The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.

Deko-Light 2019 Light Impressions catalogue

Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by morgan, 2018-06-08 10:10:05

Deko-Light 2019 Light Impressions Catalogue

Deko-Light 2019 Light Impressions catalogue

INDUSTRIAL | Standard lamps

NEU
NEW

343016
Page 316

STANDARD LAMPS

Standard lamps are both a practical and flexible light solution
at the workplace. Not only a useful illumination part,
moreover they are also an individual element in the room.

The OFFICE series features a low glare value and fits ideally
in any screen work station. The series is complemented by
the models ONE MOTION and OFFICE TWO.

312

313

INDUSTRIAL | Standard lamps

OFFICE ONE MOTION | UGR <19

Aluminum NEU
Dimensions L x W x H: 1950 x 310 x 30 mm NEW
Base L x W: 460 x 300 mm
Dimmable via On/Off switch
Movement sensor | Motion Sensor
Daylight sensor
Power consumption: 80 W
UGR <19

343019 silver NW 4000 K 6500 lm A+

110-240 40 / 40 SMD 80°
Volt 2835

Matching standard lamps | 342073 | page 251

Touch switch

314

Montageanleitung /
Mountinginstruction

AA: :BBewewegeguunnggssesnensosor Ar/ rM/tMiokoteitoliNonnrS. S/eAnensrtosicorlre No.: 343019 BB: :TaTgageselsiclihchtstesnensosor r/ D/ Dayalyiglighht tSSenensosor r

AA::BBeAewAw:e:eBgAgBeu:uwenMnwgeogsgetsisguoseunnenngnSsgsseosonressr/neo/MnrsMosooortSitr/oiotM/nenMhoSloSteeitoueniconnshnsoStoerSer,neOnsfosfiocrer One Motion / FlBoBo:r:BTl:aTaDBamgBag:epye:s,lTisglOaTilhcigfacfthigehcStseesteslseniOeclnsinnhcoseshtrosotrMesr/neo/DnstDioosaanoryylr/ilgiD/ghDahtyatSlySigelienghnshtsotSorSernensosor r

110-240V AC/50-60Hz, 80,00 W (40 W / 40 W)

AAA:A:B::BeBBweeewewwgeeeugggnuuugnnnsgggssssesssneeesnnnosssrooo/rrrM///MoMMtooioottitnioiooSnSnenneSSsSneoeesrnnnosssrooorrr BBB:B:T::aTTgTaaaegggseeelsisscllilhiciccthhshtetstssneeesnnnosssrooo/rrrD///DaDDyaaalyiyygllilhigiggthhhSttteSSSneeesnnnosssrooorrr
A: Bewegungssensor / Motion Sensor B: Tageslichtsensor / Daylight Sensor

1.1.LeLuecuhctheteeienisncshcahlateltnen/ / 2.2.ohonheneBBewewegeugnugngninmimmmt t
tu1t.run rnononthtehelalmamp p
2. HHelelilglikgekiet iat uafu3f 03%0%abab/ / 1. 2.
1.11111..Lt.u..etLLtrLtuuunLLttueeuuerrceeruunnorruhn1uunnccncto.o1cchheohoonnthh.ttntLhtenneutteteteeeLtithrhuenttehuneehheeleerisieacnuinneeiionchlmnnlscsalahnsollatsschcaamempcanmcchhttmmhlehhhpepatatpaeepphaaillentltnellteeilttsenaeenn/clnsmannh/c/m/pa//hlpateltnen/2/.22222..Ho.A..heHowHroHo:newHrHoolhhelieeheBdiethhnngieehlldnt2ulelnneheikBlllioueglliwg.c2eeiigeoueggckBkeBe.kBiuwwrHrotwkkeBBetegeeeeettheeepwwrHroiaiieiueeowddwttttiteepnwiitrhohhunlwwgiiettuualeaddettr3eeianoogfehhulaaegccu3eesuuugl0gsueuu3igoonsuukeeBefg0ggfccus%uftt0uuueegffn3keeB%uue3enntt3pp%nttni33ooenc0nnw0tgegn0ttrrgppc00sei%oogg%aeewti33e%eoanmrrn%%ussneea00gb33ennrbiieeambfiamssu%%ur00giiam/aamminnbr3b/eefngM%%ubmmtibbccmg0nn3ghmmn/o/ee/th%tcc0t//gttnnttieet%bbonienamrrnbbesiiibamggrrsmSiibhhsgg/emtttnhh/nntstteennosseerssssss
B: Tageslichtsensor / Daylight Sensor

CCCC:CC::::: CCCC:: :: DDDD:DD::::: DDDD:: ::3.33333L..wotS.u..ehLiLwotwotrcLtSuSwotunuLLnehSwwoottehuhSSeicuuihherreectucithhounrnniicthnhouhrrnccttuun33ahcnnuhcheBnnehhtcofhoecchoehh..hofoeelt33ooahoeauuBthhBooatftaufBp..aaLLeetuunwfewwoottBBlftltttffSSeef3e1uulttrt2341 3eeffeeellattahhrLLatptpwwootteeeeiinwenawtt...rrSSep.ccuu...tteaauunwppfnneefreennnnhhwwgr hhasEarft iirwtdttrreeerrwhccaffLehhccrttrreeteuuwotLteueaahnnueoorrcttnnchheeeueeueghhoo3gsiceEeesEcchrhhiergaarcceene3snhiuuEinBBggootrrssrtutteEEhtffu0tneurrhhoonhhuhuee3ngeff0ine3hllcihttaauuuueeneesBB33nnil3cnnttttnffe33iinoac30naaec0monoeeoppffnnll33ttnneenngwwsnn00hmogc0otcee00smhttg0sutcffunurraaBgge00csppccaaetmrrftteteeennnmiwweesseestmeesitmfmtneehttthffeensmmccrrmeelptaattggessrrcttmmesscttEEeeteelai.rrtemtipaechheehm.niwnthiineeccucchhhuuheenttlniiggienlhssftEEhlr33iiniirrannehhlahhhh.eltt.uaennlennela33onn.ennn.uuleeoi.ueeaeua00.bll..ceen33aaiiul..rgggl00avccSasluunn33vnntnnlmtrlgssllanahnns00lletaelSaaaaeueebe/mmnbtteggll00eadccessnnmmmb3stteeaacssetmtgbbmpmgn3nemeetieemmmccgn/0htt/ttiiessmmmmggdttdng/iio0nnhhcnpedhhe//pnnsllppeeccddaeeittieiipeellen..emeeseiiiaappnnhhno..nhhsmiiennuulnll/nneetonnllll..SSaaeecr4aae..tttailltCuuSnntieenaahr/h/,bbn.llC/,SSaaueen/tt4ll4//tt.nnmmegga/weeaa4Sb.SbbSltnn44eetBia//S.wr.addd/sSSolhttSmma.rggeeetssppl..wuwnnwmiiei//ii3e1awtiaBmddietaBiewrbeedgtddwoodwwsnnteeshtBaith.sswr.ppdewttiBaaiBtsimhcwhruiiodduiieihsseieetphrrueeieulooeeLenn/LieiaietCCwotddtLtdcduutaieiiotmiieeetthuutwd//tdwtieeethcceepoht//ctteorrcdddwtiehuiettntmhrc44CCrlouLtlwwguLeinehccuuooaennSSaholu//mehSSLahmueeechu//tc4llcatcLLAeo..emeetuhc44eaaoetoemmmceephhmuhrogetoacttgSS.ceSSwwehwwmteesuuagiuBneeapnu ..mmtcfettBiiBaaucnAggcodAhalddtuuteuefsscthhaapAt2suulep4etwwtuwwcgccttiircsAAtauuytptuuuaiiitttpiineettcaaiiBBttpinetnweppjddeeetttcohdeeccss.hc3editt.SnhhtthpccddeeftrulttiitriicornndpatheegwwuutarOgteiieltccoiicceddeeaSttwshhooutaiuetnehh0geetyereetjcntteeattjllccddutiaBLLggg3etrstwrHosettdusaajaauuresuwwllttmmrheehulhhr3esccsadejjoo%FettaaeluAehhlus3eeneerhcueenw0anllyh3iteeeLLuuylllcmmrrsmnieggeaamaannsAe30nllsuymmsouneeuFsdhhsdethnntt00shaaotyyuuess%ussnccweeg0eAAchhsseeccuuouulmmwsscsw%tpmeggcsateppumnaosslmcttln%ccwLnettmotaaouueeaccmihansewwemccohoiinnmlttoeAAeeoeommuungttcchhddcSSlchhohroocppemtteahhtmfcceitoottthamncnnauggngintthpmiishhrhnneaaectuukeBeeeneaettnebnmmaccuddSSeehhjjtaaecnne.eleeeelatutt.eearieeeggtuutllearrtttlnppnnaaaanrtuuAAecsll/tttatnnllletsaeeneejjtnnnbrtyyiaalnpttieeetennnntioeacossrbuullhcuussbrrgeewiitttaassibAAtsllptssnnprettscgt3nnrmstitsyyaccspuhwwrtttiisttihss/oommsppuueassedr3rschssr3eeoosgScssiiss0hhipoolrrciecgcceaicwwitlhhrrrrttSsuccnehgeooe0mmhniimmc0ghynaaooenneehcchbhhsshoohsueehhmeeefcihnhhhrr%sse%utBellmmnhhnsseeceeaaweaannttttnnnnnneee2e43bBceetboneenneeeeshisonibiillnntt..en/aabbhnnecttine0nnnneiittmsgesiippnnnaoeencissecessnntBaisttweeHroeesd.cis%ihos/rrecciiSSettlcc/reiuppiihiseassst/nieiieensseeeccdd//treesethh nwbrrhSSsoeeccltiieihhussllLeeiecciaamomperBBhhsgtcnnseeeeeeeemhhiugssbkeBbbrcaguicssBBiinnmtunneceeeeepnntecteehthbbinoopeicc/cohsshsiiwnnttiigtnnrtaeeut//trreeeeooae1233eeccnlrbaliiusn0gyin//rree...seune312ef123s%ucw132ctn3s113223oni...h...o/ehc...0lDLWTaETWTHvmgsa....niee%gloEuirahhtnineiTlHWEaTTLWDvcHvlWTDaTLWETeen3be 3 12heihtaHTWTLTWEvlDinireeigamaTaHDvEWWDHTLTTllEWTWLvTigrpolhEuroris.Eu.rihhsnhhiasiing..ieieloeictiEuircbhhenrggceikenehigooeEEie iuuehhHiirrchnthhhmrn2eii rceneegtTwaWtTbTieei131232eheeedbccnhrhlhnnrhlteennrheeehhneeasehhnno/ashleohnnsnrhrrletetoeueeee0stnkashhikerrrhhll......nkletiHratHt331212eennt2aassnn2gtlleeknigtbdlittnnHbdnfiebndtntit2tkkirhiingteel°tHHoibdeeneolgttnonogey22teeoehn......ggttnoe0usbdbdeenn0kelnnnookearhttear2aoecee0ooiheooekliees123nralflheooeTHEWWWTavTTTaEDHWTvDLLlndntifithlu00ditgisetekeki/el°nnaarreel°liinfbdlgyiidhitgyhns0sihnutnllel°nnutlgenffgalddongiittoo...EEgyuu2tiiiirrnnanh2tceenll°°hhhautikhTaTDvHWTDEWTHWWETTaLlLlvlliilihidguggyyeiieilnnhhccnt2arlhuuuttantegsen°iinulleennihgeseetnaheehnitnih22hliaanhnnnthhrru0hggiihhhsUgesi0eooiiteeeEEsuutngeiirrllinnttgeeshhhhtrrhhhllhyuuiiaggsseehg0tciieenttnnnstcnnkecceneiiaassgeknndgubeellddhhgutwennu00teessehethTlWHEvTWTLaDetcnn°ahhggeeelkn°iannkkiirrdguahaHHlhmeeeerttccttnnimhtkk22eUanh°herrtlhlhtddgguugttUaesstdbdbihnnesinnagnngeeessassnnn°°ttohleleeuaanUrietelhtehhneeghheoobieeooiesbtwvuhheeiekktwUUiiueeeoeottcatHHn00lmetaiwersttseesskkeelenbia22oeararrhetwamueggttdhnnmmbdbddeeeemnagnnatennarblaitsttesrtwwllhuueenasnndinerffgmiddseenaaittmdlhgoollsgoo213niiiianntlee.aaaeell°°slireeeoommnllasiimmev00nggyyglesaavnnkekettenhnhtitraraessuuttrrmltwrswniillmpiewrggsstnn...ievetdtd22bHeraallddlltgnnteeffobdiieeiihhmg2ddwrseiittsvvigtdensiilllnnbdednettdveell°°ttnhhuunmmgdsllhwwrrmssggesestegdggyyrttnnbsnhnhaeeiiddedenuuttoddosgghhnblleee00sgnissieesseoeiwns22fieddennggeee0paaewnupekaotdiihhggWTDHLvTWlEaTbarntdrelosiibtccnnireelleekkennttwnehhmiuuddgguupuggessetnneelsdtvlttnnbiineeefrveeesriimgwwnndnn°°iteppsdopmraauibhhrida00rtdtdhhhhbelbb°ssn2irrhlnveimrbtggeeeehhgycsbUUimreetthndisrinneSbuteehesuttccvvnneesslhaenuobkksnmmabrolosaddgguuddrr2nnieelbbosgaeeeessbblheihueeunnn°°tbbttwwauuuiowldpa0tiiensaldoslrnhhsstleaahurllpeetuuiigsepaaawhhtooaautnUUatneehllioossttmminglnmmrHethentrmrtaarneesshtts20puurihagStsssttrraidbiSlliinnngennnbghggeerreessntnnnmrtbabb°ippTreagttwwaauullotcoingeScnniieehhkeennnaaeommrrttvvndgllben0diiberrkedsiadaaaaensiittaroSSdvcgmmidmmewwrrssn°mmennwtbbaeaanwttaaeelddhglndeeefsseggrrddddgaitegglniieeeeihggnhhsseenneUl°nssewthilndddduneeneeglyiddgllghneslegeliieeirutggeTnliuvvowwrTihca2eiecggahtteeeebimmgihwwrrssnnnneetwsiuipanshhilTeesdgmctaeeifdeeinshiiddwwnnudaccgseidppetgglditncggbteeenddttiiiabbTTemssrrsmhaa0elensdddeenngccnmeesdcaifdelhfragetthnggrwsrssnaavvnnsstcilneddlcceiiddkssammlsenlaudgeoddttrriehubbanno.eeilhnaheriieen°eeieeeeaahasdwwnneelldbblivpphlpehhiigmupfotdtdhhsnnssbbigmtUafee/rreegtmuuwrschellaaeeellooeiseecemtuulloossooepdmiienaagmefedsfvvdnrhhgsbcefseiifuurssrtw/mmucttterddsppllrdaenbbmggmme.lfferrianaeoppefgefmaccrbbt.aaeemehrreaii.mmtnnlhhhrnndssssrDmmrrttnneeeidsffuuffrrrsnnaaaemsoosreiiteSStimle/.lglloosssehmwnire/gnnnpbbvsdstaaaatduueeteeetn(ttrggm..riwrsehhssllmrrreciens/gsrreee/nnssdddcstascppwd/ddgeetetddeaa.ssvcefemm.tnndeno//gghhvsnnsmtmmrrttocwwmsd.gr/errttbtiseggiieeeDSSeeee.eDssnnnbnneccssfmsobbihh//etilemttoownaassiittplsigcnehgeegg..idtusDeeariioosoheeTTnnne(elosimsn(bSddereecceetliinddürviiDDnscwmmuhsdtrcwsswwsmmssbaannsslctt(lltddcciiddivcrggtiibrteeteeittnv.phisstrlnns.aidcwahhunnee((einaehiioaainlleecrrmtltosteiinngghhvrtoeoeiicccwwn.igucTTSoohtnigcltecchylltcsttnllereebhvvpttuueoohasa..biiSaaeingosshobSiiünaa3nnsshhmtgceddhccüiiiireeddnoaiSanttppmhdggmmnoodboefffbSggcceeatthheehaagürccitlreleleeehwärhhlahsnmmeeadnnebbSSgdnneteeiffcüüffrrtnll.teellwerrhhleenuuioogiteiiraeenyttaaacntgeytngthhhaastttsiieehhieerr Tlli..tsgeehhppvaarricggmmnTcffsddsteonytctthaneeoacdaneeeeseesfssannssmmmmansdnn//iggofhdididttreeyyhttnntttäffirsffttrroäanssserreeeaeeiiledecassfheleccssctn//hiroottaahaannssäleeneelsetaee....uodhfftaeingrraalool.ecngddssiirrituooääenisseerpteaegmcofassDDnmmtaeeech//ggicccnaenghcmmssnmapncttllattdgmtnhnffefiieerttaathercsssstnntcggnccehssnynn//((ametttaniidesseeeerr(.iindnneeeh..cchrbffrrinnihsdthhnooccwwrriaahedsnnneccmeaeettgdohhdevveaaDDsttattottf..nreeeeoih.niimmssshnnerttcllsaee/ddedtesdiiesace.crsscadiioohhoooocnsaggdccnnt((mehhgeiioddrdteegrraaiiannthhttelceemsooccwwnnbbtSSoleemeeaddibüüsrtccsethcbsrrvvtt/ne(etttccirs..rcceieHnaaddee.oiiea1hcwettooaeehhrbrrttcllrt,ervrtaae.leeeoocooeeilggccehttÄhhoeibbrarreeeereermshhrrrojottleenngceeehtttrdbbSSeeiyyettasroodhaüüaasesaelbSssrrrnl(müii.du0eimtftrdhintpreedoohoettaanncwhhrrrrHllhdlleffH1aaacttemtd1vrreddiirrttt,otthaaään.esseA,rlleeeenitlyHtmmeeÄnnnddcciltt1Ätteeyyttsehhiijs%,oossjegcttoHHaaaniihsSaeamls11nngglsaseefaÄahisooirrtt,,u0aanneäeesbSfju0accfffüpreellnndelÄÄhhspiiaeaaiirrsäänn.sstjjatu0hhngteefotteeessnitcchaaepAorlssenrcnnAantsnhnuu00ddeeanffnttaantthppsm%gnndggheeiihhoeens%AttnSnaddelees)teedaaaSyatanlsccannihoooohh(fnnsnnaAAaas%eeediernndlnnSaorhhsnsdlneoaccttanccc.ss%%aaddy.tcnnfcoadtSSaaiTkddjeeellssttrirdaaliiertätsseeerriihhentsb.entbbddtrrrmrrgeeuaaeddlleetrnisrrmgeeeeteooere)nnoa..eatsteaaee)oosrttaanangu(iirrtamg(eeeoccteerraerccrettssaddcsenn)etnnahrdttnrrattmmaggycl(nttaymeeedTkshee))rrtddhaaTkaansbbstdrrnrlleeHo((rrnbe1aarmmeeeeddybdett,neehhnooTkassaailnnlnihtÄerriaHHtryysajd11bheee1sueaTTkkseeau,,eotestonnerreoeu0rretfabblltattÄÄpeesiirrddrcclaaunneecjjcladlleonttgoeeaandmmnssddmssaadtdttsnonhhuu0deobeeeuuooc00lsae%bffnHHSanppildrls11reeeedaenilrnder,,ccollaeherrdlohallnddooteÄÄannnny.iirAAilddtetooaeetijjannaeetreetsnnh%edssnrlaariissll%%nsstrtemggtgSSaaiuu00llsse)ardffthhaaasaeppr(seeeetteeaabmabdSgsaarrmdrmdntttddllhieedryrrrooannn..TkAArHraggttabr1rannbiicggdra,eerrnttsseass%%ortaaannbbalrsÄdSSaattnllssiuddmmrrggndaargeonrjriijaaee))eairriaas)calrrsddzllsaa((dhsaadeennru0Sdmmdu..ofaaeSiehiimmdssttpnnineddniirilsnnyyrrneerrttsstiihiiTTkkSgnngemmdoteiggnttBmmggssrratnbbtenrnSSee))mmmmddagaaiinngeegggs%ttjs((nnaataajeeSasslesabsaz1auuessdrggsggznnaeeoogruaeyyhsrjumrehwdlnameTTkkeszccggllan.serrjjdtebbuddntrnneheimeeBddiisszzooennBeeteetssntttn0ndaanuuneeShhmmssdtmmiillemigpuusntBseeoote)ethhan1anggoaee1tteg(rBBaiccsllsaattttttgwsnnneesrrwjnndda1ennsddesedz%ooyjggsstseeetttsuTkeehennhaam11wneiillrsaabbn.0ubsrensse0ddrrhehhpwwtBnneeneptrrtteentaaessrrneeeosaan0nstttttaaoueerarra1pieortaaiitiggenn00sesnddwneonnpprrdD%csltsred%iiiiittaaecdbbteeec)hnndneeoohddrrdssson0.rresrrrdii%.SSpaammtttmmddhnrnrriirhee ilnehaaonn.rdd%%sitt.taahtrggeeggaeehhhtehddahd%tnniirrsside..aetieshirrei/iiierhhsggD.raDsshjjigcdec)iicdSSiec)eemmmmddsszzsiiaaaDnnabuunieeiihhrieii eimmncdsdrec)rssDgg.gg.DDr.aicdc)riiccddeecc))nharhBBhnigghrdtt.iadnni/jj.nni/rrdeesszznrsshhheh..ttidieiirdeuui/aa11eehhi/emmshhehhiisseddSemmedwwnnii//eeeeee.nte.ssBBee.ettttnngege.ssnn00.tteeppaa11gr..rjeennrssooeswwznneerriitttusseeehrmtdd%%t/tt.rreenn00eeehhBppss..tt.rrn.eehhnnoosttrrtii/tt.a1aaiidd%%siieett..sswneeeeehhDD/s/essiiccdd..cc))trrhh/n0nnrrp..aa//eniiiieeosshhhhriiDDiddtii//iiccddcc))d%eeteeeennhrrs...reeh..hhhhiiddii//aiieeeseeDrricdc)ee..nrtt.hhid..i/rreett

C: SchalteSr eSESnSeiesennnonsssrsoto/orerSr/l/lw/SuSSCiwntwcw:igthiitcStcechchnhha/SltSeeSSrnSweEeseniinonntssrcssoothorerrllAundSgejSeuSnSnesesen/nomnSssrsoweoorirntrcth Adjusment D: ErDk:eEnrnkeunnngunsgbseberreeiicchh/ /DDeteectteacblteaAbrleea Area

C: SwitcMMhMMooAdunoojuntunastntmgiantCeeiggnnCCaetCignnaSisnSlneeetnslnries0stutooruirrcutCnCu/tcSignoAtwigAnoi/AtAScneh/nosfof rSSAenesBAnorsCBB/oBSSrewniotscfhof rSBeSBneAnssoorr D: Detectable Area

Sensor

B

1 on off

Artikel Nr. / A2rticle Noo.n: 343019on 22

SAS1tret1tihe0klh-ee2llue4Ncu0hcrV.the/tA,eACO,rO/ft5f3iifcc0file-ce6eO0NOHnoezn.:,eoMf83fMo04t,3oi0o0t0in1oW9n/ Fo/(nlF4ol0oor2oW2lralm/a4m2p02,pOW, Of)fifcfiec2eOOneneMMotoiotinon
110-240V AC/50-60Hz, 80,00 W (40 W / 40 W)
2222

Sensor 2
Sensor Sensor

A: Motion Sensor

C: Rotary Switch B: Daylight Sensor

A: Bewegungssensor / Motion Sensor B: Tageslichtsensor / Daylight Sensor 315
A: Bewegungssensor / Motion Sensor B: Tageslichtsensor / Daylight Sensor

INDUSTRIAL | Standard lamps

OFFICE TWO | UGR <19

Aluminum NEU
Dimensions L x W x H: 1950 x 310 x 42 mm NEW
Base L x W: 450 x 270 mm
Dimmable via On/Off switch
Power consumption: 80 W
UGR <19

343016 silver NW 4000 K 8300 lm A+

100-277 40 / 40 SMD 115° /
Volt 2835 75°

Rotating switch / dimmer

316

OFFICE ONE | UGR <19

Aluminum
Dimensions L x B x H: 1950 x 310 x 30 mm
Base L x W: 460 x 300 mm
Dimmable via On/Off switch
Power consumption: 80 W
UGR <19

343018 silver NW 4000 K 6500 lm A+

110-240 40 / 40 SMD 80°
Volt 2835

Touch switch / dimmer

OFFICE TRANSPARENT | UGR <19

Aluminum
Dimensions L x W x H: 1950 x 310 x 20 mm
Base L x W: 460 x 30 mm
Dimmable via On/Off switch
Power consumption: 55 W
UGR <19

343022 silver | transparent NW 4000 K 6000 lm A+

100-277 55 S2M83D5 120°
Volt

Touch switch / dimmer

317

INDUSTRIAL | Display luminaires
318

NEU
NEW

688019
Page 320

NEU
NEW

688020
Page 320

NEU
NEW

688023
Page 320

NEU
NEW

688022
Page 320

DISPLAYLUMINAIRES

Display luminaires are designed for their specific use in
glass cabinets, showcases as well as with shelves. These
highly efficient lamps are easy to install and their timeless
design fits any environment.

319

INDUSTRIAL | Display luminaires NEU
NEW
KEID

Aluminum pressure die-casting
Dimensions L x H x Ø: 120 x 580 x 75 mm
Base H x Ø: 37 x 99 mm
Power consumption: 10.30 W

688019 dark grey 3000 K 800 lm A+

Volt

ATIS II NEU
NEW
Aluminum pressure die-casting
Dimensions L x W: 526 x 144 mm
Base H x Ø: 40 x 95 mm
dimmable via phase angle or trailing edge
Power consumption: 15.00 W

688021 dark grey 3000 K 1120 lm A
688020 white 3000 K 1120 lm A

Volt

ATIS III NEU
NEW
Aluminum pressure die-casting
Dimensions L x W: 200 x 144 mm
Base H x Ø: 40 x 95 mm
dimmable via phase angle or trailing edge
Power consumption: 15.00 W

688023 dark grey 3000 K 1120 lm A
688022 white 3000 K 1120 lm A

Volt

320

PEDRIA I

Metal
Dimensions H x Ø: 55.5 x 34 mm
Base H x Ø: 5.2 x 34 mm
Power consumption: 1.00 W

920128 silver chrome look 3000 K 70 lm A++

Accessory: LED power supply unit, 350mA | 3,8W | 3 - 10,8V
565014

Volt

PEDRIA II

Metal
Dimensions H x Ø: 179 x 34 mm
Base H x Ø: 5.2 x 34 mm
Power consumption: 1.00 W

920127 silver chrome look 3000 K 70 lm A++

Accessory: LED power supply unit, 350mA | 3,8W | 3 - 10,8V
565014

Volt

PEDRIA III

Metal
Incl. power supply unit
Dimensions L x W x H: 78 x 320 x 47 mm
Base L x W x H: 78 x 47 x 28 mm
Power consumption: 1.10 W

920129 silver chrome look 3000 K 70 lm A++

Volt

321

INDUSTRIAL | Display luminaires

KARVA II

Aluminum
Dimensions L x W x H: 265 x 26.7 x 44 mm
Base L x Ø:: 35 x 34.5 mm
incl. 1,5 m connection cable
Power consumption: 2,40 W

688006 black 6000 K 200 lm A+

Accessory: 24V | 6W Switching power supply
872630 24V | 36W Switching power supply
872658

Volt

KARVA IV

Aluminum
Dimensions L x W x H: 350 x 26.7 x 44 mm
Base L x Ø:: 35 x 34.5 mm
Incl. 1.5 m connection cable
Power consumption: 4.80 W

688001 black 6000 K 400 lm A+

Accessory: 24V | 6W Switching power supply
872630 24V | 36W Switching power supply
872658

Volt

322

SELLI

Metal
Dimensions H x Ø: 165 x 18 mm
Base Ø: 34 mm
Power consumption: 3.00 W

687031 black 4000 K 100 lm A
687030 silver chrome look 4000 K 100 lm A

Accessory: LED power supply unit, 350mA | 6W | 2 - 18V
872628

323

INDUSTRIAL | Display luminaires
324

MOBA

Aluminum pressure die-casting
Dimensions L x H x Ø: 616 x 106 x 100 mm
Incl. 1.5 m connection cable with power plug
Power consumption: 9.9 W

688005 white 3000 K 760 lm A+

Volt

MOBA

Aluminum pressure die-casting
Dimensions W x H x Ø: 110 x 608 x 84 mm
Incl. 1.5 m connection cable with power plug
Power consumption: 9.9 W

688012 silver polished 3000 K 760 lm A+

Volt

325

INDUSTRIAL | Display luminaires

ATIS I

Aluminum pressure die-casting
Dimensions W x H: 144 x 520 mm
Base L x H: 100 x 55 mm
Incl. 1.8 m connection cable with plug and switch
Dimmable via phase angle or trailing edge
Power consumption: 15.0 W

688013 white 3000 K 1120 lm A
688014 white 4000 K 1180 lm A
688015 silver 3000 K 1120 lm A
688016 silver 4000 K 1180 lm A
688017 black 3000 K 1120 lm A
688018 black 4000 K 1180 lm A

Volt

326

LOUISE I

Aluminum pressure die-casting
Dimensions L x H x Ø: 650 x 85 x 55 mm
Base H x Ø: 34 x 95 mm
dimmable via phase angle or trailing edge
Power consumption: 7.6 W

688010 dark grey 3000 K 510 lm A+

Volt

LOUISE II

Aluminum pressure die-casting
Dimensions L x H x Ø: 475 x 85 x 55 mm
Base H x Ø: 34 x 95 mm
dimmable via phase angle or trailing edge
Power consumption: 7.6 W

688011 dark grey 3000 K 510 lm A+

Volt

327

INDUSTRIAL | Power Rail Systems
328

170072
Page 330

170063
Page 331

900035
Page 333

POWER RAIL SYSTEMS

Busbar systems are implemented in the industrial and private
domain. They allow the flexible installation of luminaires. They
offer a specifically installation-friendly variant for ceiling spot-
lights and pendant luminaires The mounting of multiple lights
is also possible without any additional cabling.

329

INDUSTRIAL | Power Rail Systems | 3 phases | 230V

OGEL PAR 30

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H x Ø: 132 x 120 x 220 x 120 mm
dimmable via optional light source

170055 silver mat

220-240 max. 75 E27 ​
Volt

SHADOW PAR 30

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 150 x 106 x 250 mm
dimmable via optional light source

155311 silver mat

220-240 max. 75 E27 L
Volt E
D

COSTURA PAR 30

Aluminum
Incl. 3 phase adapter
Dimensions L x H x Ø: 196 mm x 235 mm x 121 mm
dimmable via optional light source

170072 silver mat

220-240 max. 75 E27 L
Volt E
D

330

DISENO

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 205 x 188 x 192 mm
Incl. electronic ballast

170063 silver mat

220-240 150 RX7s ​ 100° ​
Volt

331

INDUSTRIAL | Power Rail Systems | 3 phases | 230V

LOMIO

Aluminum
Incl. 3 phase adapter
Incl. EVG
Dimensions L x W x H: 274.1 x 152 x 185.3 mm

003416 silver brushed

220-240 70 G12 ​ 45° ​
Volt

EPO

Aluminum
Incl. 3 phase adapter
Incl. EVG
Dimensions L x W x H: 233 x 120 x 170 mm

003438 silver mat

220-240 70 G12 ​ 60° ​
Volt

332

OVAL LIGHT

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 145 x 115 x 45 mm
dimmable via optional light source

900035 silver mat

220-240 max. 150 R7S ​ ​
Volt 78mm

TUBA

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 182 x 118 x 223 mm

003459 white

Optional: Reflector

E003459 24°

E003458 12°

220-240 70 G12 ​ 40° ​
Volt

333

INDUSTRIAL | Shopfitting and exhibition construction

707013
Page 336

001248
Page 337

SHOP AND EXHIBITION CONSTRUCTION

Major attention is paid to the optimum illumination of your
objects in showcases or exhibitions. Discover the illumination
concepts in a product setting that promotes sales and
highlights your offerings.

334

335

INDUSTRIAL | Shopfitting and exhibition construction

STUDIO PAR 30

Aluminum
Incl. 3 phase adapter
Incl. color filter frame | 125 x 125 mm
Dimensions L x W x H: 230 x 140 x 115 mm
dimmable via optional light source

707012 black
707013 silver chrome look

Bulbs: PAR 30 | Flood 30° | 650 lm | 2900K | EEI: D
003122 Bulb75W | 2900 K | 500lm | Glare protection
100858 Bulb75W | 2900 K | 680lm
100853

Accessory: Barndoor | black
001621
001623 Barndoor | chrom
10115
10116 Safety cable 60 cm | Ø 3mm | DIN 56926
Safety cable 70 cm | Ø 3mm | DIN 56926

220-240 max. 75 L
Volt E27 ​ E ​
D

336

STUDIO PAR 30

Aluminum
Bracket height: 180 mm
Incl. color filter frame | 125 x 125 mm
Dimensions L x W x H: 230 x 140 x 115 mm
dimmable via optional light source

001247 black
001248 silver chrome look

Bulbs: PAR 30 | Flood 30° | 650 lm | 2900K | EEI: D
003122 Bulb75W | 2900 K | 500lm | Glare protection
100858 Bulb75W | 2900 K | 680lm
100853

Accessory: Barndoor | black
001621
001623 Barndoor | chrom
10115
10116 Safety cable 60 cm | Ø 3mm | DIN 56926
Safety cable 70 cm | Ø 3mm | DIN 56926

220-240 max. 75 L
Volt E27 ​ E ​
D

337

INDUSTRIAL | LED-spotlight for 3 phase busbars
338

003501
Page 340

707030
Page 343

707022
Page 343

LED-SPOTLIGHT

LED spotlights for 3 phase busbars provide perfect colors
[similar to natural daylight]. They are an ideal match for
clothes or jewelry shops, exhibitions and museums.

339

INDUSTRIAL | LED-spotlight for 3 phase busbars

BRAZO

Aluminum pressure die-casting
Dimensions L x W x H: 60 x 90 x 100 mm
Incl. 3 phase adapter
Power consumption: 9.90 W

003441 silver mat CW 6000 K 480 lm A

220-240 9 20° ​
Volt

BLACK & WHITE I

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 220 x 148 x 210 mm
Power consumption: 29.00 W

003501 white NW 4000 K 2340 lm A+

220-240 28,6 COB 36° ​
Volt

340

BLACK & WHITE III

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions H x Ø: 180 x 129 mm
Power consumption: 29.20 W

707004 white WW 3000 K 2500 lm A+

220-240 26 COB 40° ​ 90°
Volt

BLACK & WHITE IV

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions L x W x H: 130 x 130 x 187 mm
Power consumption: 29.20 W

707005 white WW 3000 K 2490 lm A+

220-240 26 COB 40° ​
Volt 90°

341

INDUSTRIAL | LED-spotlight for 3 phase busbars

COB23

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions W x H x Ø: 135 x 227 x 85 mm
Power consumption: 26.50 W

707007 white WW 3000 K 1870 lm A
707009 white NW 4000 K 1970 lm A

220-240 23 COB ​ 40° ​
Volt 180°

COB44

Aluminum pressure die-casting
Incl. 3 phase adapter
Dimensions W x H x Ø: 182 x 244 x 120 mm
Power consumption: 46.70 W

707008 white WW 3000 K 3590 lm A+
707010 white NW 4000 K 3670 lm A+

220-240 44 COB ​ 40° ​
Volt 180°

342

FLOOD SMD

Aluminum pressure die-casting
Dimensions L x W x H: 170 x 143.5 x 27 mm
Base L x W: 179 x 20 mm
Power consumption: 16.00 W

707030 white WW 3000 K 1325 lm A
707031 white NW 4000 K 1349 lm A

220-240 15 SMD 100° ​ 150°
Volt 3030

FLOOD SMD I

Aluminum pressure die-casting
Dimensions L x W x H: 230 x 192.5 x 40.5 mm
Base L x W: 237 x 25 mm
Power consumption: 32.00 W

707032 white WW 3000 K 2600 lm A
707033 white NW 4000 K 2650 lm A

220-240 30 SMD 110° ​ 150°
Volt 3030

343

INDUSTRIAL | LED-spotlight for 3 phase busbars

With the friendly support of SH-Lichttechnik / Becks Reutlingen

344

LUNA 15

Aluminum pressure die-casting | matted
Dimensions L x H x Ø: 159 x 101 x 63 mm
Dimmable via phase angle or trailing edge
Power consumption: 15.60 W

707022 white matted WW 3000 K 1140 lm A
707024 black matted WW 3000 K 1140 lm A
707023 white matted NW 4000 K 1100 lm A+
707025 black matted NW 4000 K 1100 lm A+

220-240 15 COB LED 50°
Volt Watt

20° REFLECTOR | LUNA 15

Plastic | silver | chrome look
Dim. H x Ø: 25 x 50 mm
930188

30° REFLECTOR | LUNA 15

Plastic | silver | chrome look
Dim. H x Ø: 25 x 50 mm

930189

50° REFLECTOR | LUNA 15

Plastic | silver | chrome look
Dim. H x Ø: 25 x 50 mm
930190

345

INDUSTRIAL | LED-spotlight for 3 phase busbars

LUNA 30

Aluminum pressure die-casting
Dimensions L x H x Ø: 165 x 121 x 85 mm
dimmable via phase angle or trailing edge
Power consumption: 30.20 W

707018 white matted WW 3000 K 1930 lm A
707026 black matted WW 3000 K 1930 lm A
707019 white matted NW 4000 K 2210 lm A
707027 black matted NW 4000 K 2210 lm A

220-240 30 ​ 40° ​ 90° ​
Volt

20° REFLECTOR | LUNA 20/30

Plastic | silver | chrome look
Dim. H x Ø: 41 x 75 mm

930196

30° REFLECTOR | LUNA 20/30 BARNDOOR | LUNA 20/30

Plastic | silver | chrome look Metal | white
Dim. H x Ø: 41 x 75 mm
Dim. B x H x Ø: 230 x 90 x 85 mm
930239
930210

40° REFLECTOR | LUNA 20/30 BARNDOOR | LUNA 20/30

Plastic | silver | chrome look Metal | black
Dim. H x Ø: 41 x 75 mm
Dim. B x H x Ø: 230 x 90 x 85 mm
930240
930211

346

LUNA 40

Aluminum pressure die-casting
Dimensions L x H x Ø: 201 x 168 x 120 mm
dimmable via phase angle or trailing edge
Power consumption: 40.20 W

707020 white matted WW 3000 K 2520 lm A
707028 black matted WW 3000 K 2520 lm A
707021 white matted NW 4000 K 2820 lm A
707029 black matted NW 4000 K 2820 lm A

220-240 40 ​ 40° ​ 90° ​
Volt

20° REFLECTOR | LUNA 30/40

Plastic | silver | chrome look
Dim. H x Ø: 56 x 110 mm

930206

30° REFLECTOR | LUNA 30/40

Plastic | silver | chrome look
Dim. H x Ø: 56 x 110 mm

930207

40° REFLECTOR | LUNA 30/40

Plastic | silver | chrome look
Dim. H x Ø: 56 x 110 mm

930208

347

INDUSTRIAL | LED-spotlight for 3 phase busbars
348

LINEAR 60

Aluminum
Dimensions L x W x H: 687 x 33 x 52 mm
Power consumption: 20.10 W

707015 white matted NW 4000 K 1655 lm A+

110-240 19 S2M83D5 110°
Volt

LINEAR 100

Aluminum
Dimensions L x W x H: 1087 x 33 x 52 mm
Power consumption: 31.50 W

707016 white matted NW 4000 K 2435 lm A

110-240 30 S2M83D5 110°
Volt

PANEL TRACK LIGHT

Aluminum
Dimensions L x W x H: 300 x 100 x 22 mm
Power consumption: 21.00 W

707017 white matted NW 4000 K 1500 lm A

110-240 20 S2M83D5 115° ​
Volt 340°

349

INDUSTRIAL | 3 phase | 230V

ACCESSORY
FOR ROUND, ANGULAR AND WING BARS

HEAVY-DUTY TANKER ROUND ANGULAR WING

Aluminum pressure die-casting
Dim. L: 65 mm
Max. load capacity: 10 kg

144988 black
144989 white

LONGITUDINAL CONNECTOR ROPE SUSPENSION

Plastic Plastic | Metal
Dim. L x H: 21 x 30 mm Dim. L: 2000 mm

444560 black electrical 444800 black
444561 white electrical 444801 white

BUSBAR COVER ADAPTER | MAX. 6A

Plastic Plastic
Dim. L: 1000 mm Dim. L x B x H: 120 x 120 x 33 mm
for spotlight mounting

444960 black 445020 black
444961 white 445021 white

SOCKET

Plastic
Dim. L x H: 65 x 90 mm
Max. 2300W

445701 black earth earth earth
outside inside left
COVER FIXATION earth earth earth
right right left

Aluminium X-connector
Dim. L x B x H: 30 x 33 x 15 mm
Bar holder

555693 silver

350

BUSBARS, ROUND DESIGN

Dim. L x B x H: 1000 x 42 x 34 mm

444100 black 1m FLEXIBLE CONNECTOR
444101 white 1m
444203 silver 1m Plastic
444200 black 2m Dim. L x H: 42 x 34 mm
444201 white 2m
444202 silver 2m 444580 black
444207 black 3m* 444581 white
444208 white 3m*
444205 silver 3m*

220- MAX X--CONNECTOR
240V 3 x 16A

FEEDER Plastic
Dim. L x H: 120 x 34 mm
with feed option

Plastic 444690 black
Dim. L x H: 42 x 34 mm 444691 white

444520 black Ground right LONGITUDINAL CONNECTOR
444521 white Ground right
444510 black Ground left Plastic
444511 white Ground left Dim. L x H: 42 x 34 mm
with feed option
T-CONNECTOR Ground left
Ground left
Plastic Ground right 444660 black
Dim. L x H: 80 x 34 mm Ground right 444661 white
with feed option
Ground right
444630 black Ground right END CAP
444631 white Ground left
444640 black Ground left Plastic | Dim. L x H: 42 x 34 mm
444641 white

90°-ANGLE 444590 black
444591 white

Plastic earth earth earth
Dim. L x H: 80 x 34 mm outside inside left
with feed option earth earth earth
right right left
444670 black
444671 white X-connector
444680 black
444681 white

*Attention bulky goods:
increased freight costs | Price upon request

351

INDUSTRIAL | 3 phase | 230V
BUSBARS, ANGULAR DESIGN

Dim. L x B x H: 1000 x 36 x 33 mm

555100 black 1m FLEXIBLE CONNECTOR
555101 white 1m
555203 silver mat 1m Plastic
555200 black 2m Dim. L x B x H: 300 x 36 x 33 mm
555201 white 2m
555202 silver 2m 555580 black
555210 silver mat 3m* 555581 white
555211 white 3m*
555212 silver mat 3m*

220- MAX X--CONNECTOR
240V 3 x 16A

FEEDER Plastic
Dim. L x B x H: 120 x 120 x 33 mm
with feed option

Plastic 555690 black
Dim. L x B x H: 80 x 36 x 33 mm 555691 white

555520 black Ground right LONGITUDINAL CONNECTOR
555521 white Ground right
555510 black Ground left Plastic
555511 white Ground left Dim. L x B x H: 120 x 36 x 33 mm
with feed option
T-CONNECTOR

Plastic 555660 black
Dim. L x B x H: 120 x 80 x 33 mm 555661 white
with feed option

555630 black Ground left END CAP
555631 white Ground left
555640 black Ground right Plastic | Dim. B x H: 36 x 33 mm
555641 white Ground right

90°-ANGLE 555590 black
555591 white

Plastic earth earth earth
Dim. L x B x H: 80 x 80 x 33 mm outside inside left
with feed option earth earth earth
right right left
555670 black Ground right
555671 white Ground right X-connector
555680 black Ground left
555681 white Ground left

*Attention bulky goods:
increased freight costs | Price upon request

352

BAUSluBmARinSu, MmObUNuTilItN-GinWpIToHwWeINrGrSails
Di(mw. Linx Bgx vH:e10r0s0iox 5n3)x 33 mm

333331301101 1 metwerh/itwehite 1m
333333333311330011740074 2 metwerh/itwehite 2m
3 metwerh/itwehite 3m*

224220204V2-00V- 3Mx A136xXMA1A6X A 33 mm H
B 37 mm 53 mm B

LONGITUDINAL CONNECTOR

Plastic
Dim. L x B x H: 120 x 53 x 33 mm
with feed option

333211 white

FEEDER FEEDER

straigPhltasctoicnnector with mounting bracket for suspensiPolanstic

feedinDgimp.oLssxibBilxitHy: 80 x 53 x 33 mm Dim. L x B x H: 80 x 53 x 33 mm

333211333w20hi1te white 333220 chrome 333203 white Ground left
Ground right

END CAP FIXATION ANGLE

Plastic Metal
Component angular bars for suspension

930166 white 333220 chrome

353

OUTDOOR LUMINAIRES
354

OUTDOORLUMINAIRES

Artificial light during the night has become so natural that
you get aware of this fact only when you wish to design light
objects for your own garden or outdoor area. Not only does
light provide orientation and safety, it also defines spaces
when it is installed properly.

OUTDOORLUMINAIRES

248 Surface-mounted wall-ceiling luminaires
274 Recessed wall luminaires
290 Surface-mounted luminaires
surface-mounted spotlights
324 Wall washer
330 Standard lamps
346 Recessed floor luminaires
382 Underwater luminaires

355

OUTDOOR LUMINAIRES
VELORUM SERIES

356

357

OUTDOOR LUMINAIRES | Surface-mounted wall-ceiling luminaires
358

NEU
NEW

731104
Page 361

NEU
NEW

731102
Page 383

NEU
NEW

732083
Page 362

SURFACE-MOUNTEDWALL LUMINAIRES

Surface-mounted luminaires for wall and floor provide light,
orientation and safety in your outdoor area. A movement
sensor also helps saving energy.

OUTDOOR LUMINAIRES | Surface-mounted wall-ceiling luminaires
360

MAIA I

Aluminum pressure die-casting NEU
Dimensions L x H x Ø: 110 x 170 x 119 mm NEW
Base H x Ø: 45 x 110 mm
dimmable via phase angle or trailing edge
Power consumption: 5,00 W

731104 white 3000 K 100 lm B

220-240 4 SMD 350°/5° ​ ​ IP65
Volt XPE

MAIA II

Aluminum pressure die-casting NEU
Dimensions L x B x H: 148,00 x 60,60 x 98,50 mm NEW
Base L x B: 148 x 60,60 mm
dimmable via phase angle or trailing edge
Power consumption: 5,00 W

731105 white 3000 K 70 lm B

220-240 4 SXMPED 180°/5° ​ ​ IP65
Volt

361


Click to View FlipBook Version
Previous Book
SS19 Turtledove London Blank
Next Book
2018 May Royalty Rewards Newsletter Flipbook