The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by MEDIZINE UUM, 2018-12-16 01:31:39

medizine prototype (latest)

medizine prototype (latest)

Isi
Kandungan

Nutrisi
Diet

1 Khasiat Limau
3 Kesihatan Kita, Kita Jaga

Rawatan
dan

Pencegahan

7 Cirit-birit membunuh!
9 Sista Ovari Ancam
Kehamilan

Servis Info
dan Kesihatan
Inovasi
13 Khasiat Perubatan Daun
41 Maintaining Hair After Chemo Perubatan Ketum
Made Possible Alternatif
15 Golf Bukan Sekadar Sukan
43 Rehabilitasi Strok 19 Rahsia Jamu Indonesia
21 Tidur
25 Pertolongan Cemas
Sumber Penawar

29 Akupuntur: Jarum Untuk
Kesihatan

31 Rawatan Sunnah Peguat
Semangat

33 Urutan Di Hujung Kaki
35 Rawatan Islam: Satu Jalan

Keluar

Khasiat Limau

Oleh: Muhammad Khidir Bin Md Azmi

“Tahukah anda bahawa limau mempunyai pelbagai jenis, limau tempatan
mahupun limau luar negara”. Jenis limau ataupun dipanggil (citrus) dalam
saintifik ini banyak kegunaannya bergantung kepada jenis limau. Di Malaysia
sahaja, terdiri daripada sepuluh jenis limau sama ada yang boleh dimakan
atau sekadar hiasan ataupun bagi tujuan perubatan khususnya.

Jenis Limau Iklim yang panas dan lembab seperti di Malaysia
amat sesuai untuk penanaman limau nipis. Ia sesuai
Limau Nipis ditanam diatas pelbagai jenis tanah seperti tanah lom
yang berpasir kerana ia lebih sesuai dengan tumbuhan
ini untuk kekal subur.

Limau nipis mampu mengubah sedikit sebanyak Dalam kalangan herbalis, kebiasaannya air perahan
tentang kesihatan seseorang individu yang ingin buah limau nipis yang dicampur dengan kapur makan
mengetahui khasiat buah limau nipis ini. Selain itu, dikatakan boleh mengempiskan badan ibu-ibu yang
ia dapat meningkatkan tahap kesihatan seseorang baru bersalin. Limau nipis juga banyak digunakan
sekiranya mereka mengetahui khasiat sebenar limau dalam perubatan yang berunsur mistik seperti
nipis serta mengamalkannya. gangguan makhluk halus dan sebagainya.

Limau nipis atau dikenali sebagai (Citrus Aurantifolia)
ini pula dipercayai berasal dari India dan Myanmar
ataupun Asia Tenggara. Dan kini limau nipis ini
ditanam diseluruh kawasan tropika dan subtropika.
Manakala dikawasan yang lain, bijinya dijadikan
sebagai benih untuk ditanam.

1

Limau Kasturi

Limau kasturi (Citrus Microcarpa) adalah sejenis buah yang banyak digunakan dalam kegunaan masyarakat
Asia Tenggara kerana setiap perahannya memberikan rasa yang sangat sedap dan segar samada dalam
makanan mahupun minuman. Ia juga mengandungi kandungan vitamin C dan merupakan salah satu sumber
antioksidan yang baik.
Kulit limau kasturi juga boleh digunakan untuk mengurangkan penyakit seperti lelah, pening kepala dan juga
sakit tekak. Ia dikatakan dapat mengatasi masalah badan yang kerap berbau.

Limau Purut

Limau purut atau nama lain secara saintifiknya (Citrus Hystrix), adalah
berasal dari Asia Tenggara dan ianya tidak asing lagi dalam kalangan
masyarakat. Buah limau purut berbentuk bulat tetapi menggerutu
dengan rasa masam dan pahit.

Limau purut mempunyai pelbagai kegunaan dan khasiat. Limau
purut mampu menyelesaikan masalah kulit kepala kering. Ianya boleh
dijadikan sebagai skrub. Bagi anda yang mempunyai masalah bau
badan, anda juga boleh menggunakan buah limau purut sebagai air
mandian dan ianya dapat menghilangkan bau badan. Limau purut juga boleh mengatasi masalah gigi kuning
dan mampu melancarkan sistem pernafasan.

2

KITAKESIHATAN JAGA

Oleh: Tengku Syahiran Bin Tengku Rahim

Menurut Pegawai Perubatan Kementerian Kesihatan Malaysia (KKM), Dr Tengku Irfan bin Tengku Rahim
berkata, suplemen yang berada di pasaran hari ini terdiri daripada vitamin, mineral, herba atau tumbuhan lain
yang berbentuk pil, kapsul atau cecair. Senario hari ini yang dapat dilihat ialah suplemen dijual dengan meluas
tanpa kawalan telah mencetuskan kebimbangan ramai pihak terutama KKM. Hal ini kerana orang awam
boleh mendapatkan makanan tambahan tersebut dengan mudah seperti di farmasi, kedai makanan kesihatan,
pasar raya, atas talian (online) dan sebagainya tanpa diketahui kandungan sebenar sesuatu suplemen tersebut.
Walaubagaimanapun, pengambilan suplemen sebenarnya mampu membantu merawat dan mencegah banyak
penyakit sekiranya diambil dengan betul dan mendapat preskriptif daripada pakar perubatan atau pakar
pemakanan yang diiktiraf.

Penyakit Mata

Penulis telah menemui En Nizar Bin Omar, 47 tahun, Selain itu, pengambilan makanan semulajadi
seorang penghidap penyakit Presbyopia sejak 7 tahun yang kaya dengan sumber vitamin juga mampu
yang lalu. Penyakit ini akan menyebabkan seseorang memperbaiki daya penglihatan seseorang.
itu mengalami penglihatan yang tidak jelas, kabur
dan mengalami kesukaran untuk fokus pada objek. Sebagai contoh, makanan berkhasiat seperti kekacang,
Menurutnya, beliau telah mengambil suplemen sayur bayam dan telur. Sayur bayam mengandungi
Omega 3 atas saranan doktor. Hal ini kerana Omega kandungan lutein dan zeaxanthin yang tinggi
3 mempunyai kadar DHA yang tinggi yang mampu yang boleh mengatasi katarak mata dari merebak.
melindungi sel mata apabila terkena cahaya matahari. Manakala kekacang pula mengandungi bioflavonoid
Selain itu, Omega 3 juga mampu menguatkan daya dan zink yang tinggi. Kedua-dua bahan ini sangat
penglihatan walaupun usia sedang meningkat. Oleh diperlukan oleh retina untuk tujuan perlindungan
itu, jadikanlah pengambilan suplemen Omega 3 dan mengurangkan masalah mata yang rosak. Akhir
sebagai rutin harian dan lihatlah manfaatnya pada sekali, telur mengandungi lutein dan vitamin A yang
daya penglihatan anda. Sebagai buktinya, En Nizar membantu mengatasi masalah orang yang rabun
telah Berjaya merawat masalah mata beliau dengan malam dan masalah mata kering.
mengambil suplemen Omega 3 secara teratur.

3

Penjagaan Kulit Muka

Terdapat beberapa jenis vitamin yang membantu menyihatkan kulit
wajah iaitu, vitamin A, E, B, C, dan K. Vitamin E adalah untuk merawat
kulit kering dan mencegah kerosakan kulit akibat sinar UV. Seterusnya,
vitamin A pula mampu menjaga kesihatan mata serta memelihara kulit.
Vitamin B pula, mampu merawat kuku, kulit dan sel rambut. Vitamin C
pula membantu mengurangkan kedutan wajah, noda hitam dan mencegah
kulit kering. Selain itu, Vitamin K mampu merawat bekas luka, jerawat dan
lingkaran hitam di wajah. Walaubagaimanapun, pengambilan vitamin-vitamin
ini perlulah mendapat nasihat daripada doktor terlebih dahulu.

Terdapat beberapa bahan organik yang kita boleh digunakan untuk merawat kulit
muka bermasalah. Pada umur 40 keatas, ramai wanita mahupun lelaki mempunyai
masalah kulit muka. Makanan semulajadi seperti buah betik, kulit jeruk, buah
alpukat(avocado) dan tomato telah terbukti secara saintifik mampu mengatasi
penyakit-penyakit berkaitan kulit wajah. Buah betik mengandungi banyak
vitamin C, A dan E. Vitamin tersebut berfungsi sebagai antioksidan. Antioksidan
membantu memperbaiki semula kulit wajah anda dengan cepat, mengelakkan

pigmentasi dan melindungi daripada cahaya matahari.
Kulit jeruk mengandungi banyak vitamin C. Ia mampu membuat kulit
wajah kita lebih segar, putih dan cerah. Kulit jeruk juga berguna untuk
meneutralkan sel-sel kulit yang rosak atau mati akibat radiasi dari
sinaran UV. Selain itu, buah alpukat atau dikenali sebagai buah
‘avocado’ ini mengandungi vitamin C, vitamin E dan karotenoid
anti-oksidan. Kandungan buah ini mampu menjaga kulit terus
kekal sihat. Akhir sekali adalah tomato. Tomato mempunyai
khasiat yang begitu banyak untuk kulit wajah. Tomato
mengandungi sebatian anti-oksidan yang digunakan untuk
melindungi kulit dari terus terkena pancaran matahari dan
boleh mengatasi radikal bebas.

4

5

6

CIRIT-BIRIT

MEMBUNUH!
Oleh: Nurfarhana binti Mohd Nasajudin

Tahukah anda bahawa terdapat virus yang sangat berbahaya dan mudah
menjangkiti kanak-kanak dan bayi? Virus tersebut dikenali sebagai Rotavirus.
Kanak-kanak yang dijangkiti akan mengalami cirit-birit yang teruk terutama
sekali dalam kalangan bayi dan kanak-kanak dibawah umur 5 tahun.

Apa itu Rotavirus ? Tahap kebersihan yang tinggi sesungguhnya dapat
menghindarkan anak-anak dari dijangkiti penyakit
Rotavirus adalah sejenis virus yang amat berbahaya. seperti ini. Mereka sangat mudah dijangkiti penyakit
Penyakit ini boleh menjangkiti kanak-kanak yang ini kerana ibu bapa gagal untuk mengawal pergerakan
berumur di bawah umur 5 tahun yang sering terdedah anak-anak mereka. Sebagai contoh, barang mainan
kepada kotoran. Virus ini berupaya merosakkan kanak-kanak merupakan suatu bahan yang boleh
sel-sel usus kecil apabila ia mula menjangkiti menjadi penyebar virus ini. Hal ini amatlah
kanak-kanak. Sel usus kecil yang telah rosak akan serius kerana kanak-kanak yang berumur seawal
menyebabkan gastroenteritis di dalam perut kanak- 3 tahun dan ke bawah gemar memegang barang
kanak tersebut. Seterusnya, bayi dan kanak-kanak dan menggigitnya. Justeru itu, ibubapa haruslah
tersebut akan mengalami cirit-birit dehidrasi yang meningkatkan perhatian tentang tahap kebersihan
amat teruk. Virus ini boleh dijangkiti tanpa disedari persekitaran untuk mengelakkan virus ini daripada
sebagai contoh, apabila ibu bapa membawa anak- tersebar. Ibu bapa juga perlu mengambil inisiatif
anak mereka ke taman tema air untuk bermandi- lain seperti memvaksin anak-anak mereka sebagai
manda. Air di dalam kolam tersebut yang tidak bersih langkah awal untuk mencegah anak-anak daripada
menyebabkan Rotavirus terbentuk dan menjangkiti dijangkiti penyakit tersebut.
kanak-kanak. Peranan ibubapa dalam menjaga
kebersihan persekitaran anak-anak amatlah penting.

Cara Rotavirus berjangkit

7

Simptom Jangkitan Rotavirus

Apabila Rotavirus terjadi kepada bayi dan kanak-kanak, mereka akan mengalami cirit-birit yang teruk. Cirit-
birit yang terjadi mungkin akan mengaburi mata ibubapa kerana simptom itu mungkin boleh dikategorikan
sebagai normal atau mungkin ibu bapa beranggapan bahawa perkara itu tidak akan membawa bahaya
kepada anak mereka.

Hal ini akan membahayakan lagi keadaan anak-anak yang terkena jangkitan kerana perbezaan simptom
tersebut sukar dikenal pasti. Walau bagaimanapun, simptom jangkitan Rotavirus lebih bahaya daripada cirit-
birit kerana virus ini akan merosakkan dalaman kanak-kanak dan akan menyebabkan terjadinya jangkitan
lain. Antara simptom lain yang akan terjadi jika anak-anak telah terkena jangkitan ialah:

1. Muntah berlanjutan sehingga lapan hari
2. Cirit-birit teruk melebihi sepuluh hari
3. Sakit pada bahagian abdomen
4. Demam yang berlarutan

Jika simptom ini berlarutan, ibu bapa hendaklah membawa anak mereka untuk mendapatkan rawatan kerana
ia boleh menyebabkan badan kanak-kanak tersebut dehidrasi dan kehilangan cecair.
Jika keadaan ini tidak dirawat, kanak-kanak yang telah dijangkiti Rotavirus akan mengalami kerosakan
organ, kejutan dan boleh membawa kepada kematian.

Langkah-langkah Pencegahan Rotavirus

Ibubapa haruslah mengambil berat tentang tahap kebersihan persekitaran

kerana ia boleh menyebabkan penyakit Rotavirus ini tersebar. Segala
permainan kanak-kanak haruslah berada dalam keadaan yang bersih
dan penerapkan amalan menjaga kebersihan diri yang baik seperti
mencuci tangan sebelum mengendalikan makanan dan selepas
menggunakan tandas haruslah dididik sejak awal lagi oleh ibubapa
untuk melumpuhkan virus ini daripada terus menjangkiti kanak-
kanak.

8

SISTA OVARI
ANCAM KEHAMILAN

Oleh: Nurshahfawati binti Ashaari

Ovarian cyst atau lebih dikenali sebagai Sista Ovari merupakan kantung
yang dipenuhi dengan bendalir. Sista ovari ini terletak dibahagian rahim
wanita. Kebanyakan wanita di Malaysia tidak mengetahui tentang gejala
atau simptom ini sekiranya mereka menghadapi penyakit ini. Penyakit
ini biasanya tidak merbahaya bagi kaum wanita namun, sekiranya tidak

dicegah ia akan mengakibatkan keadaan yang lebih teruk sehingga
menyebabkan kematian.

Pengalaman dan Simptom Penyakit Cyst

Terdapat pelbagai tanda atau simptom Seperti yang dialami
yang dihadapi oleh penghidap oleh Puan Amirah,
ketumbuhan sista dalam ovari beliau sering
mereka. Antaranya ialah mengalami sakit di
mengalami kekejangan perut,
senggugut bahagian bawah perut
yang teruk yang membuatkan perut
semasa beliau berasa tercucuk dan
datang mengalami kekejangan. Selain
bulan itu, beliau juga sering membuang air
dan perut kecil walaupun tidak minum air yang
kembung. Perut banyak. Pembuangan air kecil sebanyak
kembung seperti orang hamil 10 hingga 15 kali amat membimbangkan
dikhuatiri akan menghidap penyakit keadaan yang dialaminya. Hal ini telah
ovarian cyst kerana ia merupakan mengakibatkan beliau akan sering
simptom utama yang diperlihatkan untuk membuang air kecil setiap kali minum air
mengesahkan bahawa ketumbuhan itu dalam masa 5 minit. Perkara ini berlaku
sedang membesar. akibat ketumbuhan sista yang dialaminya
telah membesar dan berdekatan dengan

pundi kencingnya.

9

Bagi wanita yang mengalami simptom
perut kembung, mereka perlulah membuat
pemeriksaan dengan segera. Hal ini
berkemungkinan akan menyebabkan
penyakit itu boleh merebak sehingga
menjadi sel kanser yang menyerang ovari.
Namun begitu, kekembungan perut tersebut
akan menyebabkan pesakit tidak selesa
dan boleh menimbulkan gangguan emosi.
Oleh itu, penyakit ini harus dirawat dengan
secepat mungkin dan dicegah sebelum
memudaratkan diri.

Pemeriksaan mengelak penyakit Rawatan pencegahan
kanser
Apabila sesuatu ketumbuhan (ovarian cyst) telah
dapat dikesan, doktor akan memberi pendapat
tentang kaedah bagi mencegah penyakit ini.
Untuk mengetahui dengan lebih lanjut tentang Jika pemeriksaan klinikal, ultrasonography
rawatan yang dilakukan untuk mencegah penyakit dan penilaian menunjukkan ketumbuhan itu
ini adalah dengan membuat pemeriksaan patologi berkemungkinan bukan kanser, dan faktor
bagi mengelakkan ia dari terjadinya kanser. Perkara usia yang muda, pembedahan konservatif iaitu
ini adalah untuk memudahkan kaum wanita pengeluaran ketumbuhan atau pembuangan ovari
mengetahui penyakit sista ovari ini sama ada terlalu yang terlibat sudah mencukupi.
bahaya atau sekadar ‘benda yang wujud di dalam Salah satu faktor penyebab kepada risiko kanser
rahim mereka. adalah disebabkan kandungan air yang berada
dalam kantung sista itu merupakan kuman
Ada juga ketumbuhan di bahagian ovari (ovarian yang mampu menyerang organ lain. Justeru
cyst) itu bukan kanser (benign) tetapi kelihatan itu, doktor akan menyaran supaya melakukan
seperti busung. Biasanya ketumbuhan (ovarian pembuangan ketumbuhan tersebut jika tidak mahu
cyst) tersebut dikesan di peringat usia muda dan membahayakan kesihatan kelak.
pemeriksaan ultrasonography pula menunjukkan
ciri-ciri bukan kanser. 10

Cara Pencegahan

Ketumbuhan sista ovari ini juga boleh mengecut dalam tempoh 6 bulan dan tidak perlu melakukan pembedahan
kerana ketumbuhan itu tidak berbahaya. Hal ini dapat dilihat melalui kemahiran fizikal seseorang itu.
Pengambilan buah-buahan seperti aprikot membantu mencegah masalah dalaman wanita.

Kebaikan aprikot ini mengandungi vitamin C yang mampu memberi perlindung kepada tubuh badan sekaligus
dapat menyihatkan badan.

Senaman juga amat penting bagi mengekalkan kesihatan tubuh badan. Hal ini dapat menyihatkan tubuh badan
dan mengelakkan diri daripada penyakit-penyakit yang kronik.



Di samping itu juga, tubuh badan juga perlulah mempunyai nilai BMI yang bagus seperti di bawah 25 untuk
lebih cergas. Diet yang seimbang juga perlu dipraktikkan bagi membantu memdapatkan berat badan yang
ideal. Dalam konteks ini, pengurangan berat badan yang dapat dilakukan dapat mengurangkan pengeluaran
estrogen dalam badan dan dapat mengurangkan risiko “ovarian cyst” membesar.
Tambahan pula, penghidap sista ovari yang masih mampu mencegah
mereka perlulah mengelakkan pengambilan estrogen yang berlebihan.
Hal ini adalah kerana ia merupakan faktor utama yang menyumbang
kepada ovulasi yang tidak teratur dan akan membentuk sista ovari.
Contohnya seperti pemgambilan kekacang atau produk tenusu.
Pesakit juga perlulah mengurangkan pengambilan daging merah dan
menggantikannya dengan sayur-sayuran, buah-buahan dan bijirin
dalam diet seharian.
Tuntasnya, penyakit ini merupakan satu penyakit yang sukar dirawat
jika tidak dicegah lebih awal kerana ia merupakan pembunuh nombor
satu bagi kaum wanita.

11

12

KHASIAT PERUBATAN

DAUN KETUM
Oleh: Nur Safirah binti Che Zulkefli

Pak Noor merupakan salah seorang pembuat air ketum di Beliau tidak menjualnya kepada orang
kawasan Sintok. Beliau membuat perniagaan ketum ini hanya sebarangan malah air ketum ini hanya
secara kecil-kecilan sahaja yang mana perniagaan ini dijalankan dijual kepada pelanggan tetap atau
dalam kedai runcit miliknya dan tidak ramai mengetahuinya. orang yang beliau kenali sahaja. Hal ini
Beliau membuat dan menjual air ketum ini sebagai ubat terutama demikian kerana, bagi mengelakkan
sakit urat. Beliau telah menjual air ketum ini lebih dari lapan penyalahgunaan air ketum yang
tahun daripada tanaman daun ketum beliau sendiri.. mana kebanyakkan mereka sanggup
mencampurkan air ketum dengan ubat
batuk bagi menguatkan tenaga mereka
tanpa memikirkan kesannya.

Khasiat Air Ketum

• Ubat untuk sakit urat dan

menambahkan tenaga
• Merawat wanita selepas bersalin
• Menurunkan kadar gula dalam darah

Kesan Minum Air Ketum

Pak Noor memberitahu ia menyebabkan badan menjadi kurus, Tahukah anda, ketum
insomnia, bibir menjadi kering, sembelit sehingga sukar juga dikenali dengan nama
membuang air besar dan sebagainya. Jika seseorang ingin lain iaitu ‘Biak’. Dalam bahasa
minumnya boleh tetapi jangan mencampurnya dengan benda
lain terutama dengan ubat batuk dan jangan meminumnya inggeris pokok ketum dinamakan
secara berlebihan kerana ia boleh mendatangkan kemudaratan ‘Kratom’. Kebiasaannya, pokok
kepada tubuh badan. Oleh sebab itu, kita sebagai manusia ketum ini diperolehi dari negara

harus bijak membuat pilihan dan jangan mudah terjebak Afrika, Utara Semenanjung serta
dengan benda yang tidak baik. Buktinya, walaupun saya menjual Selatan Thailand. Keistimewaan
air ketum tetapi saya tidak ketagih untuk meminumnya setiap daun ketum dapat menghasilkan
hari. Di mana saya akan meminumnya ketika diperlukan
sahaja. Pesanan saya kepada orang ramai janganlah air ketum melalui
cuba minum air ketum yang dicampur dengan pelbagai rebusannya.

ramuan kerana ia akan memberikan banyak kesan yang tidak
baik kepada diri anda, keluarga dan juga masyarakat,”katanya.

13

Petua Tanaman Pokok
Ketum

Penanaman pokok ketum boleh dilakukan
melalui dua cara iaitu penyemaian biji benih
dan juga melalui kaedah keratan batang. Ianya
perlu dipotong bahagian batang apabila cukup
matang usianya.

Daun ketum ini mempunyai
Mitragirin yang boleh
menyebabkan seseorang itu
ketagih selepas meminumnya.

Cara Rebus Daun Ketum

Bagi merebus daun ketum, beliau menasihatkan agar tidak memetik pucuk malah daun-daun yang terdapat
sebelum pucuk. Selepas itu, masukkan daun-daun ketum tersebut ke dalam periuk dan dicuci dengan bersih.
Seterusnya, cebiskan daun ketum kecil-kecilan agar kandungan nutrisi mudah serap. Rebuskan daun ketum
itu dengan air yang tidak banyak bagi pekat supaya lebih piau (power). Akhir sekali, matikan api selepas
dua jam dan biarkan rebusan itu sejuk sebelum ditapis. Pastikan minum airnya tidak berlebihan dan tidak
disimpan melebihi tiga hari.

14

BUKAN SEKADAR

GOLF SUKAN
Oleh: Sazanur Iman bin Salenin
“GOLF bukan sekadar sukan yang dianggap tidak mempunyai
risiko berbanding sukan lain tetapi sukan golf banyak memberi
kekuatan dan kesihatan tubuh badan kita, khususnya pada
golongan 40an ke atas”, Encik Wan Rosni (ketua jurulatih
Akademi Golf Nasional Universiti Utara Malaysia).

Sukan golf adalah sukan yang Sukan ini memberikan seseorang Ia merupakan cara yang terbaik
digemari oleh orang ramai individu itu banyak manfaat untuk terus berhubung dengan
meskipun ia merupakan sukan daripada segi kesihatan untuk rakan-rakan, memberi peluang
yang menggunakan kos tinggi, minda dan badan kita. Kajian telah untuk berinteraksi dengan
Bagi peminat sukan golf mereka menunjukkan bahawa pendedahan kenalan yang baru dan membantu
tidak memerlukan kajian oleh berterusan di kawasan hijau dapat menyambung komuniti. Oleh
saintis untuk mengatakan golf baik melegakan badan, mengurangkan kerana golf adalah permainan yang
untuk kesihatan. Apabila keluar tekanandanbolehmembantudalam tidak begitu kompetitif seperti
ke padang atau ke lapang sasar mengurangkan kebimbangan. bola sepak dan bola keranjang,
mereka tahu ia pasti menyihatkan. Selain itu, pendedahan kepada terdapat banyak masa dan waktu
Menghayun kayu golf, berjalan cahaya matahari membolehkan yang lapang untuk berinteraksi
dan naik turun cerun juga sebagai tubuh manusia menyerap vitamin dengan pemain golf yang lain.
satu senaman yang menyihatkan. D dari matahari. Sukan golf juga Kajian telah menunjukkan bahawa
Sukan golf merupakan aktiviti luar boleh menambah kenalan baru sejumlah besar urusan perniagaan
yang tidak lasak dan memerlukan dan menjadi sukan yang sangat dibincangkan di dalam padang
seseorang pemain itu terdedah menyeronokkan secara sosial. golf.
kepada matahari dalam jangka
masa lama.

15

Tambahan lagi, sukan golf Sukan golf ini mampu
merupakan salah satu sukan menguatkan daya penglihatan
yang terbaik untuk membakar anda. Contohnya, dalam
kalori. Sebuah padang golf sukan golf, ia memerlukan
mempunyai keluasan sebanyak fokus yang baik untuk
30 hingga 200 ekar, ia bermakna melihat bola kecil yang
anda akan banyak berjalan! bewarna putih dan
Menggunakan kereta golf (buggy) dimana ianya berhenti
dan berjalan boleh mencecah setelah membuat
jarak sejauh antara lima hingga pukulan. Pemain golf
tujuh kilometer. Jika anda memilih belajar bagaimana
untuk membawa beg golf anda hendak meletakkan
sendiri, anda akan membakar sasaran kecil dari jarak
lebih banyak kalori! Dengan jauh walaupun bola berada
semua berjalan, membawa dan di ‘tee’, sebelum memulakan
hayunan yang terlibat, pemain golf pukulan mereka, pemain golf
boleh membakar sehingga 1000 juga diberikan peluang untuk
kalori dalam satu permainan. menilai tahap daya penglihatan
mata mereka di samping dapat
meningkatkan koordinasi mata.

Seterusnya , sukan golf Kemudian, sukan golf Akhir sekali, sukan golf
ini mampu mengawal kadar merupakan sukan kecederaan membantu mengurangkan
denyutan jantung anda secara berisiko rendah, dimana ia sangat tekanan. Berada di kawasan luar
sihat. Permainan golf boleh sesuai untuk golongan berusia di mana anda boleh berinteraksi
membuatkan jantung anda lewat 40-an untuk menyertai dengan orang lain yang berkongsi
sihat dan normal sama seperti sukan ini. Walaupun golf adalah minat yang sama adalah cara
pembakaran kalori, berjalan, sukan yang mengutamakan terbaik untuk melupakan sebarang
membawa dan berayun akan strategi, koordinasi dan ketepatan, masalah. Keseronokan berjalan
meningkatkan kadar denyutan terdapat beberapa aktiviti fizikal di persekitaran yang terbuka dan
anda, memastikan ia mengepam seperti berjalan, berayun dan semulajadi serta menghabiskan
dan meningkatkan aliran darah. berputar. Golf adalah sukan masa dengan rakan di tempat
Perkara ini akan mengurangkan kecederaan berisiko rendah tetapi golf sudah tentunya akan
risiko anda untuk penyakit masih melibatkan aktiviti fizikal memberi impak yang positif
jantung dan mengurangkan paras yang cukup untuk mengekalkan dalam diri individu itu sendiri.
kolesterol secara semula jadi. otot-otot yang terlibat. Info lain, bermain golf boleh
melepaskan endorphin iaitu bahan
kimia semula jadi yang dapat
meningkatkan mood dalam otak
kita supaya anda lebih bahagia.

16

17

18

Rahsia Jamu Siapa yang tidak kenal dengan 'Jamu'
atau ubat herba? Minuman tradisional
Indonesia Indonesia yang dihasilkan menggunakan
Oleh: Rissa Pramita bahan semula jadi dan mempunyai
manfaat untuk kesejahteraan. Jamu yang
mempunyai pelbagai jenis yang dijual
di pasaran dan sangat mujarab untuk
pengguna.

Di Indonesia sendiri terdapat 400 produk dan mereka ubat herba yang tersebar di berbagai belahan tempatan,
dan separuh dari produk jamu dalam sekitar 200 berada di peringkat internasional. Sebilangan besar produk
itu dihantar ke pelbagai negara, misalnya, China, Jepun, Belanda, Pusat Timur, dan negara ASEAN, contohnya
Malaysia dan Singapura.

Sejak abad ke-16, seseorang dari Indonesia telah Teknik tradisional untuk membawa bakul buluh
memperkenalkan ubat atau Jamu ini yang merupakan dipanggil 'Jamu Gendong'. Walau bagaimanapun,
warisan nenek moyang mereka. Jamu mempunyai rasa pada masa kini, beberapa peniaga Jamu boleh
tidak menyenangkan tetapi hasilnya sangat memuaskan menunggang basikal. Selain itu terdapat khemah di
hati pengguna dan ia dapat melindungi kesejahteraan tepijalanyangmenawarkanJamuistimewa.Permulaan
tubuh manusia. Jamu juga dapat ditemui di seluruh dalam pembuatan jamu adalah mempunyai tanda
Indonesia terutama di Jawa. Semasa penulis kecil, saya dagangan sendiri di antara keluarga. Pada ketika
pernah melihat 'Mbok Jamu', permukaan botolnya itu dari industri rumah, Jamu dijual melalui 'Jamu
mempunyai seorang wanita yang menggunakan kain Gendong' dan dukung. Selain itu, Jamu yang dijual
tradisional 'kebaya Indonesia' dan membawa bakul ialah minuman kesejahteraan yang boleh dimakan
buluh yang dipenuhi jamu dan digendong jamu untuk secara teratur seperti beras galingale yang dikenali
menjualnya dari bandar ke Bandar. sebagai 'Beras Kencur' atau asam Kunyit Asam '.

Jamu Indonesia semakin popular
dalam kalangan rakyat Malaysia

Jamu telah memasuki pasaran Malaysia sejak zaman
purba dan telah dikenali oleh penduduk umum di Malaysia.
Kini, terdapat sekitar 200 produk jamu atau separuh jamu
Indonesia yang masuk ke Malaysia. Sebanyak 20% jamu adalah
buatan di Malaysia dan diedarkan oleh agen atau pengedar
melalui undang-undang. Sedangkan 80% masuk ke
Malaysia dengan pengedar secara haram.

19

Di Indonesia, telah diketahui berbagai jenis jamu yang dihasilkan dari bahan-bahan alami, seperti kunyit,
sirih sirih, dan bahan alami lainnya. Jamu mempunyai ramuan yang luar biasa sejak zaman dahulu. Apa lagi,
untuk pencinta Jamu, sudah tentu ingin tahu tentang jenis Jamu dan apa faedahnya, bukan?
Nah bagi pencinta jamu, mari kita kenali bahawa herba semulajadi dan manfaat kesihatan mereka,

1. Jamu Madurasa

Jamu Air Mancur Sdn Bhd adalah salah satu pembuat jamu terbesar di Indonesia, yang dibina pada tahun 1963
di Solo, Indonesia. PT Jamu Air Mancur telah memasuki negara-negara besar, salah satu daripada Malaysia.
Mereka terus berkembang inovasi baru yang mana menghasilkan suplemen kesejahteraan bernama Madurasa.
Siapa yang tidak kenal madu? Ia manis dan bahan-bahan ini berguna untuk kesejahteraan.

Madu biasanya digunakan dalam produk makanan dan ubat-ubatan dan mempunyai khasiat sebagai
menstabilkan stamina dan kecergasan. Dengan kelebihan madu, Madurasa hadir dalam skop item yang
berbeza. Madurasa memberikan item dalam struktur yang berbeza iaitu Madurasa Stick, Curcuma, Madurasa
Kelengkeng, Madurasa Premium, Madurasa Orange, Madurasa Jasmine, Teh Hijau Madurasa, Madurasa Teh
Lemon, Madurasa Coffee Halia, Madurasa Beras Kencur.

Satu perkara itu adalah Stick Madurasa. Menyusun bahan dengan batang plastik. Keuntungan dari Stick
Madurasa adalah untuk mengembangkan kerangka dan kesejahteraan yang tahan. Selain itu,
Madurasa Orange iaitu perisa oren. Ia sangat efektif untuk menyihatkan semula dan dengan
cepat merangkumi daya hidup, tambahan pula membuat individu
ketabahan muda dan bertambah, ada keberkesanan jeruk
madurasa. Madurasa Premium pula merupakan madu
yang tidak tercemar dengan jem regal dan madu lebah.
Kelebihan ini adalah menstabilkan stamina dan daya
hidup, pembasmi kuman, memastikan kesejahteraan
fikiran, perubatan kepanasan, dan sentiasa awet muda.

2. Jamu Kunyit Asam

Wanita yang perlu mengendalikan perut
utama dengan ubat tradisional, anda
harus cuba Jamu Kunyit Asam. Jamu ini
dikenali sebagai salah satu herba biasa
yang telah menunjukkan daya dorongan
dalam menjaga masalah corpulence dan
penipisan di kawasan perut. Kerana ramuan
ini mengandungi Curcuma, mineral dan
vitamin C, dan juga minyak asas sangat
berguna untuk badan pelangsingan.
Selain daripada ramuan Curcuma dalam
kunyit boleh membetulkan luka di sayap
kunyit. Jamu Kunyit Asam ini adalah selamat
memandangkan ia tidak mengandungi
bahan kimia untuk kesejahteraan apabila
dibelanjakan dalam jangka panjang dan rasa
segar.

20

TIDUR “Masih ingatkah anda sewaktu
anda masih kecil, setiap hari
Oleh : Nor Atiqah Najwa pastinya ibu bapa anda akan
Binti Hassan memaksa anda untuk tidur
sebentar pada waktu siang.
Fungsi Utama Tidur Yalah, selepas penat pulang dari
sekolah. Namun kini, tiba giliran
Tahukah anda bahawa Antara fungsi utama tidur anda pula telah penat apabila
waktu tidur adalah waktu ialah dapat mengurangkan seharian bekerja, menghadap
dimana berlakunya tekanan yang dihadapi oleh dunia yang makin sesak dengan
proses-proses penting seseorang individu setelah pelbagai jenis masalah, kini tiba
didalam tubuh badan kita. penat melakukan kerja pada sudah waktu malam, iaitu waktu
Sebagai contoh, apabila siang hari. Apabila anda berehat atau lebih dikenali
kita tidur, ianya akan mempunyai tidur yang cukup, sebagai waktu tidur.
dapat mengembalikan anda dapat mengurangkan
tenaga kepada tubuh risiko mendapat serangan strok Tidur yang cukup juga
dan sakit jantung. Oleh yang dapat menyegarkan tubuh
demikian, anda hendaklah badan anda. Sebagai contoh,
tidur dengan secukupnya bagi tubuh badan anda dapat
mengelakkan tekanan stress mengumpulkan lebih banyak
berlaku. tenaga, dan boleh melapangkan
minda setelah bangun dari
badan kita. tidur.

21

Tidur juga dapat menguatkan Gangguan Tidur
daya ingatan anda. Ia berlaku
apabila anda mengalami Antara gangguan semasa tidur adalah anda mungkin telah mengalami
mimpi semasa tidur; ianya mimpi yang buruk ataupun mimpi yang ngeri. Oleh hal yang
dapat menguatkan minda demikian, anda mungkin tidak dapat tidur dengan nyenyak semula
daya ingatan anda kerana selepas mimpi tersebut membuatkan ianya terkesan dalam diri anda.
pada waktu tersebut tubuh Anda terlalu memikirkan peristiwa berikut dan menyebabkan mata
badan anda akan berada anda tidak mengantuk kerana anda telah memaksa otak anda untuk
dalam keadaan rehat dan otak mengingati apa yang anda mimpikan itu.
anda pula sedang memproses
apa yang telah terjadi dan
peristiwa yang dilalui oleh
anda sepanjang hari tersebut.
Oleh itu, tidur tanpa gangguan
akan dapat menghasilkan daya
ingatan yang lebih segar dan
baik.

Sesetengah individu mengalami masalah
semasa tidur iaitu tidur berjalan. Hal ini
berlaku kerana ia boleh disebabkan oleh
keturunan seseorang individu tersebut.
Perkara sebegini amat membahayakan
kerana anda mungkin akan mengalami
kecederaan. Sebagai contoh, semasa tidur
berjalan anda mungkin akan terjatuh dan
sebagainya.

INGAT! Kita tidak
digalakkan untuk makan
atau minum yang boleh
merangsang seperti
Tips Tidur Mudah minuman bersoda
atau bergas dan kafein.
Antaranya ialah dari segi faktor tilam dan tilam yang digunakan Minuman berkafein
itu hendaklah sentiasa dalam keadaan yang selesa dan bersih. dikatakan adalah salah
Disamping itu, suhu bilik yang sesuai juga dapat membantu anda satu minuman yang
untuk tidur dengan lebih tenang dan nyenyak. Kita tidak digalakkan akan menyebabkan anda
membuat kerja diatas katil bagi mengelakkan otak kita tidak terus sukar untuk tidur.
bekerja disaat tubuh badan kita telah bersedia untuk berehat.

22

23

24

PERTOLONGAN CEMAS
Sumber Penawar Oleh: Muhammad Shahhir bin Aziz

Terkejut? Panik? Takut? Inilah perasaan yang akan
dialami oleh seseorang apabila berhadapan dengan
situasi kecemasan yang berlaku di sekeliling mereka.
Ada juga yang terus melarikan diri daripada
situasi tersebut kerana tidak mahu terlibat
menyelamatkan mangsa.

Mungkin ramai yang tertanya-tanya adakah Kemahiran pertolongan cemas inilah yang
pertolongan cemas ini mempunyai rawatan yang akan menentukan mangsa sama ada hidup atau
sama digunakan oleh para doktor untuk pesakit. mati. Pertolongan cemas ini bukan sahaja dapat
Jawapannya tidak sama sekali kerana rawatan ini menyelamatkannyawamalahandapatmenyelamatkan
boleh dilakukan oleh semua lapisan masyarakat nyawa malahan dapat mengurangkan kecederaan
sekiranya mereka mempunyai pengetahuan asas yang serius seperti tercekik, kecederaan luka dan
yang telah ditetapkan oleh Kementerian Kesihatan lemas. Walaupun kecedaraan ini dianggap biasa
Malaysia. Pertolongan cemas ini mempunyai tetapi tindakan yang dilakukan untuk rawatan perlu
rawatannya tersendiri yang melibatkan mangsa mengikut prosedur yang betul supaya tidak memberi
mengalami kecederaan, kemalangan atau orang yang kesan buruk kepada anggota badan yang lain.
diserang penyakit secara tiba-tiba.

Serangan jantung dan strok penyakit
kritikal

Seperti yang kita tahu, penyakit kritikal ini memerlukan
pengawasan maksimum yang boleh membawa kepada
kematian kerana bila-bila masa sahaja boleh berlaku dan
memerlukan rawatan secepat mungkin. Bukan golongan tua
sahaja yang boleh mengalami sakit jantung, malah golongan
muda juga boleh mengalami nasib sama.

25

Menurut Pakar Perunding dan Ketua Perubatan Kaedah ini perlu dilakukan dengan cara yang efektif
Kecemasan, Hospital Universiti Kebangsaan Malaysia untuk mengembalikan saluran pernafasan mangsa
(HUKM), Prof. Madya Dr Azhar Abdul Aziz,” mangsa dengan betul. Untuk mendapatkan keputusan yang
yang kebiasaannya pengsan disebabkan serangan menyakinkan, kaedah ini akan dilakukan oleh orang
jantung perlu dirawat dalam 10 minit selepas waktu yang telah menguasai atau terlatih dalam Automated
itu supaya denyutan jantung dapat berfungsi semula External Defibrillation (AED)”.
dengan baik”.
Tambahnya lagi, “begitu juga dengan serangan
“Antara simptom seseorang terkena serangan strok yang mana mempunyai cara rawatan tersendiri.
jantung ialah mereka akan mengalami sesak nafas, Ada yang mengatakan serangan ini boleh diubati
sakit dada, loya dan muntah. Kadang-kadang dengan dengan mencucuk jarum pada hujung jari tangan
keadaan yang tidak boleh dikawal, pada peringkat dan kaki. Perkara ini tidak benar sama sekali dan
akhirnya, mangsa akan pengsan dengan serta merta”. merupakan satu mitos sahaja kerana tiada kaitan
langsung dengan saluran darah pada otak”.
“Rawatan yang paling sesuai dalam membantu
mangsa yang mengalami serangan jantung ialah
dengan menggunakan kaedah Cardiopulmonary
Resuscitation (CPR).

Prosedur rawatan CPR yang efektif

Dalam kesemua rawatan pertolongan cemas yang telah dipelajari, masih ramai lagi yang mengambil tindakan
sambil lewa terutamanya dalam kaedah bantuan pernafasan. Apa yang mereka tahu hanyalah memberikan
oksigen dari mulut ke mulut tetapi tidak tahu langkah-langkah sepatutnya yang perlu dibuat.
“Bantuan CPR ini boleh dilakukan melalui dua kombinasi iaitu bantuan pernafasan dan penekanan di bahagian
dada. Tujuannya adalah untuk memastikan oksigen sampai ke otak dengan menggunakan saluran darah.
Bantuan CPR ini sangat ditekankan kerana hampir kesemua penyakit yang kritikal memerlukan rawatan
pertolongan cemas dalam memberikan bantuan pernafasan.

26

Jurulatih St. John Ambulans Malaysia (SJAM) UUM, Samsudin Oli Mohamed menyatakan “setiap masyarakat
mahupun pelajar haruslah didedahkan dengan pelbagai teknik dalam menyelamatkan mangsa yang boleh
mengakibatkan pernafasan mangsa terhenti. Danger, Response, Chest Compression, Airway dan Breathing
adalah lima teknik panduan terbaik dalam memberikan bantuan pernafasan. Jika bantuan CPR ini tidak
dilakukan dengan secepat mungkin, peratusan mangsa untuk terus hidup akan jatuh selepas beberapa minit

serangan penyakit berlaku”, katanya lagi.

Nasihat Pakar



Walaupun pertolongan cemas
bersifat sementara dan tidak
memberikan rawatan sepenuhnya
ketika kecedaraan, sekurang-
sekurangnya rawatan ini dapat
memberi peluang untuk menerima
pemeriksaan daripada pakar dengan
selanjutnya.

Menurut Pengurus Jururawat Pusat Dr Umar Sharif selaku Pakar Kecemasan Hospital Tentera Darat,
Perubatan Kelana Jaya (KJMC), Gemas berkata, individu yang ingin memberikan rawatan kecemasan
Jafrina Hariani Haris Fadil, “orang tidak perlu panik dan melakukannya dengan penuh yakin. Punca
yang mempunyai ilmu asas dalam panik mungkin disebabkan mereka tidak diberikan pendedahan
pertolongan cemas adalah seorang dengan lebih awal.
wira dan amatlah beruntung kerana
dapat menyelamatkan mangsa “Bagi memastikan semua berjalan dengan selamat, setiap masyarakat
manakala orang yang tiada ilmu harus tahu perkara yang perlu dilakukan dan bertindak pantas
akan memburukkan lagi keadaan”. apabila didedahkan dengan ilmu pertolongan cemas yang sedia ada”.

Tambahnya lagi, “untuk
meningkatkan lagi kesedaran,
kursus pertolongan kecemasan perlu
dilakukan sekurang-kurangnya
setahun sekali untuk memberi
pendedahan dengan cara mengawal
situasi kecemasan yang boleh dibuat
khususnya oleh syarikat-syarikat di
Malaysia terhadap pekerja”. Tidak
lupa juga, beliau juga menyarankan
para pelajar untuk mempelajari
ilmu asas ini yang telah banyak
didedahkan kepada pendidikan di
sekolah.

27

28

AKUPUNTUR
JARUM UNTUK PEMULIHAN

Oleh : Lee Leroy

Jarum dalam kulit. Itulah yang dapat dilihat pada gambar di atas. Siapa sangka prosedur yang
nampak sakit ini sebenarnya tidak dan sebaliknya adalah baik untuk kesihatan? Prosedur ini
merupakan sejenis rawatan tradisional yang berasal dari China yang dikenali sebagai Akupuntur.

Akupuntur merupakan salah satu komponen dalam sistem kesihatan di negara
China yang berlangsung sejak sekurang - kurangnya 2500 tahun dahulu. Teori
am akupuntur adalah berasaskan konsep ‘Qi’ yang merupakan tenaga yang beralir
di dalam badan manusia yang amat penting bagi kesihatan seseorang. Tabib
China percaya bahawa sebarang penyakit yang dihadapi oleh manusia berpunca
daripada ketidakseimbangan atau ganguan atas ‘Qi’ seseorang tersebut. Oleh
demikian, akupuntur diperkenalkan bagi membetulkan aliran ‘Qi’ dalam badan
dengan memasukkan jarum halus berdasarkan kombinasi melalui 350 titik-
titik tertentu yang terletak di merata tubuh badan seperti gambar di kiri. Tidak
dinafikan keberkesanan akupuntur dalam mengubati penyakit konvensional
sehingga negara barat seperti America dan Britain menunjukkan minat yang amat
mendalam kepada perubatan akupuntur China sejak lawatan presiden Richard M.
Nixon ke China pada tahun 1972.

Pada tahun 2003, World Health Organization (WHO) telah mengeluarkan sebuah
senarai rasmi penyakit yang dibuktikan berkesan diubati melalui akupuntur, iaitu:

- tekanan darah tinggi and rendah - selsema
- mual dan muntah akibat kemoterapi - sakit sendi
- gastrik - tubuh badan terseliuh
- disentri - mengurangkan risiko strok
- penyakit ringan seperti sakit belakang, leher, lutut - penguranggan sakit semasa hamil
- osteoarthritis -migrain

Walaupun dengan kenyataan ini, bagaimana akupunktur berfungsi secara saintifik masih tidak jelas, tapi
memang disetujui oleh pakar- pakar atas keberkesanannya.

29

Apakah yang perlu anda tahu apabila
melawat seorang pakar Akupuntur?

Sebelum bermulanya terapi akupuntur, seorang pakar akupunktur akan memeriksa pesakit dan menilai
keadaan mereka. Apabila diagnosis pesakit telah tamat dan penyakit telah dikenalpasti, maka mulalah terapi
akupuntur. Pesakit akan diminta untuk berbaring di belakang mereka, depan, atau satu sisi, bergantung di
mana jarum perlu dimasukkan. Pakar akan memasukkan satu atau lebih jarum steril yang tipis, di mana
pesakit mungkin merasakan sensasi yang disuntik yang sangat singkat, seperti gigitan seemut. Ada kalanya,
jarum yang digunakan akan dipanaskan atau dirangsang dengan elektrik selepas dimasukkan ke kulit. Jarum
akan tetap berada pada badan selama 5 hingga 30 minit. Bilangan rawatan yang diperlukan bergantung
kepada keperluan individu. Seseorang yang mempunyai keadaan kronik mungkin memerlukan satu hingga
dua rawatan seminggu dalam beberapa bulan. Masalah yang ingin dirawati biasanya mula berkesan selepas 8
hingga 12 sesi. Selain itu, perawat juga akan menawarkan nasihat tentang penjagaan diri atau terapi pelengkap
lain, seperti herba Cina kepada pesakit jika diperlukan.

Rawatan akupuntur adalah selamat jika dipraktikan oleh seorang ahli
akupuntur yang pakar dan berlesen. Akupuntur, apabila dijalankan
dengan betul, kurang kesan sampingannya dan selamat digabungkan
secara berkesan dengan rawatan lain. Tetapi jika akupuntur
dikendali dengan salah atau cuai oleh ahli akupuntur yang kurang
berpengalaman, ia boleh membahayakan kesihatan dan jika lebih
sirius, nyawa pesakit.
Akupuntur adalah bahaya kepada pesakit yang mempunyai masalah
pendarahan. Pendarahan, lebam dan kesakitan boleh timbul apabila

jarum menembusi kulit semasa rawatan akupuntur. Oleh demikian,
seorang ahli akupuntur harus mengenalpasti keadaan pesakit dengan teliti
sebelum mengambil keputusan untuk menjalankan akupuntur terhadap seseorang. Justeru, jarum yang
digunakan untuk akupuntur harus disterilkan bagi mengelakkan penjangkitan penyakit.
Jika anda ingin mendapatkan rawatan akupuntur, anda haruslah memastikan pakar yang anda pilih adalah
berlesen dan berpengalaman agar tidak mengancam keselamatan diri. Terdapat kes di mana ahli akupuntur
yang tidak sah memasukkan jarum pada bahagian dada atau belakang terlalu dalam dan mencederakan organ
dalaman pesakit. Kemalangan ini sangat jarang berlaku dalam kalangan ahli akupuntur yang berlesen dan
berpengalaman. Bagi memastikan pakar yang anda lawati adalah ahli akupuntur yang sah dan berlesen, anda
boleh membuat semakan melalui laman web National Certification Commission in Acupuncture and Oriental
Medicine (NCCAOM), iaitu http://www.nccaom.org/.

30

Rawatan Sunnah

Penguat
Semangat

Oleh: Nurul Fazliana Madihah Binti Abdul Ghafar

Amalan bekam basah dan kering mampu bebaskan darah kotor dan
toksin dalam badan.

Bekam adalah sejenis ubat alternatif purba di mana ahli terapi meletakkan bekas bekam pada kulit anda selama
beberapa minit untuk membuat sedutan. Ramai yang mendapatkannya untuk banyak tujuan, termasuk untuk
membantu dengan sakit, keradangan, aliran darah dan membuang darah kotor kelonggaran sebagai jenis
urutan tisu dalam. Rawatan bekam ini juga dikenali sebagai Hijamah dalam bahasa Arab dan Cupping dalam
bahasa Inggeris.
Seorang pesakit darah tinggi yang sering mengalami sakit kepala, pemandangan menjadi kabur, sakit dada dan
rasa berdebar-debar boleh mengambil altermatif dengan membuat bekam darah bagi membantu mengurangkan
tekanan darah. Selepas berbekam, darah akan jadi semakin stabil dan boleh menjalani kehidupan harian
seperti biasa.

31

Bekam apa yang selalu menjadi permintaan orang ramai?

Bekam kering atau bekam angin -menyedut permukaan
kulit tanpa mengeluarkan darah dari kawasan yang dibekam.
Alatan atau bekas yang digunakan untuk bekam kering adalah
bekas kaca, tanduk kerbau, tetapi ramai pemilik spa dan pusat
kesihatan yang menjalankan rawatan bekam menggunakan
bekas plastik atau bekas komposit. Sedutan dibuat dengan
menyalakan api di dalam bekas bekam, dan menekupnya ke
badan pesakit atau tempat yang ingin dibekam. Perubahan
suhu yang mendadak dari panas ke sejuk akan menyebabkan
ruangan seperti vakum terbentuk.
Bekam basah- dilakukan dengan memulakan bekam kering dahulu, selepas itu, permukaan kulit yang dibekam
dilukai dengan jarum. Setelah itu, darah dari dalam badan disedut dengan menggunakan alat cupping set and
hand pump bagi mengeluarkan darah kotor. Bekam basah ini biasanya dilakukan selama 4 hingga 5 minit dan
tidak boleh melebihi 9 minit malah penyedutan darah hanya boleh dilakukan sebanyak 7 kali dan tidak boleh
lebih dari jumlah tersebut. Biasanya darah kesan daripada rawatan bekam yang keluar adalah bewarna merah
kehitaman dan berbuih. Pada 3 hingga 4 jam yang pertama, bahagian badan yang dibekam tidak boleh terkena
air dan bekam basah ini tidak boleh dilakukan secara kerap sekurang-kurangnya selepas 2 hingga 3 minggu.

Boleh ke pesakit kencing manis membuat rawatan bekam?

Ramai yang berpendapat bahawa pesakit kronik yang mengalami penyakit kencing manis tidak boleh menjalani
rawatan bekam kerana bimbang akan luka yang disebabkan oleh rawatan bekam tersebut. Kebanyakan pesakit
kencing manis beranggapan mereka akan mengalami kesukaran untuk sembuh sekiranya terdapat luka di kaki
mereka.
Apa yang sebenarnya berlaku adalah disebabkan oleh kandungan gula dalam darah yang telah menyumbat
pembuluh darah yang menjadi punca kaki berasa kebas, saraf tidak dapat berfungsi dengan baik kerana
saluran darah tidak ke kawasan itu. Tidak ramai yang mengetahui bahawa antibodi yang terdapat di dalam
darah bersih yang akan menyembuhkan luka tersebut. Sekiranya saluran darah tersumbat, darah tidak akan
sampai ke kawasan luka tersebut. Justeru, pesakit kronik yang mengalami penyakit kencing manis tidak perlu
takut untuk menjalani rawatan bekam. Bekam membantu dalam mengeluarkan toksin dari badan, seterusnya
secara perlahan-lahan darah bersih tersebut akan mengalir ke kawasan luka.

32

Urutan
Di Hujung Kaki

Oleh: Fetra Fajri Kalvin

Refleksologi yang juga dikenali sebagai terapi zon, adalah ubat alternatif yang melibatkan penggunaan tekanan
kepada kaki dan tangan dengan teknik ibu jari, jari, dan tangan tertentu tanpa menggunakan minyak atau
losyen. Menurut Dwight C. Byere, refleksologi adalah sains yang melibatkan prinsip-prinsip iaitu refleks
dibahagian kaki yang selari dengan semua kelenjar organ di bahagian badan. Oleh sebab itu refleksologi
adalah teknik yang terlalu mudah untuk dilakukan.
Refleksologi ialah satu terapi yang boleh dilakukan secara sendiri. Namun begitu untuk mendapatkan hasil
yang terbaik eloklah seseorang itu berjumpa dengan orang yang pakar. Risiko adalah tinggi bagi orang tua yang
menghidap tekanan darah tinggi yang disebabkan oleh perubahan yang berlaku semasa pertambahan umur
dan salah satu proses penuaan yang menyebabkan peningkatan risiko tekanan darah tinggi adalah penuaan
dalam sistem kardiovaskular. Proses penuaan dalam sistem kardiovaskular juga mengakibatkan pengurangan
sel “pacemaker” yang mengakibatkan “dystrhythmia”. Hipertensi jika tidak diatasi segera boleh menyebabkan
kerosakan pada arteri di dalam badan.
Rawatan hipertensi boleh dijalankan oleh ahli farmasi yang mempunyai ubat anti-hipertensi. Namun ia juga
boleh dirawat dengan refleksologi pada bahagian kaki. Dalam mendapatkan maklumat mengenai refleksologi,
saya telah menemubual dengan pakar refleksologi yang membuka klinik di kawasan Changloon. Menurut
Puan Siti Hajar Mohd Dzohir seorang pakar yang telah lama bekerja di sektor perubatan, terutama bahagian
refleksologi, pesakit akan mengurut pada bahagian pantulan untuk memberikan rangsangan yang diterima
oleh saraf deria, dan terus dihantar ke organ yang dikehendaki oleh saraf motor.
Apabila perawat melakukan urutan refleksologi pada satu titik, badan akan melepaskan beberapa bahan seperti
serotonim, histamine, bradykinin, bahan reaksi perlahan (SRC) dan bahan-bahan lain yang belum diketahui.
Bahan-bahan ini menyebabkan pelebaran kapilari dan arteriol dan tindak balas suar hasil pembaikan peredaran
mikro darah.

33

Kesan refleksologi relaksasi akan menyebabkan kekejangan
otot kerana vasodilasi umum akan mengurangkan tekanan
darah secara stabil. Urutan perlu dilakukan supaya dapat
memberikan kelegaan kepada pesakit. Sistem saraf yang
lemah akan menyebabkan penurunan tekanan darah.

Selain itu, urutan juga adalah sangat penting kerana
ia merupakan suatu bentuk latihan pasif yang mampu
meningkatkan peredaran darah dalam tubuh badan. Semasa
membuat urutan, reseptor saraf akan merangsang tubuh
dan akan menyebabkan pembuluh darah melebar secara
refleksi sehingga melancarkan aliran darah. Akibatnya,
peredaran nutrien dan oksigen ke sel-sel badan menjadi
licin tanpa sebarang halangan.
Peredaran darah yang lancar akan memberi impak kepada
kelonggaran dan kesegaran dalam semua anggota badan
supaya berada dalam keadaan yang seimbang. Walau bagaimanapun hipertensi akan lebih menyerang orang
dewasa yang lebih tua. Antara risiko yang akan dihadapi adalah seperti obesiti, hypercholesterolemia, dan
stres. Kebanyakkan pesakit yang hadir di klinik refleksologi adalah warga tua yang berumur 50 keatas. Namun
rawatan refleksologi sangat penting bukan hanya kerana gaya hidup yang tidak sihat, malah terdapat banyak
faktor yang memerlukan seseorang itu melakukan rawatan refleksologi.
Faktor-faktor yang diketahui seperti stress yang mengarah pada rangsangan berlebihan pada sistem “saraf
simpatik”, penumpukan sodium daripada pengambilan garam yang berlebihan, dan faktor keturunan yang
masih belum banyak diketahui pada masa ini. Jika terjadi sesuatu perkara pada kesihatan tubuh badan, kita
haruslah mengenalpasti tanda-tanda yang datang itu merupakan suatu penyakit yang serius ataupun tidak.
Sebagai contoh, keadaan awal hipertensi yang perlu dititik beratkan adalah sakit kepala yang menyerang
belakang kepala, hidung berdarah, dan berdebar-debar yang kerap pada jantung.

34

Rawatan Islam:
Oleh: Ahmad Nizar bin Azham
Pernahkah kita berdepan dengan satu situasi dimana tiba-tiba kita terdengar satu jeritan dari seseorang yang
telah terkena gangguan makhluk halus? “Aaarghhh...sakit..! Jangan kacau aku..!” jerit mangsa. Suara pekikan
itu cukup untuk membuatkan sebuah blok asrama di salah sebuah institut pengajian di Pahang ini menjadi
sunyi sepi. Kelihatan seorang lelaki berkopiah putih terkumat- kamit mulutnya melafazkan bacaan ayat-ayat
suci Al Quran. Kekuatan makhluk halus di dalam badan mangsa tersebut semakin lemah dan akhirnya mangsa
telahpun berjaya dipulihkan.
Sesetengah orang akan cuba seboleh mungkin untuk tidak terlibat ataupun mengelak daripada menyaksikan
perkara yang sebegini. Ada juga sebahagian yang lain menolak untuk mempercayai akan kejadian-kejadian
yang melibatkan gangguan makhluk halus ini. Bagi mereka, ia mungkin tindak balas sains daripada minda
seseorang yang terlalu stress dan runsing.
Walaubagaimanapun, sebagai seorang Muslim, kita perlulah menyakini dengan
sepenuhnya cabang keimanan dalam Islam iaitu beriman kepada perkara ghaib.
Dari sudut perubatan moden pula, kaedah rawatan Islam sendiri telah diiktiraf
oleh Kementerian Kesihatan Malaysia (KKM) sebagai rawatan alternatif
pelengkap yang mempunyai kekuatan dan kelebihannya yang tersendiri.
Apabila seseorang itu telah terkena gangguan jin atau makhluk
halus, sudah tentunya mereka akan mendapatkan rawatan
alternatif. Hal ini kerana perubatan moden tidak dapat
membuktikan perkara ini mengikut fakta sains. Terdapat
sebuah hadis Nabi Muhammad saw yang bermaksud
“Sesungguhnya syaitan akan berari-lari dalam badan
seseorang anak Adam melalui pembuluh darahnya.”

35

SatuJalanKeluar

SEBAB JIN MASUK KE DALAM BADAN MANUSIA
Menurut mantan Profesor Madya Akademi Pengajian Islam Universiti Malaya, Dr Jahid Sidek
menerusi artikelnya dalam majalah Al-Islam menggariskan beberapa sebab kenapa jin masuk ke
dalam badan manusia.
Antaranya ialah jin dan syaitan masuk sendiri tanpa diundang kerana jin dan syaitan adalah musuh
manusia. Kita semua sedia maklum bahawa syaitan adalah musuh yang nyata bagi manusia seperti
banyak kita temui di dalam Al Quran mengenainya dan ini adalah cara yang efektif oleh bangsa jin
merosakan manusia dengan masuk ke tubuh manusia dan menguasai jasmani dan rohani mereka.
Kedua, jin akan masuk ke dalam tubuh manusia melalui sihir dengan pelbagai tujuan. Selain itu,
seseorang itu sering mengamalkan ilmu atau amalan yang melibatkan jin dan syaitan seperti ilmu
kebal, penggerun, penyeri muka, pelaris dan sebagainya. Seterusnya, jin dan syaitan juga boleh
masuk ke dalam tubuh manusia melalui saka atau keturunan daripada nenek moyang, datuk nenek
atau ibubapa kita. Akhirnya, gaya hidup yang selalu mendedahkan diri dengan amalan perbomohan
seperti penggunaan tangkal, azimat, mandi bunga dan sebagainya. Namun, perlulah diberi perhatian
bahawa terdapat dua bentuk rawatan alternatif bagi mendepani gangguan makhluk halus iaitu
rawatan secara Islam dan rawatan yang tidak patuh syarak.

36

• Kaedah bacaan ruqyah
Perawat akan menggunakan ayat-ayat Al Quran, zikir-zikir, doa dan hadis-hadis Nabi Muhammad saw.
Kaedah ini menyebabkan jin ini kesakitan dan meronta-ronta untuk keluar daripada badan pesakit.
Adakalanya jin akan keluar melalui muntah, najis dan sendawa angin ataupun pesakit biasanya akan pengsan
sebentar apabila jin telah keluar dari badan.
• Kaedah di pusat rawatan Islam
Pusat rawatan Islam di Malaysia seperti Darussyifa’, Sinar Zamdurrani, Tibb An Nawawi dan sebagainya
membawa botol-botol berisi air mineral untuk diruqyahkan. Kaedah meminum air ruqyah adalah selari
dan bertepatan dengan syarak kerana ianya bukan sahaja disarankan oleh Nabi Muhammad S.A.W,
tetapi juga melalui petunjuk al-Quran. Sebagaimana telah disebut di dalam al-Qur’an, Allah S.W.T telah
memerintahkan Nabi Ayyub A.S minum dan mandi menggunakan air yang terpancar dari tanah selepas
baginda menghentakkan kakinya.

37

• Kaedah mengeluarkan barang sihir dan memusnahkan tangkal-tangkal yang ditanam atau digantung di
kawasan rumah atau dimana-mana penjuru tiang rumah.
Penulis pernah berpengalaman sendiri menyaksikan di depan mata bagaimana mangsa yang mengalami
gangguan sihir memuntahkan barang-barang tajam seperti kaca dan paku apabila perawat membacakan
ayat-ayat ruqyah. Mengikut logik akal dan sains, sudah tentulah perkara sebegini tidak masuk akal dan sukar
untuk dipercayai. Namun, percayalah, ia telahpun berlaku sendiri didepan mata penulis. “Kebiasaannya,
pengamal sihir akan melakukan perkara sihir ini secara bersendirian dan mencari tempat-tempat najis atau
tempat kotor untuk meletakkan barang sihir tersebut seperti tandas atau rumah-rumah kosong yang tinggal”
tambah Dr Khader lagi. Apabila barang ini dijumpai, perawat akan menuang air ruqyah ke atas barang sihir
ini ataupun membakarnya dengan niat membatalkan sihir tersebut.

• Kaedah Mandian
Kaedah ini merupakan asas yang kuat dalam agama Islam kerana Nabi Muhammad saw pernah menyuruh
seorang kanak-kanak yang terkena gangguan tidak boleh bercakap agar mandi dengan air yang telah Baginda
SAW ruqyahkan. “Mandi ais juga dapat memberi kesan yang baik kepada pesakit kerana ia didasarkan
kepada firman Allah dalam Surah Sod ayat 40-41 tentang bagaimana Allah perintahkan Nabi Ayyub AS yang
terkena gangguan syaitan agar menghentakkan kakinya ke tanah lalu terpancarlah air sejuk untuk Baginda
minum dan mandi “ menurut Dr Jahid Sidek lagi.

• Kaedah Tepukan
Perawat tersebut akan menepuk-menepuk badan persakit dengan tepukan sederhana kuat menggunakan
telapak tangan yang tidak menyakitkan pesakit tetapi sebagai isyarat untuk menyakiti makhluk halus atau
menepuk keluar bahan-bahan beracun dalam badan pesakit atau sebagai isyarat untuk mengarahkan
makhluk halus keluar dari tubuh badan pesakit. Dr Khader menyifatkan kaedah tepukan adalah kaedah yang
menepati sunnah Nabi Muhammad S.A.W dalam merawat penyakit-penyakit tertentu. Sebagaimana kisah
sahabat yang bernama Uthman bin Abi al-`As RA menceritakan bahawa beliau pernah diganggu oleh syaitan
dan baginda SAW telah membantu merawat beliau dengan menepuk-nepuk dada serta meludah ke dalam
mulut beliau.

38

39

40

Scalp cooling is a simple innovative treatment that
can help to avoid the major pattern baldness
caused by chemotherapy. It has been around
since 1970s in Europe and Canada with
the more conventional manner in
which more thought of putting
the ice pack on the scalp of
a patient while they were
undergoing chemotherapy.
To put things in
perspective, scalp cooling
includes the utilization
of cold cap on the head
before, during, and after
chemotherapy to choke
veins in the scalp. The
goal is to decrease the
flood of chemotherapy
to hair follicles in the
scalp, interfering with the
capacity of chemotherapy to
avoid major baldness without
influencing the practicality of
the actual treatment by helping
shield the cell from the deadly
effects of chemotherapy.

41

MAINTAINING HAIR AFTER
CHEMO MADE

POSSIBLE

There are two main kinds of devices used to prevent chemotherapy-initiated alopecia—manual and automated.
The manual techniques are more established however, the manual strategies that are currently accessible can
be very viable. A gel-filled cap is chilled for something like 24 hours, set on the head, and then secured by a
protecting cap. The gel cap begins to warm when it is set on the head, so it is exceptionally cold at first and must
be exchanged like clockwork.
The automated devices utilize a little machine on wheels that can give scalp cooling to 1 or 2 patients at once.
Coolant moves through a hose from the machine to a cap that resembles a swimming cap and comes in a few
sizes. The cap is utilized amid the chemotherapy and for around 30 to 45 minutes beforehand and an extra 20
to 150 minutes after the infusion closes. The automated gadget has appeared to be more practical since the cap
does not require replacement at regular intervals and it additionally keeps up a more consistent temperature.
Being diagnosed with cancer and the list of endless treatments that must be endured is hard enough for the
cancer patient to face. Hair is incredibly important for both woman and man. Hair can significantly affect the
overall appearance of a person. Even to a hijabi who covers their hair, they still protect their crown underneath
the veil. Despite the fact that hair loss caused by chemotherapy is typically temporary, numerous patients with
cancer think of it as a huge and distressing side effect of treatment.

Scalp cooling has been a game changer in
helping breast cancer patient to regain the
confidence for years. Hopefully, in the near
future, it will be available to help all patients
with any type of cancer unexceptionally and
more centres will carry this treatment so
that one of the most devastating effects of
cancer treatment which is hair loss can be
avoided.

42

REHABILITASI
STROK
Oleh: Nur Safaat binti Zakaria

Strok adalah satu keadaan apabila otak kehilangan bekalan darah sama ada kerana salur darah tersumbat
(thrombosis), salur darah menjadi sempit (stenosis) atau salur darah pecah yang terjadi di dalam otak. Otak
adalah pusat saraf tubuh yang mengawal setiap yang kita lakukan atau fikirkan. Di samping itu, otak juga
mengawal fungsi-fungsi automatik seperti pernafasan. Untuk berfungsi, otak memerlukan bekalan darah
berterusan yang membawa oksigen dan nutrien yang amat penting. Apabila saluran darah di dalam otak anda
pecah ataupun tersumbat, bekalan darah akan terhenti dan sel-sel otak akan kekurangan oksigen dan nutrien.

Simpton Strok Pencegahan Strok

•Lemah atau kebas pada sebelah bahagian •Pengambilan makanan berkhasiat dan tinggi dalam
badan serta bahagian kaki atau tangan. protein

•Simpton penglihatan menjadi kabur pada •Pemakanan yang sihat seperti kerap mengambil
sebelah atau kedua- dua mata secara tiba- tiba. makanan seperti buah- buahan serta sayur-sayuran
mampu mencegah strok.
•Sukar untuk bertutur
•Pemeriksaan juga hendaklah dilakukan secara berterusan
•Mengalami masalah penelanan setelah bagi mengawal tekanan darah.
diserang strok.
•Berat badan yang ideal adalah salah satu pencegahan
yang terbaik bagi mengawal penyakit strok ini.

43

44

‘Kami di Jabatan Rehabilitasi membantu pesakit untuk kembali berdikari,
memulihkan pesakit yang patah semangat yang memerlukan motivasi
serta sokongan dari segi fizikal dan mental’- Dr Nor Hanim Binti Mohd
Hanappi, Pakar Perubatan Rehabilitasi Hospital Raja Perempuan Zainab
II.
Hamidah Awang, 45 tahun telah mengalami strok dimana beliau lumpuh
sebelah bahagian tubuh badan sejak 2 bulan yang lalu. Beliau telah
membuat keputusan untuk menjalani rawatan rehabilitasi bagi merawat
strok yang dialami. Beliau juga mengalami kesukaran untuk bertutur dan
menguruskan diri sendiri dalam kehidupan seharian.

Kaedah Rawatan Strok

‘Kami bekerja dalam satu pasukan bersama pegawai perubatan, pegawai fisoterapi, pegawai terapi pertuturan,
pegawai cara pulih kerja, pekerja sosial serta keluarga pesakit bagi membantu mereka supaya kembali
berdikari seperti sediakala’ kata Dr Nor Hanim. Tambah beliau lagi, ‘pesakit yang mengalami kecacatan perlu
menjalankan terapi bagi membantu mereka untuk kembali pulih’.
• Fisioterapi - mempercepatkan kadar pemulihan sistem neuromuscular yang terlibat dari segi pergerakan
voluntari, keseimbangan badan, koordinasi pergerakan, mobiliti dan keupayaan berjalan dan membantu untuk
mengembalikan fungsi harian dengan cepat dan kebolehan bergerak yang optima dan berdikari (optimal
independent functional recovery).
• Terapi pertuturan - bagi membantu mereka berkomunikasi dengan orang lain.
Rehabilitasi memainkan banyak peranan kepada pesakit khususnya membantu mereka yang baru sahaja
mengalami kurang upaya. Diharap rakyat Malaysia sedar mengenai penyakit strok yang mampu mendatangkan
bahaya serta boleh mengundang maut sekiranya tidak mendapat rawatan. Cegahlah sebelum terlambat.

45


Click to View FlipBook Version
Previous Book
Nothings
Next Book
Петровская В.Ф. Neat