicceeeennaanneeyykkddiieenn((00ooggoo77rrrryy44mmoorr66aa99eeuuff44eeffttll00tthhee88aaeepp11nnnnrr22..iiee77zzIIwwff))ee..yy,,oooonnuuee WWhhyy nnoott ccoommee iinn ffoorr
CCooffffeeee aanndd aa CChhaatt??

EEddeenn SSuurrggeerriieess
SfStbtbfauaurriirrrrnniinnnnccrrggeeeeaassaarrjjccooootthhoouuiinniinnnnooiiddnngguuggrrppeepprrttffhheeffaaeeeessttcciicceePPttrrssnnrriippaattoossttccffii,,oottttiittnncchhhheesseeee IIiiPPccnnhhooaaaaaannmmvvddttppeeiieemmllmmeebbeexxeeiilliicceeyytt))iinneemmmmssvvaaeeeebbnnaarreeyynnnnhheeaaiittrrnnhhww..ddaaWWaattrrrrhheettuuhhiinnttlleesshhnnrrttaaiieennffttuuhhggoollaalluuaayyssrrddaabbddiippeessiissppeepppprrnneeeeeennccnnnnssiioossaaaaaattrrqqiirryynnuuyygg((iicchhppttkkaaaahhssrrffeettiiiixxbbccff..rreeuuuueellssaannttrrrrllssaayyttttrriiiiuunnooggnnllggiiggttllhhiihhnnaattggttoottttffhhoottiihhssee
nwnwHHeeooooxxrrwwttkkffiieenneevvggwweerrppww,,rrtteeoohheecceekkeessccsshhssaaaaeessnnssooggbbuueeeerrssddnnttiihheennwwaa..tt ddwwiisseepphheeaannvvsseeaabbrryyeeeemmnnaaiinnmmaappgglleeeemmmmeeeennnnttttiittnneeggaammrreebbcceeeennccoottllmmyy wweessiilllleessssttttaaaarrbbttlliittssoohhtteeaaddkkeeaannaaddffffeenncceettwwoovveerr tthhee
bbOOuuuussrriinnooeebbssjjsseeccaattlliillvvddeeaaiiyyss..ttoo ddeelliivveerr aa 7722 hhoouurr ttuurrnnaarroouunndd sseerrvviiccee,, MMoonn --FFrrii,, wwiitthh tthhee ddiissppeennssaarryy ooppeenn ffoorr
pvpauauvIIttdeednonorrmmddststyyiirrssllaaeeiihhttyybbhhssiillggsseetteeaahhiiyynnkkppttrrggeeaaeeaattssttttuuiihheeeettsseennnnooaatteeiiffssssggwwCCsseeaaoohhuurrttvviivveeiillvveeiiiissddcceetteeaa))rroo....nneeBBddaallaauucctttttthhhheeIIiiddaaeewwttvvwweeaaeeoovvnnttrreetthhkkeerriiyyddssaaoobbttggnnoossooeeeessaannaahhll,,ccttaaeeeeEErrsseessddppeett((eehhNNnncciiHHssiiSSaaSSmmuullllrrwwyyeeggssooaaeessrrssrrkkaaiieetteegghhssrreeeessiisswwPPaaiirrffrrttooaaeehhccccssyyuuttttiioosscciilluulleeeeeeddccttxxooooooppnnnnddeetteeccddiinnmmtteeeeuullooddiieevvnnsstteessoorrttttiioorrssnnaattggssttaaeeuuyyttffhhttffaahheeeettaarrbbhhttffeerroowwoossmmeemmtt eeaaaarree
ttTThhhheeaaccnnhhkkaayynnoogguueessffoobbrreeyyiinnoogguurrmmppaaaaddttiieeee..nnccee,, aanndd II hhooppPP0ee1eett2tthhee7aarr9ttEEoo7ll3vvdd0eeoo6rrnn1tthh--6PPee(rrHaaccccaootttmmiifccieeeiinnldMMggHaawwenneeaaaeetgghkkee)ssrr/yy7EEoo1dduu8ee2nnww4iiSS5lllluu(ssrrHggeeaeeeetrrfiittieeehhssleed bb00B11eero22nna77eed99ffiittOssaookff)

AAllll iinnffoorrmmaattiioonn oonn tthhMMee aaddrriiccffHHffhheeAArriisseeTTssnnuuttSSFFeeccPPIIllooEEOOaannssLLNNssttDDeehhSSsseeOOHHoowwRRffEEeevvSSEEAAbbeeUUssDDTThhiiNNiittHHcceeBBDDllhheeYYFFAAssaaEEttJJaaYYffSS..nniiEEeeTTdd55ll..ddTTIIaaWWhhHHVVwweeAAJJHHaaaaUUrrttLLIIhhddNNTTvvssCCiiEEEEiillssLLllaaMM22iiAAggnn00eeSSOO22ttmmhhSS22TTeeIIaaCCOOggMMaaRRCCzzaaiiSSrrAAnncceeLLhhRR@@TTeeSSddwwDDHHiitteeiiOOeeoobbnnWWllyyoo..ffccootthhmmee MMaaggaazziinnee aanndd oonn tthhee
EEnnttrriieess bbyy 2277tthh MMAAYY

SSAARRAAHH WWHHIITTEE,, WWEENNHHDDEEYYRRTTTTCCOOSSOO..TTEECC,,NNMMCCSSHH22UU22EERR77LLEEBBMMTTHHIISSNNEE..FFLLCCIIOONN..LLNNRRCCUUDDOOLLSSUU..IIRROO00DDOO11NNII22AANN77IIDDNNGG99,,77TTAAHH33HHNN00AAEE22TTSS77EEFF..44AAIIVV..EE..EEEELL..NNDDIITTFFHHPPccEEOOooAAnnSSTTttSSaaHHIIccBBtt,, LLBBEEIISS.. HHOOPPSS SSTTOORRTTFFOORRDD,,
HNTNHTHHOOEEEEAATTEETTSS--HHHHLLOOSSAAWWHHTTOOEEAAWWEERRIINNEENNTTAAGGRR.. AATTIIEEHHLLSSLLEEWWEECCIINNLLLLAATTLLRRSSBBSSAAEEIINNCCAATTCCCCSSAACCWWRREEIIPPAALLTTLLRREEEERRDDSSAAEEAAUU..CCRRPPEEAAIIUUVVHHNNEEWWTTNNIIHHLLOOII22TTTTnnIIEECCdd EEJJ--UUCCOONNAAFFEERRTT22IISS00MMHH22EE22OOSSSSWWUUTTOOOOBBRRJJAAEEGGRRCCAARRTTNNIITTVVIIOOSSEEEERRAARROONNOODDMMAABBMMEEAAIINNPPGGOOAAFFVVHHAAAAIITTLLFFAAIIEEBBLLLLDDEE IINN

111999

HATFIELD HEATH PARISH COUNCIL
Minutes of the Meeting of the Parish
held at 19:30 on Wednesday 2nd March 2022 in the URC Hall

Hatfield Heath Parish Council

Unfortunately, the draft minutes for this meeting were not available before the
magazine needed to go to press. They will however available on the Parish Council
website (hatfieldheath.com) and posted on the Parish Council notice board.
The next meeting will be held on Wednesday, May 4th 2022 in the URC hall at 1930
and the Parish Forum on Saturday, May 14th from 1000 to 1200 in The Institute.
HHPC

Parish Council Forum 9th April 2022
We had three visitors. Ivan/June Cooper and Hillary Allen
In attendance were Sandra Saban, Nigel Robley, Chris Overton and Peter Brown.

We talked about damage in the play area and NR phoned and dropped a message to
Sam King to see if he could do it. Chris Overton also sent him a photo.

We talked about the tree for the Platinum Jubilee, which needs to be purchased
urgently if we are to have a ceremonial planting on Jubilee day as previously discussed.
This would then become our ‘Christmas Tree’ for the future.

We talked about the ‘Have a Chat’ bench dedicated to Phyliss Howard that has been
destroyed by the falling sycamore tree from the church yard. Michael Hockley will
retrieve the sign on the bench and discuss with the Church how best to replace the
bench.

The sign at the end of Cox Ley which was reporting some legal activity on Taylor’s
Field has disappeared and so Chris Overton has been unable to take photos of it as we
agreed at our last forum. We agreed that there is not much we can do without this
information.

The car parked in the cut through between the Sawbridgeworth Road and Stortford
Road is still there and NR has taken photos to send to the correct people at UDC to deal
with it.
Ivan expressed concern about a number of things.

2200

The first was lack of any information about the forthcoming festival and other
events over the four day weekend to mark the Jubilee. We told him that there
was a meeting planned for Wednesday to finalise plans for the Sunday
traditional festival but there were other events planned (a history Society
event at the URC and also an art exhibition, lighting of the beacon, Flower
festival at Holy Trinity, music event at the Hunter’s Meet). NR and SS will
endeavour to pull together a timetable in the next few days to summarise
these and circulate to the responsible people to agree,/provide more detail so
that this can be put into the village magazine and loaded to the website.
The second was the Neighbourhood Plan. We told him that this was to be one of the
topics at our annual AGM and we were attempting to ensure that the UDC expert could
come along and help us all understand what and how to do it. He remembered the
‘Village Plan’ from several years ago which attempted to do at least partly what the
Neighbourhood plan attempts to do and believes there are examples of local plans on
the Recorders of Uttlesford website that could be useful.
He lastly expressed concern about stacking of chairs in the URC hall and wondered
if it was possible to reduce the five high chair stacks to (say) two by distributing around
the hall, since there have been difficulties putting out and replacing them at such
events as Leisure Hour.
Dog bins were discussed. The bin outside the surgery was emptied on April 8. We
agreed to check the others and Peter will try and co-opt Anne Walsh whose dog walks
pass by virtually all of them. We van then establish of how frequently they are actually
emptied to support Richard’s efforts to get a replacement bin for Ardley Crescent and
replace the ‘disappeared bin’ at the entrance to Friars Lane.
NR gave a debrief of his and Mark Bissell’s meeting with the head of Essex Highways,
which was very positive if the things that were discussed actually come to pass.

2211

Advertising OUT

If you are interested in advertising in our magazine please select from the
following options and email [email protected] for more
information.

We offer 4 sizes and duration options:-

A = 1/3 page (18.4x8.6cm) £20 per month/ £200 for 12 months

B = 1/4 page (13.5x9cm) £15 per month/ £150 for 12 months

C = 1/8th page (6.5x9cm) £8 per month/£80 for 12 months

D = 1/16th page (4x9cm) £4.50 per month/ £45 for 12 months

Email = [email protected]

Please make sure that your advert will fit into the size you have chosen. The ones
already in the Magazine will help you choose the appropriate size.

Payments need to be made in advance of the 14th of the month prior to
going to print.

22

In essence Lee Scott said the following:
� He is responsible for potholes, flooding, speeding and enforcement. He has a finite budget that relies

on local taxation and government funding and is looking at ways to get commercial sponsorship to
increase this amount. This against a background of having existing contracts that he must continue to
honour until they come up for renewal.
� His first focus is on enforcement, since he presently only has one enforcement officer with an ever
growing portfolio of cases, so he is actively recruiting very many more (15 to 20) additional
enforcement officers on the basis that this will stop people believing that they can do anything they
like without too much fear.
� His major e mail load consists of complaints about potholes and so he is doing two things. Firstly
categorising them into ‘dangerous’ and ‘cosmetic’ and secondly charging every contractor to use
proper discretion when mending them – example was if it says to do three potholes on the worksheet
but there is a fourth in the vicinity that needs doing then do it and he will sign off the overage.
� Slightly linked to this is the damage done by individuals and companies during development. He
intends to demand a bond for each new development to be able to pay for proper repairs to damage
to Highways Property caused during construction.
� On flooding his major concern is new systems joining up with historical old systems and causing the
flooding. We alerted him to our situations.

� On speeding he said that we were not going to have fixed speed cameras all over the county but told
us about TruCam. These are hand held cameras that can automatically issue points and fines to
speeders. His vision is that these will be operated by the parking partnerships, who are actually part
of the police force themselves and therefore trained and legally able to operate such devices. The
idea is that the present wardens, who police our system at the moment would also use their TruCam
on their visits. The advantage is that their visit times are random and also seven days a week so
speeders cannot rely on patterns being constant. He believes that word will very quickly get around
about these devices while at the same time protecting local residents from abuse, since the
measurements would be independent.

23
23

Beer Festival

May Bank Holiday Weekend

Saturday FGth 11am-5pm
Sunday C May 11am-8pm

Monday E May 11am-5pm

Local Breweries
Over 2G Real Ales
Over 2000 Pints!

Local ciders and wine available
BBQ | Pizza Oven | Play Area
| Beer Tent

Entry must be
pre-booked online

LIVE MUSIC

Saturday 1<G0pm-4pm: FF/-*
Sunday 1<GGpm-4pm: /
Sunday 5pm-7.15pm: /
1 #
Monday 12.30pm-4pm: '

Book now! Limited tickets available. You MUST pre-book your table - one table seats up to six people

Visit our website for full details and to book at cammashall.co.uk

Needham Green, Hatfield Broad Oak, CM22 7JT

Unit 14, Heath View, Hatfield Heath
Discover our delightful collection of
unique toys and board games.
New opening hours: Tues-Wed: 10-3,
Thurs- Sat 10-4, Open every Sunday before Christmas
Email: [email protected]
Tel: 01279 739230

24

� A representative from Barnston complained about multiple road ups to cater for three separate

Broadband projects. We were told that since Broadband is a Central Government project, Essex

County Council have no power to do anything about it but will raise the issue.

� The last thing he talked about was increasing Electric Vehicle usage at the expense of fossil fuel.

Which I think is ‘pie in the sky’ territory for the majority of road users.

Our meeting ended at 12:05 Nigel Robley

Moat Field Allotments

We recently had a problem on the Moat
Field Allotment Site, when it was found that
one or more of the allotment holders sheds
had been entered and a quantity of garden
tools stolen. However, a local person
spotted a "camp" set up by we presume
children at the edge of the adjoining football
field and most of the stolen garden tools
were found in and around that "Camp", and
have now been returned to their owner, who
was very upset, as some of the tools had
been given to them by relatives who had
now died.

However, not all the tools stolen were
successfully recovered, so if there is a
resident we presume in the vicinity of the
Moat Field Allotment Site who finds garden
tools at their home that they did not
purchase, could they please return them to
the Allotment site where their owner would
be pleased to receive them.

Roger Breavington
Chairman, Moat Field Allotment Society

25
25

Hallingbury Handyman

General repairs and maintenance, painting and decorating,

PgairadennoingLaendslseoafnclsearnanecew, flaatdpack furniture assembly, fitting

shelves and blinds, curtain rails, picture and mirror hanging,
woodworking

Cost effective, practical solutions: Call for a fast reliable service

[email protected] 07958 972072

[email protected]

Live - Zoom - On Demand

YOUR LOCAL PROPERTY Private Studio Matching Green On Demand now
DFoIvNeAcoNtCe EprEoXpPerEtRyT. Monday 9.15 and 10.30 available for as little as

ZoTeuPesudradyy9.1o5ut £20 per month

Thursday 9.15 7 day free trial
All of the above by Zoom also

We can help with all types of specialist www.pilatesfactory.co.uk Call me: 0794 373 4544
property finance including:

• Buy to Let Mortgages

• Commercial Investment Mortgages

• Finance for trading premises

• RHeofluidWrabyiesLhwemtsielnl th&eDlpevyeoloupmbernint Fginoanucteonly the best.
•

To make an enquiry call 07764807803 or
visit our website at
www.dovecotepropertyfinance.co.uk

Conversions, Bathrooms, Kitchens
Plastering, Brickwork, Decorating

Dovecote Property Finance Ltd is an appointed representative of The
On-Line Partnership Limited which is authorised and regulated by the
Financial Conduct Authority (FCA). The FCA does not regulate some
investment mortgages.

If you would like to
A dirty bin can be advertise in the magazine,

a breeding ground for choose from the 4 sizes of adverts

germs and bacteria. shown in the magazine and

contact us. To find out about our rates,

Improve your bin hygienReObUyNDhOaFviAnPgAyWoSurtebrmins apnrdocfoensdistiioonns,ally
cleaned, deodorised and disinfected bplyeaFsereapsphlybbiynezmLatildto.

Domestic wheelie bins: [email protected]

One-off clean - £9 per bin or call 01279 731 434
Regular clean - £24 per bin for six cleans.

Our team attend every four weeks for a
maintenance clean (same bin each visit).

Commercial bins - POA Before
& After

Call / text to book 075577 35352

or visit our website www.freshbinz.co.uk

26

Gardening Club Leisure Hour
URC Hall, Chelmsford Road, at 2pm at the URC Hall
Wednesday May 4th 1.45 AGM
Last month, Deb Hart gave us a fascinating followed by Paulene Brakspear talk – Out of Africa

presentation on willow in the landscape and Proposed Summer Outing July 6th 2022.
Frederick Gibberd Gardens
how it can be used in a variety of ways. We or Saffron Walden Museum.

learnt that there are around 500 types of willow THANK YOUs from the

which have a range of colours and qualities. In United Reform Church

order to use willow in sculptures, fencing and Thank you to everyone who supported our Jumble Sale
last month at the URC in aid of repairs and also for the
baskets, the willow has to be cut, steamed and Red Cross. We made £600 and it was a great success.

air dried. Deb demonstrated the construction of Grateful thanks to everyone who helped out before hand

a willow wigwam for climbing plants and very and on the day. Jean Wybrew

kindly donated this for the raffle. The photos of …………………………………………………….

sculptures made out of willow were very UKRAINE EMERGENCY APPEAL

interesting, some of which Deb had made Dear Members of Hatfield Heath,

herself. The United Reformed Church thank you very much for
your recent donations to the above appeal where we
Next Meeting Wednesday 25th May 2pm raised £60.

Brian Carline - Pelargoniums, their varieties and Another Huge thank you to the Royal British Legion C
Section. They had their meeting in the URC hall on
propagation. Saturday 2nd April 2022. The collection pot was still in
the hall and the RBL members donated a further £78.
Visitors and new members are welcome
Today, (4th April 2022) I deposited £128 to the Disasters
APRIL - MAY - JUNE are the main months for Emergency Committee to help those in desperate need.
Honeybees to swarm.
Again, thank you all, in these difficult times, for thinking
Although this natural phenomenon sometimes causes of others who are suffering much more than ourselves.
alarm, the bees, having gored food for the journey,
are usually quite placid. John Jackson (HHURC Treasurer)

When sighted allow to settle and immediately inform {Receipt for deposit is held with URC finance documents
a Registered Swarm Collector or telephone the and is available to view on request}
British Beekeepers Association.

Once clustered the bees send out scouts to find a
suitable permanent home. Should they decide to live
in a building, removal is virtually impossible, the
only way is by a Pest Controller. Unfortunately the
poisons will remain in the building for some time and
visiting insects including bees will pick this up and
take back to a managed or wild colony which could
have disastrous consequences.

BE AWARE, REPORT SWARMS AS SOON AS
THEY SETTLE.

David Tyler, over 40 years experience as a
Beekeeper, Registered BBKA Swarm Collector
Tel: 01279 730228 Mobile: 07955 768124 Free

Service

27
27

Leisure Hour
A presentation from Hannah Shine of Easter
Wreaths and Flower Arrangement generated
interest for an attentive Leisure Hour audience.
An example of how placement of foliage,
cuttings and flowers created a colourful and
sympathetic design. How the points of the
compass and geometric shapes and angles
provide a template from which an initial idea
can be processed.
Following her talk Hannah answered a series
of questions on the garden, plants, flowers and
her own experience of entering competitions.

Two
examples

shown
below of
completed
designs

Ivan Cooper

Mark Homer - Rain coming from the north

We would like to receive your photographs of Hatfield Heath Diana Graves - Holy Trinity on
and nearby surroundings for publication, so do please send Mothering Sunday
them in with your name and a caption to
[email protected]

Printed by Panther Print & Design Ltd Tel: 020 8592 1166