Issue 892

More pages online!!! R
at
ALL RIGHTS RESERVED ©2019
www.tidbitsweekly.com/
publisher/treasure_valley

Nov 12, 2020 - Nov 18, 2020 Issue # 892

www.oregontrailpub.weebly.com For Ad Rates Call 541-212-0914 [email protected]

If it’s broken, my grandpa can fix it!

Treasure
Valley

Windshield
& U-Haul

ADJUSTABLE TIDBITS® 1965 NW 9th Street, Ontario
COMFORT HONORS Oregon 541-889-0037 Idaho 208-741-4629
THE
Save NOW on all adjustable bases! Home of the $50 Rebate
VIETNAM ON WINDSHIELD REPLACEMENT
WALL

by Kathy Wolfe

∙ Read a book or watch TV in comfort Every year, about 3 million visitors stop to
∙ Reduce lower back pain pay their respects to Vietnam veterans at
∙ Reduce acid reflux ∙ Reduce snoring the Vietnam Veterans National Memorial
∙ Quit sleeping in your recliner and be comfortable in bed in Washington, D.C. In honor of Veteran’s
Day, Tidbits presents the facts about what is
We have a great selection of commonly referred to as “The Wall.”
mattresses that are made for
• The inspiration for the wall came from
your new adjustable base. decorated Army veteran Jan Scruggs.
Scruggs, who had been wounded in the
541-889-5642 Vietnam jungle, was inspired by the 1978 425 S Whitley Dr. #12 Fruitland, ID 83619
film “The Deer Hunter,” and wanted his
398 South Oregon Street ∙ Ontario, Oregon fellow soldiers to be honored for their service
and sacrifice. He established a fund in 1979
DON’T SETTLE FOR Se habla español for a suitable memorial. In 1980, President
Jimmy Carter signed legislation to provide
CHEAP DENTURES frEECall for a a 2-acre site in the Constitution Gardens
COME TO US FOR on the previous site of the World War I
Consultation Munitions Building, demolished in 1970.
CUSTOM DENTURES AT A
COMPETITIVE PRICE! Insurance and • The wall was entirely funded by private
Payment plans accepted donations, a total of $8.4 million, from
Custom made Dentures corporations, foundations, veterans, and
Warranty on ALL Dentures Accepting Medicaid more than 275,000 individual Americans.
SAme DAy Repairs & Relines No federal government money used for the
project.
Senior DiSCountS
Flexible Partials • A design competition was launched and by
the end of 1980, 2,573 had registered for
PoRCeLAin teetH Available the competition, which would award a cash
Dentures oVeR implants prize of $50,000 to the winner. When the
entry period ended on March 30, 1981,
205 W. Logan St. 188 east Lane, Ste. 3, 10480 W. Garverdale Ct. 1,421 designs had been submitted.
Caldwell ontario, oR Ste., 804A • Boise
TURN THE PAGE FOR MORE!
for more information visit: eurodenture.com

208-609-3341

WE OFFER A WIDE VARIETY OF Choice. Dignity. Compassion.
PREVENTATIVE SERVICES
Ask your doctor about
208-707-BUGS (2847)
Signature Hospice
[email protected]
SIGNATURE healthcare (208) 642-9222
Weed Abatement and at home
Pest Control Services care where you are

Rory Clinton Owner/Operator
Licensed in Idaho and Oregon

SERVING THE COMMUNITY SINCE 2003

1372 Southwest 8th Avenue ∙ Ontario, OR 97914
Phone (541) 889-4600 | Fax (541) 889-5480 ∙ brookdale.com

Facility No. 24022

Page 2 Tidbits of Lower Treasure Valley Nov 12 - Nov 18, 2020

1372 Southwest 8th Ave CANYON NEW
Ontario, OR 97914 FINANCIAL
Phone (541) 889-4600 | Fax (541) 889-5480 LOCATION
brookdale.com of Fruitland Inc.
Assisted Living ∙ Facility No. 24022
Mon-Sat Bulk Clover Loans up to $10,000
10a - 5p & Local Honey Come see us about our Move In Special! · Fast Approvals · Decisions Made Locally

$3.00 per pound · Loans for Autos, Furniture, Vacations,
in your own container Bill Consolidations, etc.

Former Bankruptcy, Damaged Credit, "No Problem"

2330 Hwy 30 West, Fruitland 208-452-7035 Mon - Fri 9-4 · Visit our website: www.everydayfinancing.com

452-6274 1401 N. Whitley Ste. #9
Fruitland

THE VIETNAM WALL Does COVID

(continued): Restrict
• Of these, entry number #1026 was chosen
Travel With
as the winner, a 21-year-old Yale University
undergraduate, Maya Ying Lin. The Ohio- Pets?
born young woman was the daughter of
Chinese immigrants who had fled China ---
in 1949 when Mao-Tse-Tung took control
of the country. Her design was part of DEAR PAW’S
her college architecture class, on which,
ironically, she only received a “B,” beating CORNER: I’m
out her professor in the competition.
• Ground was broken for the memorial one driving from
year later on March 26, 1982. It was
completed seven months later, followed New York to
by a week-long national salute to Vietnam CoRloecraodnonefocrtinagloWngit-hterm contract job,
veterans when thousands of veterans of the anYdomury StwenoiodrogDsowgill be coming with
conflict marched to the site. It was officially lawDmrgiEteeAhm.RmiMxeyPydA-brcWorae’oteSdmadCbmoOogaRu“tHNteaEatiRcnhw: eNetM”eeiyksw York is flying
dedicated on November 13, 1982. later, because

• Two 246-ft- 9-inch-long (75.21 m) black 12 yIeadros nol’dt, tahndinhkismdisycicplaintewhailsl do well on a
granite slabs form the foundation of the wall. bsollfeeiopcysanpecueagasdrespqc. uIiaTn’ivhrtgeeat)atbr’.sbiepieAptnrir(onecabtoahntnbehdslupyemaImrs’eetmydcoafawuwnupitylolthe,rrreiesdtriacbtioountshoenr
The two sections are divided into 140 panels rupnentisngtaranvewelibnugsinbesys apnldanbaereolyr staying in ho-
of horizontal rows, etched with the names Ih’avvteeertleismsoealvtteodtwhtaoilskghteiitmmb.aeBc?ukt-oth-nisBtryeaecatkrh G., Brooklyn
of 58,320 servicemen. With a portion sunk HIwiacitDntahclghlEoeAhutyirwRmoiud,lBlareniEsloppyTtellcHawisianta:elllnnkyIsito.narstgTcoortohmwuueneebpwldlealhsrieiknsnl,.ikaedvyaonuc’ree,
into the ground, the highest above-ground do-
tip is 10.1 feet (3.1 m) high, tapering to a and
height of 8 inches (200 mm) at their outer
points. Support for the massive structure Can he be retrainedt?ha—t’sDogurgeLa.t, .
is provided by 140 concrete pilings driven AustiYno, Tuerxadsogs should be secured in the
about 35 feet (10.7 m) down to bedrock. riseDfarocEegasnArherReatrtwhitderDheaiaiOirn!lUieOnsGgniyzc:ioeenyuGboa’iaurvnseisindctagtrotrtbhawHeevodarietekctnlihynicengept ge.
Depending
• The black granite came from Bangalore, India, of car, they
one of just three places in the world where
granite of this size is available. (The others wicthanhimbedaiplyl,ahceesdhoiunldapiclakrtghoesekennel cage in
are Sweden and South Africa.) The cutting usksCtteilhoolpsmeyorsmisgictihitaavtteibrnnraggdecoiktnoafuoapctrhrcc—aeeetmaedsesaspn(iletwytcmoiwiaetltahlwhylokiadcfwstoy.eiomtuhr)f.yObredthse, ychceawn
and forming of the pieces were completed in himsitsrethtecbhesot uthtinognyotuhceanbdaockto seat -- use a
Barre, Vermont. The names of the veterans cimoBfrmpreeromcosamvautenrsdeahssiHi.slniadbttecihnhdaegevtivioasricraaoensdeundnrieoedsrspdoitgonhgsnee, ehtocedatrookreeespcadpoignsg
were typeset by an Atlanta, Georgia firm, may tire more eafsriloymon tyhoeur vweahlkiscle.
with each name slightly over half an inch paansudpMsmpnmyaao.panBpdyyieilfynaihoealtosidtrttheleeteshplpdsoaeindtaiiderwrntecthoelwenpciotaehhmnethm-iwinfmarang.sideIasfpnrdolyceadnudrehsasvoe
(1.27 cm) high. The stones were shipped he tishna’ttretsphoendhinogtweelllrtoo othme “scowmei”ll be clean and
to Memphis, Tennessee, where the names command atrteheapdayrk,fkoerepthhiem onnehxist guest.
were etched into the granite using a photo- loenaAsthhnadtducroimmngmowaraneldkwsgahonilodedwinontrhkeewwpiatsrhk:h. iYmour friend and
emulsion and sandblasting process. The yIfoHuartcchaett dcoaesnn’tprimopbraovbel,yiftrhaevel together in
stones originally contained 57,939 names of seetmhes laetihralirngiec corabpeinrh,apassalolinttlge as your cat is
those killed or still missing in action. (cont) ssneienamppasyocfwfa,ittrharkoieethhreimr(dhtooagthsr,edovreotirefrihsneoarjfiutasntsided) that will
forfiatchuenckduep.rSneeniaotrhdogtshceansdeevaetloipn front of your
physfircaiel inssdue.s(thSaot dmisteracatitrhleimnefrsomare no longer
aterrnaedsinnoh’ictnirggpinet—ptehtiipenntrghogdiibnnilgpestshmreeluistkw.speMatyaiearnotkhdferthishtifiuslseirogepuachttidhantooroossegrrcoheadreualedsu.)e to
timBe.oBoekst otfhleucka!irline seat with a pet option

Senadsyosuor coonmmaesntsp, qousesstiobnlseo.r tAipisrlines allow a
to [email protected]. of pets to travel in the
cabi©n2,02e0 vKiengnFeaitnuresaSycnda.,rInrci.er. Those slots may

fill up fast.

Likewise for hotels: Book the rooms as

soon as possible so that you know a

pet-friendly room is waiting for you and

your dogs.

Send your tips, comments and ques-

tions to [email protected].

(c) 2020 King Features Synd., Inc.

Nov 12 - Nov 18, 2020 Tidbits of Lower Treasure Valley Page 3

LEON’S PUMPS LLC FOR SALE Don't Dump, Donate
Working & Non-Working Appliances
Sales ∙ Service Free Standing Oil Stove, Brass & Glass
Installation ∙ Repair Door. Looks Like Wood Stove, asking Call to arrange pickup
$700(New$2900), Small Mobile Home Wood Heat from our local area.
Do It Right Stove $200, 12’ One Axle Flatbed Trailer $175, Old
The First Time 16’ Aluminum Boat & Newer Trailer Runabout $250, 1701 SW 4th Ave, Ontario · 541-889-3078
Small Ladder Rack for Small Pickup $150, 50 Cali- Mon-Sat: 10-5 · cbsontario.com
(541) 889-6353 ber Cannon 2’ Long $175, Old Model “T” Axles, Wall
Hangers and Yard Art. Gas Water Heater 100, Table 1. What Cleveland
[email protected] Saws $75 each, 1940-1970 Harley Parts, 1939 Briggs Browns player scored
203 NE 1st Street ∙ Ontario 14Hp, 2 Exercise Bikes, $80 & $160. Fuel Tanks $100 the first two-point
& $175,100s of N.O.S Small Aircraft Parts 1940-1990 conversion in NFL
Licensed in Oregon & Idaho CCB#214732 history in Week 1 of
$250 the 1994 season?
THE VIETNAM WALL 2. Corliss Williamson,
(continued): 541-709-0278 Ontario a.k.a. “Big Nasty,”
was named Most Out-
• The shiny black granite slabs are arranged 2001 Honda Civic FARM FRESH APPLES standing Player of the 1994 NCAA Basket-
in a “V” shape, with one wall pointing toward GOOD CONDITION RED DELICIOUS ball Tournament as a member of what team?
the Lincoln Memorial and the other toward the $.85 per pound. 3. What American track and field athlete set
Washington Monument. 112,448 miles world records in the 100-meter and 200-me-
Quality Tires 9mm And Other Ammo ter sprint in 1988 and is still considered the
• The Department of Defense has determined $1800 cash only For Sale Also fastest woman of all time?
the criteria for inclusion on the wall. “Only the 541-216-8336 New Plymouth 4. Who led the NHL in goals scored in the
names of service members who died of wounds Payette/Ontario 208-761-4110 1996-97 season with 52 as a member of the
suffered in combat zones” may be added to the Phoenix Coyotes?
memorial. Although many veterans have died EMPLOYMENT MISCELLANEOUS 5. In 1908, Jack Norworth and Albert Von
prematurely from noncombat injuries, (such Tilzer wrote what popular sports-themed
as Agent Orange exposure) and emotional DOMINO’S IS HIRING! The “Books Only” song?
suffering from the war, they are not eligible for All Shifts, Full Time, Part Store 6. Before serving as NBA commissioner
inclusion. The wall of names is not a complete Time. Flexible Hours. No from 1975-84, Larry O’Brien was appointed
list of the eligible, as some families requested Chris’s Book Corner to what government position by President
that the name be omitted. Experience Necessary! 322 State Street, Lyndon B. Johnson in 1965?
Inside Pizza Makers/ Weiser Idaho 7. What is the name of the oversized bass
• Each name is marked with either a diamond or 208-549-8191 drum that has been featured at University of
a cross, with the diamond denoting that the Customer Service Reps. Mon-Fri 9:00-5:00 Missouri Tigers home games since 1981?
soldier’s death was confirmed. About 1,300 Delivery Experts Sat 9:00-4:00 (c) 2020 King Features Syndicate, Inc.
names are marked with a cross, signifying
that the person was either missing in action Competetive Wages +
or a prisoner at the end of the war, remaining Tips.
unaccounted for. If a person marked as MIA is
found, a circle is placed around the cross. The Stop in Fruitland Store
soldiers are listed chronologically in the order Today. Ask For Keri
in which they were lost.
Urgently looking for Need cash now,
• Although Richard B. Fitzgibbon, Jr. was the marketing and sales don’t want to have
first casualty of the war on June 8, 1956, his representatives to help an estate sale or yard
name was not the first to be added to the wall. with ad sales for Tid- sale, call the Trea-
The first two names entered on the wall are bits in NEW distribu- sure Valley Picker for
Dale Buis and Dale Ovnand, who were both tion area of Emmett, unwanted items, an-
killed on July 8, 1959 by Viet Cong guerrillas. ID to include Parma, tiques, jewelry, tools,
Fitzgibbon was actually murdered by another New Plymouth, Fruit- furniture, musical in-
American, a soldier he had reprimanded land, Payette, Weiser, struments, garage
for an incident earlier in the day. The U.S. Nyssa, Ontario and Vale sales items & misc.
Government did not classify his death as a if interested. At least We buy storage units,
war casualty until 1999, when his name was two referrals preferred. garages & barns. Call
finally added to the wall. Nine years after the Straight commission. 208-405-9647.
death of Fitzgibbon, his 22-year-old son was Call Lisa 541-212-0914
killed in action by an explosive device. The
wall contains the name of three sets of fathers Classified Advertising Rates:
and sons. (cont)
$8.00 for the first week for up to 20 words, up to 3 ad-

ditional weeks for $4.00 each when paid at the time of

original ad placement. For additional words, add 20¢

per word per week, for border and yellow highlight, add

$2.00 per week. Payment Options: Credit Card- call

541-212-0914 - Check or Money Order - mail your legi-

ble ad with payment to: Oregon Trail Publications, P.O.

Box 93 Ontario, OR 97914

All ad copy must be approved by Tidbits, which reserves the right to edit or reject any ad request
that we find, in our sole discretion, to be questionable or not in good taste. In the event of typo-
graphical errors, errors in publication, or omission in or from an ad, Tidbits liability will be limited
to the reprinting of the ad. By placing an ad in Tidbits, you waive any claim for consequential,
incidental, or other damages. All items listed are subject to prior sale. Tidbits considers it’s ad-
vertisers reliable and verifies as much data as possible. However, readers using this information
do so at their own risk. It is suggested that investors contact the appropriate consumer agency
before sending payment. Although persons and companies mentioned herein are believed to be
reputable, neither Tidbits nor its’ employees accept any responsibility whatsoever for their actions
or claims. For more information to help you avoid rip-offs and exercise your consumer rights,
write: FTC, 600 Pennsylvania Avenue NW, Washington, DC 20580 or log on to http://www.ftc.
gov/bcp/consumer.shtm.

WE’RE HERE TO HELP!! PLEASE GIVE US A CALL WITH YOUR
QUESTIONS AND WE WILL HELP IN ANY WAY WE CAN.

541-889-8012

For Up To Date Information Visit www.ontariochamber.com

Ontario Area Chamber Of Commerce

Page 4 Tidbits of Lower Treasure Valley Nov 12 - Nov 18, 2020

WE MAKE SERVICES INCLUDING: Malheur County
HOUSE ∙ In-home visits
CALLS ∙ Medication management Veteran's Service Office
∙ Pain management
Do you find it hard to ∙ Convenient lab collection Connie R. Tanaka
get to those doctors’ ∙ Disease management
appointments? Providing help with your Veterans Benefits
Let us come to you!
541-889-6649
SIGNATURE healthcare 208-642-9222 * On Nov. 18, 1883, American and Canadian
at home railroads begin using four continental time zones Call for an appointment
care where you are to end the confusion of dealing with thousands
of local times. Most Americans and Canadians MOVIE FAVORITES:
THE VIETNAM WALL quickly embraced their new time zones, howev-
er, it was not until 1918 that Congress officially THE DEER HUNTER
(continued): adopted the railroad time zones.
The 1978 war drama “The Deer Hunter”
• More than 33,100 of the names on the wall * On Nov. 19, 1915, British airman Richard Bell inspired Army veteran Jan Scruggs to
Davies performs a daring rescue, swooping pursue an avenue to honor his fellow
belong to 18-year-olds, including that of Sgt. down in his plane to whisk a downed fellow pilot Vietnam veterans. This week, Tidbits
Robert G. Davison. The Muskegon, Michigan from behind the Turkish lines. The British gov- explores the making of this motion picture.
native joined the Marines at age 14, and ernment awarded him the Victoria Cross.
had put in four years of service before being • Although labeled as a war movie, actual
shipped to Vietnam at age 18. He was killed * On Nov. 21, 1934, teenager Ella Fitzgerald war scenes are actually just a small part
in action in 1966, just one day before his 19th wins Amateur Night at Harlem’s Apollo Theater. of the movie. Rather, it’s the story of how
birthday. Putting her name in the hat on a bet, she’d the trauma of the Vietnam War changed
originally planned a dance number. History was the lives of a group of small-town, middle-
• The final casualty of the war was another made when she changed her mind and sang class friends. Steven, Nick, and Michael are
18-year-old, Marine Kelton Turner, killed in a “The Object of My Affection.” steelworkers in Clairton, Pennsylvania, and
helicopter crash while on a rescue mission as the film opens, they are attending Nick’s
over Cambodian waters in May, 1975, two * On Nov. 20, 1947, Princess Elizabeth marries wedding shortly before the three head off to
weeks after the evacuation of Saigon. distant cousin Philip Mountbatten, former prince war. Nearly the first half of the movie takes
of Greece and Denmark, who renounced his place at the wedding and on a deer-hunting
• The name of Dan Bullock is located on Panel titles to marry the English princess. Mountbatten trip with the trio and another three of their
23W, honoring the youngest person killed in was made the duke of Edinburgh. buddies.
Vietnam. Bullock joined the Marines at age
14, altering the date on his birth certificate * On Nov. 16, 1959, the smash musical “The • The second section of the film moves to
from 1953 to 1949. He arrived in Vietnam on Sound of Music” opens on Broadway to the Vietnam, where the three friends are taken
May 18, 1969, and was killed in action just 20 consternation of the real Maria von Trapp and prisoner. This sequence contains one of the
days later at age 15. her stepchildren. Nearly all of the particulars she movie industry’s most disturbing scenes
related in her 1949 book, “The Story of the Trapp when the friends are forced to play Russian
• Five names belong to 16-year-olds, and Family Singers,” were ignored by the creators of roulette by their captors.
another 12 were just 17 years old . the musical.
• The final segment of the movie covers their
• On Veteran’s Day, 1984, an addition to the * On Nov. 17, 1973, in the midst of the Water- post-war experiences, including discovering
memorial was added 150 feet (45.7 m) gate scandal that eventually ended his presi- that Nick has not returned home, Michael’s
away, a bronze statue named “The Three dency, President Richard Nixon tells a group of return to attempt to bring him home, and and
Servicemen.” It was created by Frederick newspaper editors that he is “not a crook.” Steven’s coping with the loss of his legs.
Hart, a Washington, D.C. sculptor who
had had placed third in the Wall’s design * On Nov. 22, 1988, the Northrop B-2 “stealth” • As research for his role as Michael, actor
competition. The figures portray the major bomber is shown publicly for the first time at Air Robert De Niro socialized with many
ethnic groups of the U.S. military who served – Force Plant 42 in Palmdale, California. Although steelworkers, none of whom recognized
a European-American, an African-American, the aircraft had a wingspan of nearly half a him. The steel mill scenes were filmed
and a Latino-American, all modeled after football field, its radar signal was as negligible as inside a Cleveland mill owned by U.S. Steel,
actual young soldiers. The statue was placed that of a bird. The B-2 also successfully evaded who secured a $5 million insurance policy
so that the soldiers are looking at the names infrared, sound detectors and the visible eye. to cover the actors working on the furnace
of the fallen soldiers. floor.
(c) 2020 Hearst Communications, Inc.
• On Veteran’s Day, 1993, yet another sculpture All Rights Reserved • In preparation for his role as Nick, then-35-
was added just south of the wall, dedicated year-old Christopher Walken ate just water,
to the 265,000 American women who served rice, and bananas in order to attain a hollow,
in the war, most of whom were nurses. gaunt look for his character. Walken’s salary
Designed by sculptor Glenna Goodacre, the was originally $17,000 for the role, but raised
2,000-lb. (907 kg) bronze sculpture features $25,000 when filming went long. (cont)
three women in uniform tending to a wounded
soldier.

Nov 12 - Nov 18, 2020 Tidbits of Lower Treasure Valley Page 5

PARKERBUILDINGS.COM Family owned and operated since 1919, Tires ∙ Wheels ∙ Brakes
trust us to be here tomorrow! Shocks ∙ Oil Changes
Building Material Supplier Lift Kits ∙ LED Lighting
Exceeding Your Expectations Engine Diagnostics
ENCLOSED PERMITTED BUILDING Vehicle Accessories

Fusion Bumpers

541.889.8693

280 South Oregon St

∙ Ontario ∙ Debbie & Mike

www.blackabyinsurance.com Blackaby Have a smart phone?
Follow us!
“Insurance is what we do,
service is how we do it.” Facebook Website

KIT CONTAINS: (1) 3’x6’ - 8” Entry Door, (1) 11’ wide
Slider Door, Galvanized Roof, Painted Walls & Trim.

These buildings have Engineered Plans
& price is based on 25# Snow Load, “C” Exposure.

24 x 36 10’ Eave 12’ Eave 14’ Eave 16’ Eave 1. GEOGRAPHY: Which of the Great THE DEER HUNTER
30 x 36 $8,650 $9,490 Lakes is the largest in surface area?
30 x 48 $10,165 $10,926 2. LITERATURE: Which 20th-century (continued):
36 x 36 $10,119 $10,973 $11,736 $12,562 novel’s working title was “Tomorrow Is
36 x 48 $12,091 $12,980 $15,151 Another Day”? • This was Meryl Streep’s first starring role
40 x 48 $12,532 $13,914 $14,444 3. MEASUREMENTS: What does an ane- in a movie, after being spotted by Robert
40 x 60 $11,658 $13,379 $17,425 mometer measure? De Niro in a stage production. Her role
$13,991 $14,978 $15,935 $19,413 4. TELEVISION: Which 1980s sitcom as Angela, Nick’s bride, earned Streep
$15,957 $16,763 $17,902 $22,007 featured the characters Mrs. Garrett, her first Academy Award nomination.
$19,344 $20,642 Tootie and Jo?
$18,441 5. ENTERTAINERS: Which singer was • One of the buddies on the deer-
born with the name Stefani Joanne An- hunting trip was played by 42-year-old
Customizable Options & Prices gelina Germanotta? John Cazale, who had appeared in
are available on our website. 6. ADVERTISING: Who is the mascot of two of the “Godfather” films and “Dog
the snack brand Cheetos? Day Afternoon.” Cazale, who was
BARNS ∙ ARENAS & STALL BARNS ∙ COMMERCIAL 7. ANATOMY: How much blood does the dating his co-star Meryl Streep, had
SHOPS & GARAGES ∙ RESIDENTIAL ∙ WAREHOUSES average human have? been diagnosed with cancer prior to
8. MOVIES: What was the name of the starting “The Deer Hunter.” Deemed
800-331-0155 ∙ 503-981-0890 1993 movie in which actor Tom Hanks “uninsurable” by the studio, moves were
plays a lawyer with HIV? made to replace him, but Robert De
QUALITY SINCE 1982 9. U.S. STATES: What is the official Niro personally paid for the insurance.
FOB Hubbard, OR. Price subject to change without notice. state bird of Minnesota? Cazale passed away shortly after the
10. ASTRONOMY: Which planet in our filming was completed and never saw
solar system has the largest moon? the finished product.

(c) 2020 King Features Synd., Inc. • The budget for the film was initially set
at $7 million, but when director Michael
Cimino insisted on filming the Vietnam
scenes in Thailand, the cost more
than doubled. The three-hour long
saga, which grossed $49 million, was
nominated for 9 Academy Awards and
took home five, including
Best Picture and an Oscar
for Christopher Walken.

• Although deemed as one of
the century’s greatest films,
the director was criticized for
claiming to have drawn from
his own experiences as an
Army soldier in Vietnam, but
in fact had never deployed.
In addition, the screenwriter,
who was a carpenter by
trade, was given one month
to do the job, and failed to
interview a single veteran
for research, relying on
what he saw on the news to
write the script. In spite of
the Russian roulette scene
being a fundamental part
of the film, there was not
a single recorded case of
Russian roulette during the
Vietnam War.

Page 6 Tidbits of Lower Treasure Valley Nov 12 -Nov 18, 2020

THE LUSITANIA Call Or Stop In Today 20% OFF
To Sign Up For One
When we think of sinking ships, the Titanic is Of Our Classes! Be- any purchase
usually the first to come to mind. However, just ginners Welcome! over $40
as tragic was the sinking of the Lusitania, three
years after the Titanic went down. If you don’t Tuesday-Saturday Some Exclusions Apply
know much about this vessel, you’ve come to 10:30am-6:00pm
right place to learn more.
* In March 1980, multiple female students
at Southern California universities com- • The RMS Lusitania’s maiden voyage was
plained that someone had surreptitiously September 7, 1907, and like the Titanic, she
painted their toenails while they studied in was the world’s largest passenger ship at
the library. The perp, dubbed “Leonardo the time. The ship was designed by Cunard
da Toenail,” was caught but released, since Line’s architect and built by a Scottish
police hadn’t discovered him in the act. shipbuilding company. The vessel took her
Apprehended again a year later, he was name from the ancient Roman province of
ordered to a hearing at the city attorney’s Lusitania, which was modern-day Portugal
office but didn’t show up and was never and part of western Spain.
seen again.
* There are 12 times more trees on earth • The Lusitania only held the honor of largest
than there are stars in the Milky Way. passenger ship for two months when another
* Academically gifted actress Sharon Stone Cunard Line ship, the Mauretania, designed
skipped both kindergarten and first grade, by the same architect, grabbed the honor.
entering second grade at age 5.
* In the early ‘90s, Pepsi owned 17 sub- • Lusitania was the first passenger ship to cross
marines, a cruiser, a frigate and a destroy- the Atlantic Ocean in less than five days,
er, due to a deal with the Soviet Union in (another record broken by the Mauretania),
which they exchanged soda for military and made 202 crossings on the Liverpool-
equipment. New York route.
* The oldest known pet cat existed 9,500
years ago. • On May 7, 1915, as the Great War spread
* Ever find yourself nodding off in a bor- across Europe, the Lusitania set sail from
ing meeting? You might want to invest in New York on the return journey of the ship’s
a box of “Sleep Safe Tape,” a half-inch roll 101st round-trip voyage. Although President
of transparent tape with pictures of eyes Woodrow Wilson had declared the United
along its length that, as one source put it, States a neutral nation, a German U-boat
allows users to “get the shuteye they need
while appearing to be wide awake.” Of toWrpAeNdToeTdOaRnUdNsaYnOkUthReOBWriNtisBhUoScIeNaEnSliSn?er.
course, the game is up if you start to snore • WPithubalischreaw of 696 andP1a,2p6e6r pinasYsoeunrgAerresa, the
... .
* Abraham Lincoln was a skilled wrestler totalIfnYuoumCabnePrroovifdpe:eSoaplesleExapberoienacred· AoCnomthpuatetrd· ay was
and was honored with an award from the 1De,s9kW5to9peP, upibnrloischvliiundgdeSiontfhtgwea1roe2p· A8poRAertamusonneiatrybilcefoaFirnnassnucicaaclnIendvsessa!tmleantrge
National Wrestling Hall of Fame in 1992.
* At least six ravens are kept at the Tower npeumrisbheCerdoa.fTlClhae1nre.a8dw0iae0nres..54O82f 3ltihfe.i3sbon0au9tms6boenr,b1o,a1r9d5,
of London at all times, due to an old su-
perstition that says: “If the ravens leave but only wsiwx ww.etrideblaitusnwceheekdlys.uccocmessfully. The
the Tower, the Kingdom will fall.” The birds 32,000-ton ship sank within 18 minutes after
even have part of a wing clipped so if they being struck off the southern coast of Ireland.
do decide to fly around, they won’t get very
far. MORE ON PAGE 10 ONLINE AT
***
Thought for the Day: “The glow of one www.tidbitsweekly.com/publisher/treasure_valley
warm thought is to me worth more than
money.” -- Thomas Jefferson Information in the Tidbits® Paper is gathered from sources considered to be
reliable but the accuracy of all information cannot be guaranteed.
(c) 2020 King Features Synd., Inc.
Can’t Get Enough Tidbits?

TRILOGY RESERVE NOW!

LimBitoeodk E Sdeittion Send $24.95 (plus $5.00 S&H)
Reprints of Books I, II, & III. by Check or Money Order to:

Tidbits Media, Inc.

1430 I-85 Parkway, Suite 301
Montgomery, AL 36106
(800) 523-3096

(Alabama residents add appropriate sales tax.)

The Tidbits® Paper is a Division of Tidbits Media, Inc. • Montgomery, AL 36106
(800) 523-3096 • E-mail: [email protected] • All Rights Reserved ©2008

Nov 12 - Nov 18, 2020 Tidbits of Lower Treasure Valley Page 7

* Yard sales sponsored by churches BETTER LIFESTYLE HOME MEDICAL SUPPLY
and other charities can be a great HAIRCUTS
source of bargains, especially at New and Refurbished Medical
this time of year. Since they are a Equipment and Supplies
fundraiser, usually with donated
items, they are motivated to sell, We Will Save You Money!
even if it’s at a lower price. Often-
times you can get items that still (541) 216-6468
have tags, which make great gifts.
2390 SW 4th Ave ∙ Ontario
* “If your toothpaste is almost
done, just snip off the top and Mini Mall
dip your brush in the container.
There’s usually more in the tube.” Crafter’s Supply House
-- T.D. in Kentucky
JDz Bike Shop
* If someone has written on your
dry erase board with a permanent 208-414-4011
marker, try writing over it with a
dry erase marker. Sometimes this 445 State Street, Weiser
works to remove the permanent
marker. We also offer black & white copies

* Wrap a bit of tape sticky side out And we are the only place in
around a straightened-out paper town offering FAX services!!
clip. You can GENTLY put it in the
headphone jack to get out lint that
is otherwise inaccessible. Also,
keep a lint-free cloth that comes
with glasses handy to clean the
screen of your smartphone.

* “If you are inundated by paper,
here are some things you can do
to at least stem the tide: First, if
you can’t bear to shred something
because you think it might be
important, scan it first. If you’re
the kind of person who prints out
and saves things like online bill
payment receipts, print to PDF and
save it electronically.” -- W.L. in
Illinois

* “It’s really annoying when I put
a shirt on or take one off and I get
foundation on the collar. When that
happens, I use shaving cream to
remove it. After removing the gar-
ment, I squirt a dollop of shaving
cream on the stain and rub it in.
Sometimes I try to use a paper
towel to remove some of it before I
put it in the washer. Always check
it before you put it in the dryer!” --
L.M. in Washington

Send your tips to Now Here’s a
Tip, 628 Virginia Drive, Orlando, FL
32803.
(c) 2020 King Features Synd., Inc

GREAT PRICES

GARDEN GALLERY

469 SE 2nd Street
Ontario
971-409-4362

Page 8 Tidbits of Lower Treasure Valley Nov 12 - Nov 18, 2020

Social Security Increase

for 2021

The news is out. Our Social Security
benefit increase starting in January 2021
will be less than it was for 2020.
Instead of the 1.6% increase we re-
ceived this year, they’re cutting us back
to 1.3% for Social Security benefits and
Supplemental Security Income. For the
average recipient, this comes to a whop-
ping $20 per month. The average benefit
will be $1,543 per month and $2,596 for
a couple.
The retirement earnings test exempt
amount will change in 2021 as well. If
you’re not yet at full retirement age, the
annual exempt amount will be $18,960
per year. During the first year you reach
full retirement age, the limit will be
$50,520 per year (before the month you
reach that age).
The way this is supposed to work is
that when the annual inflation rate goes
down, our cost of living adjustment also
goes down. We allegedly don’t need as
much money to get through the month.
(Although the cost of our groceries has
gone up, the price of gas has gone down
because no one is going anywhere now.)
The Senior Citizens League guesstimat-
ed correctly a few months ago that our
increase would be 1.3% -- the second
lowest increase ever.
Meanwhile our Medicare Part B premi-
um continues to climb. The good news
there is the “hold harmless” clause in
the regulations. If the Medicare premium
rises enough that it overtakes our Social
Security increase, the dollar amount of
the Part B premium will be reduced so
we don’t end up with fewer Social Secu-
rity dollars than we received this year.
This applies to most but not all of us.
Keep an eye on the Senior Citizens
League (seniorsleague.org). They fight
for us when it comes to drug costs, vet-
erans benefits, Medicare, Social Security
and more. They’re in Alexandria, Virgin-
ia, right across the river from Washing-
ton, D.C., and the halls of Congress.
(c) 2020 King Features Synd., Inc.

Sports Quiz Answers Trivia Answers
1. Tom Tupa.
2. The University of Arkansas Razorbacks. 1. Lake Superior
3. Florence Griffith-Joyner. 2. “Gone With the Wind”
4. Keith Tkachuk. 3. Wind speed and pressure
5. “Take Me Out to the Ball Game.” 4. “The Facts of Life”
6. U.S. postmaster general. 5. Lady Gaga
6. Chester Cheetah
7. Big MO. 7. 1.2 to 1.5 gallons
8. “Philadelphia”
9. Common loon
10. Jupiter, with the moon Ganymede

Nov 12 - Nov 18, 2020 Tidbits of Lower Treasure Valley Page 9

Blue Water Sailors and Agent Orange ARIES (March 21 to April 19) Your hon-
esty continues to impress everyone who
--- needs reassurance about a project. But
Blue Water sailors, heads up. The Department of Veterans Affairs has now made be careful you don’t lose patience with
it easier for you to file a claim for Agent Orange exposure. Starting Jan. 1, those who are still not ready to act.
2020, The Blue Water Navy Vietnam Veterans Act of 2019 (PL 116-23) extends TAURUS (April 20 to May 20) Pushing
coverage to those who weren’t inland but were shipboard. The difficulty has others too hard to do things your way
been gathering all the records and logs required to prove your location. could cause resentment and raise more
Now the National Archives and Records Administration has digitized declassified doubts. Instead, take more time to ex-
Navy and Coast Guard deck logs (aka ship or captain’s logs) from 1956-1978 plain why your methods will work.
and put them online to make it easier for veterans to validate their claims. This GEMINI (May 21 to June 20) Be more
includes the hospital ship USS Sanctuary. considerate of those close to you be-
Some particulars: fore making a decision that could have a
* If you were within 12 nautical miles of the coast of Vietnam from Jan. 9, 1962 serious effect on their lives. Explain your
to May 7, 1975, or in the Korean Demilitarized Zone between Jan. 1, 1967 and intentions and ask for their advice.
Aug. 31, 1971, you qualify. CANCER (June 21 to July 22) You might
* If you have any of these medical conditions, you qualify: AL amyloidosis, have to defend a workplace decision you
chronic B-cell leukemias, chloracne, diabetes mellitus Type 2, Hodgkin’s dis- plan to make. Colleagues might back you
ease, ischemic heart disease, multiple myeloma, non-Hodgkin’s lymphoma, up on this, but it’s the facts that will ulti-
Parkinson’s disease, peripheral neuropathy, porphyria cutanea tarda, prostate mately win the day for you. Good luck.
cancer, respiratory cancers and soft tissue sarcomas. LEO (July 23 to August 22) The Big Cat’s
* If you’ve never filed, go ahead and do it quickly. Use VA Form 21-526EZ, Ap- co-workers might not be doing enough
plication for Disability Compensation and Related Compensation Benefits. If you to help get that project finished. Your
did file and were turned down, try again, and use VA Form 20-0995, Decision roars might stir things up, but gentle
Review Request: Supplemental Claim. Payment is retroactive to when you first purrr-suasion will prove to be more effec-
filed. Priority is given to those with a terminal condition. tive.
For more information, go online to www.benefits.va.gov/benefits/blue-water-na- VIRGO (August 23 to September 22)
vy.asp and click on everything. Go to va.gov (put blue water navy in the search Someone you care for needs help with
box). See the digitized records at catalog.archives.gov. a problem. Give it lovingly and without
Remember: Agent Orange was in the water you drank onboard and the shower judging the situation. Whatever you feel
water you stood under. It was in your coffee, your laundry ... even if your ship you should know will be revealed later.
had a water supply system to convert seawater. LIBRA (September 23 to October 22)
While you’re to be admired for how you
(c) 2020 King Features Synd., Inc. handled recent workplace problems, be
careful not to react the same way to a
new situation until all the facts are in.
SCORPIO (October 23 to November 21)
Rely on your keen instincts as well as the
facts at hand when dealing with a trou-
bling situation. Be patient. Take things
one step at a time as you work through
it.
SAGITTARIUS (November 22 to Decem-
ber 21) Your curiosity leads you to ask
questions. However, the answers might
not be what you hoped to hear. Don’t re-
ject them without checking them out.
CAPRICORN (December 22 to January
19) Be careful not to tackle a problem
without sufficient facts. Even sure-footed
Goats need to know where they’ll land
before leaping off a mountain path.
AQUARIUS (January 20 to February 18)
Appearances can be deceiving. You need
to do more investigating before invest-
ing your time, let alone your money, in
something that might have some hidden
flaws.
PISCES (February 19 to March 20) Your
recent stand on an issue could make you
the focus of more attention than you
would like. But you’ll regain your privacy,
as well as more time with loved ones, by
week’s end.
BORN THIS WEEK: You’re a good friend
and a trusted confidante. You would be a
wonderful teacher and a respected mem-
ber of the clergy.

(c) 2020 King Features Synd., Inc.

Page 10 Tidbits of Lower Treasure Valley Nov 12 - Nov 18, 2020

1. Is the book of Ananias in the Old THE LUSITANIA
or New Testament or neither?
2. From Micah 7:19, where does (continued from page 6)
God place forgiven sins? Depths of
sea, Heathen hearts, Past the stars, • Although the Lusitania was a passenger
Fiery pits liner, it had been officially declared an
3. In the book of Revelation, Jesus Armed Merchant Cruiser, and about 173
said, “I am Alpha and ...”? Beta, tons of war munitions were hidden aboard.
Omega, Eternity, Delta Just days before the torpedo attack, New
4. From Psalms 60:8, David said, York City newspapers had published a
“Moab is my ...”? Terrier, Washpot, warning issued from the German Embassy
Courier, Warrior in Washington, D.C. stating that Americans
5. What was the home of Peter, An- traveling on British or Allied ships in war
drew and Philip? Caesarea, Assos, zones did so “at their own risk.” The seas
Sardis, Bethsaida around Britain had been declared a war
6. On which mount did King Saul zone by the Germans three months prior to
die? Sinai, Moriah, Pisgah, Gilboa the attack.

Comments? More Trivia? Gift ideas? • The British Admiralty warned the Lusitania’s
Visit www.TriviaGuy.com captain to stay out of the area or to pursue
(c) 2020 King Features Synd., Inc. a zigzag course to confuse enemy ships
tracking their course. Captain William
Turner did not adhere to the Admiralty’s
instructions, despite having been given two
warning messages the night before.

• Turner escaped the sinking ship, swam to a
floating chair, and managed to hold on to it for
three hours when he was rescued. He was
charged with negligence for failure to comply
with Admiralty instructions. However, in the
end, the German government received all of
the blame, and Turner, Cunard Line, and the
British Navy were absolved. In 1916, Turner
was assigned to another ship, carrying
troops for the British government. Ironically,
that ship was also torpedoed by a German
U-boat, this time in the Mediterranean Sea,
with a loss of 120 souls. Turner was once
again saved, but remained at the helm until
the last lifeboat was lowered.

• With relations between the U.S. and Germany
already strained following the sinking of the
Lusitania, the United States declared war
on Germany in April, 1917 after a German
U-boat sank the American ship Housatonic.

Nov 12 - Nov 18, 2020 Tidbits of Lower Treasure Valley Page 11

PHOTO: Michael Douglas in “The American
President”
Photo Credit: Universal Pictures

No matter where your vote is on the political spectrum, I think we
can all agree that this election season has been dramatic. Here are
seven political films to unite all movie fans. I propose a bipartisan
resolution to have some popcorn. All in favor? Say “aye!”

“Dave” -- A no-good commander in chief has a heart attack and goes into a coma. So his scheming chief of staff (Frank Lan-
gella) installs a presidential impersonator -- temp agency owner Dave Kovic (Kevin Kline) -- as a believable substitute. Dave
might look like POTUS, but his go-gooder energy and affable manner set him apart as he navigates his way through cabinet
meetings and budget decisions -- and around the microscope of a skeptical first lady.

“Swing Vote” -- Bud Johnson (Kevin Costner) is an average Joe from Texico, New Mexico. On Election Day, Bud’s precocious
daughter Molly attempts to vote on Bud’s behalf, setting off an unlikely series of circumstances that places the outcome of the
presidential election squarely on Bud’s shoulders. Both parties and candidates come a-courting -- and a-pandering.

“The American President” -- Michael Douglas plays President Andrew Shephard, who has the unusual distinction of being a
bachelor in the White House. It’s hard to date when you’re the leader of the free world, so when he meets a fascinating wom-
an (Annette Bening) and begins a relationship, it’s no surprise that the press is relentless. It doesn’t help that a political rival
(Richard Dreyfuss) is moving in for the kill.

“Lee Daniels’ The Butler” -- Forest Whittaker plays Cecil Gaines -- loosely based on real-life Eugene Allen -- who gets a job
as a butler serving the first family and ends up tending the needs of presidents from Eisenhower to Reagan and more. Over
three decades, his professional capacity is unquestionable, but his relationship with his wife and son show the signs of stress.

“Election” -- In a delightful black comedy, Reese Witherspoon stars as Tracy Flick, a determined Type A overachieving high-
school student whose ethics are ... questionable. Matthew Broderick plays her foil as the high-school government teacher who
backs a likable athlete as her opposition for student body president.

“Wag the Dog” -- A sex scandal on the cusp of the presidential election leads a presidential adviser (Anne Heche) to bring in
some help: a spin doctor (Robert De Niro) who, in turn, brings in a Hollywood producer (Dustin Hoffman) to cook up a little
fake war in Albania as a distraction from negative news for the president.

“The Distinguished Gentleman” -- A professional con man (Eddie Murphy) uses name recognition to take his scam national
when he decides to run for Congress. It’s the biggest game you can get -- lux offices, swank fundraisers and all the perks
that good government can buy. Just don’t develop a conscience!

(c) 2020 King Features Synd., Inc.

Page 12 Tidbits of Lower Treasure Valley Nov 12 - Nov 18, 2020
PHOTO CREDIT: Depositphotos

Cactus Is a Prickly Treat

I was shopping in an ethnic grocery store when I saw a huge pile of fresh Prickly Pear
cactus pads in the produce section. Prickly Pear cactus is thought to be native to Mex-
ico and is eaten as a vegetable. The cactus is called “nopal” in Spanish, and the pads
or stems are called “nopales.” Mexico exports 40,000 pounds of nopales pads to Texas
every day. They’re also grown as an export crop in Central America and Israel.
The pear-shaped fruit on the ends of the nopal pads are called “tunas,” and range in
color from a greenish-white to purple. If the tuna fruit are sweet, they’re eaten raw or
used to make wine or as a sweet syrup. If sour, they’re cooked and incorporated into
a variety of recipes. I’ve always wondered about the first adventurous cook to take this prickly crop and turn it into a delight-
ful dish!
Preparing the fresh cactus pads takes time and care, as all of the prickly spines and thorns must be carefully removed. After
the pads have been prepped, they’re grilled or boiled until tender. When sliced thinly, the nopales are called “nopalitos.” They
look like French-cut green beans and have a similar texture.
You can buy nopalitos in a can or jar, and both the fresh nopales and the canned variety are widely available in ethnic super-
markets. I prefer the ease and convenience of using the canned nopalitos because it’s difficult to prepare them properly the
first few times. Be sure to rinse the canned nopales well before using them.
Nopalitos are a popular ingredient in Mexican dishes. They’re scrambled with eggs and served during the Mexican celebration
of Lent, used as a taco filling, as a vegetable in soups, or breaded and eaten like French fries.
I used breaded nopalitos as a crunchy topping for this unusual Fried Cactus Salad. Enjoy this taste of Mexico, and try nopali-
tos in your recipes to give your dinner a South-of-the-Border flair!

FRIED CACTUS SALAD

1 cup fresh nopalitos, rinsed, drained and patted dry
1/3 cup all-purpose flour
2/3 cup cornmeal
1 teaspoon chili powder
1 1/2 teaspoon salt
1 teaspoon ground black pepper
1/8 teaspoon cayenne
1 cup vegetable oil

1. To make the fried cactus, place flour, cornmeal, 1 teaspoon salt, black
pepper and cayenne pepper in a small bag. Shake the bag to mix the ingre-
dients. Drop the rinsed and drained nopalitos into the bag. Shake until the
strips are well-coated.
2. Heat oil in a medium-sized skillet, about 2 to 3 minutes. Fry the strips
until they are golden brown. Place strips on a paper towel to drain, sprinkle
with the remaining salt, and set aside.

Salad:
3 tablespoons chopped white or sweet onion
1/2 cup chopped fresh cilantro
1/2 teaspoon dried oregano or 2 teaspoons fresh
Romaine Lettuce, torn into bite-sized pieces
1/4 cup prepared Italian Dressing

Topping:
3 tomatoes, sliced
1/3 cup chopped fresh cilantro
1/3 cup crumbled queso fresco or anejo or Monterey jack cheese
1/3 cup purple onion rings
1 avocado, peeled and sliced (optional)

Place the onion, cilantro, oregano and lettuce into a large bowl. Drizzle with the salad dressing. Toss to combine. Top with the
tomato slices, cilantro, cheese, onion rings and avocado. Sprinkle the fried nopalitos over and around the salad. Makes about
4 servings.

Angela Shelf Medearis is an award-winning children’s author, culinary historian, and the author of seven cookbooks. Please join The Kitchen Diva in
supporting Mattress Firms’ efforts to assist foster children through the Ticket to Dream Foundation to make a positive impact on the lives of hundreds of
thousands of foster children in need. They believe not everyone can be a foster parent, but anyone can help a foster child. (www.tickettodream.org)

(c) 2020 King Features Synd., Inc., and Angela Shelf Medearis

BIBLE TRIVIA ANSWERS:
1) Neither; 2) Depths of sea; 3)
Omega; 4) Washpot; 5) Bethsaida;
6) Gilboa