More pages online!!! For Ad Rates Call 541-212-0914 R
at
ALL RIGHTS RESERVED ©2019
www.tidbitsweekly.com/
publisher/treasure_valley Issue # 893
[email protected]
Nov 19, 2020 - Nov 25, 2020
www.oregontrailpub.weebly.com
DON’T SETTLE FOR Se habla español TIDBITS® LOOKS UP WORDS IN THE ADJUSTABLE
COMFORT
CHEAP DENTURES frEECall for a DICTIONARY
COME TO US FOR by Janet Spencer Save NOW on all adjustable bases!
Consultation Come along with Tidbits as we learn about dictionaries!
CUSTOM DENTURES AT A
COMPETITIVE PRICE! Insurance and
Payment plans accepted
Custom made Dentures
Warranty on ALL Dentures Accepting Medicaid
SAme DAy Repairs & Relines
Senior DiSCountS
Flexible Partials
PoRCeLAin teetH Available
Dentures oVeR implants
205 W. Logan St. 188 east Lane, Ste. 3, 10480 W. Garverdale Ct.
Caldwell ontario, oR Ste., 804A • Boise
for more information visit: eurodenture.com
208-609-3341 DICTIONARY
FACTS
OPEN Monday-Thursday until 7:00pm
Friday and Saturday until 8:00pm
Quick Loan and Soda Shop located at • Robert Cawdrey first released his book ∙ Read a book or watch TV in comfort
204 N. Whitley Drive, Fruitland “A Table Alphabeticall” in 1604, one of the ∙ Reduce lower back pain
first dictionaries of the English language. ∙ Reduce acid reflux ∙ Reduce snoring
PAYDAY LOANS DAILY ∙ Quit sleeping in your recliner and be comfortable in bed
RATES! • Samuel Johnson’s “A Dictionary of the
English Language” was published in We have a great selection of
Locally Owned & Operated England in 1755. It was the first dictionary mattresses that are made for
to try to include all English words with
208-452-4050 definitions and examples. It was the your new adjustable base.
leading dictionary until the Oxford
English Dictionary (OED) appeared 173 541-889-5642
years later. Johnson did the work on the
dictionary by himself. He was paid the 398 South Oregon Street ∙ Ontario, Oregon
equivalent of $250,000 for the job.
If it’s broken, my grandpa can fix it!
• Johnson thought his dictionary would take
three years to complete. Actually it took Treasure
nine. The OED was estimated to take Valley
10 years but it took 70. Meanwhile, work
on the definitive dictionary of the Welsh Windshield
language began in 1921 but was not & U-Haul
completed until 2002.
1965 NW 9th Street, Ontario
• Samuel Johnson left the letter X out of his Oregon 541-889-0037 Idaho 208-741-4629
dictionary, claiming that X “begins no word
in the English language.” The current OED Home of the $50 Rebate
lists about 400 words that start with X. ON WINDSHIELD REPLACEMENT
• The unabridged OED includes definitions
for about 600,000 words. If laid end to
end, the typescript for the first edition of
the Oxford English Dictionary would have
stretched over 200 miles (321 km).
Turn Page For More!!!
425 S Whitley Dr. #12 Fruitland, ID 83619
20% OFF LEON’S PUMPS LLC
any purchase Sales ∙ Service
over $40 Installation ∙ Repair
Some Exclusions Apply Do It Right The First Time
Call Or Stop In Today Licensed in (541) 889-6353
To Sign Up For One Of Oregon & Idaho
Our Classes! Beginners [email protected]
CCB#214732 203 NE 1st Street ∙ Ontario
Welcome!
Tuesday-Saturday
10:30am-6:00pm
mowers on sale now!
Stop by for details.
Page 2 Tidbits of Lower Treasure Valley Nov 19 - Nov 25, 2020
PRO RENTALS & SALES
35 NE 1st Street Phone: (541) 889-5233
Ontario, OR 97914 PRORENTALSANDSALES.COM
Mon-Sat Bulk Clover 1372 Southwest 8th Ave
10a - 5p & Local Honey Ontario, OR 97914
Phone (541) 889-4600 | Fax (541) 889-5480
$3.00 per pound brookdale.com
in your own container Assisted Living ∙ Facility No. 24022
2330 Hwy 30 West, Fruitland 208-452-7035 Come see us about our Move In Special!
DICTIONARY FACTS (cont) We offer a full line of parts for all
brands listed
• The word “unabridged” on a dictionary
does not mean it contains all the words Downgrad-
in the language, but actually means that ing
it contains all the words that appeared in
previous edition. Cat’s Fresh
Food Diet
• The world’s bestselling dictionary is the Xinhua
Zidian Chinese language dictionary, which DEAR PAW’S
has sold over 400 million copies worldwide.
wbeaesRnYfeugocreuolotrntuinngSgheeecbndtyiionforrgonmDWsaomvigtiynhgjosbanindCAOapnRriulNnaEenmdRp:hlaoIvye-
• The word “esquivalience” defined as
“the willful avoidance of one’s official DmEeAnRt cPhAeWck’S. WCitOhRnNoERn:ewMjyob yet, I need to
responsibilities” appears in the New Oxford sol1aelf2irdpaygtyrpteheeaseaaimdssrratssiqi.wxcsuoTeaipildnhtdlee-lat,ybceatar’ircsneba.eudilpMtdtrdihodnybiibeostacagthdcabe“ioklstHpyfc“eaiamppSsxtltrciyiplecnhkeofsee”auntch”uprissalilietpess,9stiotyoneagcreastnonthledrdoaufnogdohd
American Dictionary. It’s actually a fake becapulsues If’rveeshbeepnetcofonosudmferdomwitthhe grocery. Will
word, designed to protect the copyright of rIh’uavdsnveheinerietnteimsgswoetaliavttenyohdewhwataeolcbakouglhtsemhiitnmymbe.saiBesfcrukaIctniottdaehnlimbsctaryapraeetocalkyrfroaroidly?r-e-pHlaecneryheinr
the dictionary from plagiarists. with our daiWlyowrcaelksst.erT,rMouabslesaics,husetts
• “Aardvark” isn’t the first word in the dictionary. Hatchet will not listen or come when
The Oxford English Dictionary lists several
words before it, including aa (a stream), ICacnaDllEhehAibmRe, HreesEtprNeaciRniaeYldly:? Ta—thtaDhneokupgyaorLku.,. for putting Silk
aal (a mulberry), aam (an old unit of liquid Aufsitrisnt, Tinexyasour household budget, especially in
measure), aandblom (a wild flower), and
aapa (a term, originating in South Asia, for DthEeAsRe tDouOgUhG:timGeivsi!ngGivHeatycoheutr cat’s veterinar-
an older sister). riwseifaitrahfegonsrhheuieaamrrt-ictddtraeaaoaliilnl!ysiaO,nixnghn-decmiensdyohboionsauuctslshiudctasbprostirbcwetekhodartiekheknoisnfcsrigeetoumatiporne.scWrioputilodna
skilclsarnignhetdbafcokoudp —beesOpeKci,alalynidf ynoout threaten Silk’s
NEW WORDS huhsiCmeeopamioslsmtihttfhiio?tveterinTbrgweehisthnetofioctathrhhncianestsgmwdheyaeeniol’trusymdweceeaatahnpltokiedndnwosg.dittsshopoencitahl efocoodn.dition
imYporuovecahnis pberhoabvaiobrlayndstroepspobnusyeitnog those prepack-
• Around 1,000 new words are added to the cmoaBatmgiyelemcytadiauornesufdermseHg. osearhtetchpfeieaentstaiilsnyfoacooisanedlnslyiyoofrubordarowcygka,olhkuoesrn
dictionary every year. Words recently added cat, at least un-
to dictionary include: track. Instead,
• Latinx: gender-neutral version of Latino or andprmeapyarneotarefsepwondatyosc’ owmomrathndsof fresh cat food
Latina ahpsuealiptkisspnenhya’.optcBprmheielisyecpakoablensitydnthlienesogtpdrewaidatteiuemlwlnntthiaonewgtnuhitehnhrei“tchciwlieomf,mau.spelI”alfeyacsoaonkdeda
protein
• Kombucha: fermented tea (do not
• Schnoodle: a cross between a schnauzer comamdadndspatictheespoarrk,skaelet)p hainmdosnmhias shing together.
and a poodle loseenIaefstFmahhrHasefdtaousctlrrceohiCmhtmnheofgamutoorwlgoadaliandoctaldekensnwsodnderah’ntceislpdaeditemtwoisrnhrpofatoetrrhopokoesviwndbep,aiaettsrhhikolfsih.eutitthmlphreeepafltreiSmgielekrnagtteeodtr.swkietyh
spfsoneshcerahynamapsoutpicscuyhtfaorleoldfwicfeoik,sinbdtsuthaupte,kes.oeesSatdhithebtheinuhamlrierteoiddrtnrotoidosggdotthsrgrra,teysehcovctciroeastohtnirefemtdricmihmenamevafneerrjeoliun.oanmsenpTtddh,aenthvoeafttfe-wrtihinllea-mrsiaheneeltf
• Adorbs: short for adorable
• Embiggen: to enlarge things
• Welp: a slang version of “well” used to show
disappointment or resignation
• Bingeable: suitable to be binged
• Swole: bulging, as in muscles
• Page view: How many people visit a website
• Go-cup: a portable container for liquids
(Continued)
trahineinrgn—eetdhisngfsolrikae afertwhritmis opanitnhosr. If she is taking
etainrmmednieoce’.citdBnrgiieenecstesatti,topnifragoolnniubncdlsetkhma!bessew. wMasyueaorklflee,hsdtiusooroenuintt’dhtcoolsuoskerdime pthoenmhienrymouerd-
Send your comments, qbueusdtiognestoirntgip.s
to [email protected].
Se©n2d02y0 oKiungrFteiaptusre,s Scyondm., Imnc.ents or questions to
[email protected].
(c) 2020 King Features Synd., Inc.
Nov 19 - Nov 25, 2020 Tidbits of Lower Treasure Valley Page 3
Serta Mattresses & Boxsprings FOR SALE
Queen Size
2001 Honda Civic FARM FRESH APPLES
only $95-$195 / set GOOD CONDITION RED DELICIOUS
Full Size, 112,448 miles ONLY $.65 per pound.
Quality Tires 9mm And Other
Extra Long only $150 / set $1800 cash only
541-216-8336 Ammo For Sale Also
Proceeds help fund the FREE CLINIC at Four Rivers Health Care. Payette/Ontario New Plymouth
Most donations of building materials are eligible for a tax deduction. 208-761-4110
We'll pick up your donations FREE from our local area.
Free Standing Oil Stove, Brass & Glass ALL proceeds go to support
1701 SW 4th Ave, Ontario · 541-889-3078 Door. Looks Like Wood Stove, asking meals on wheels
MMoonn--SSaatt:190-55 · ccbbssoonnttaarriioo..ccoom $600(New$2900), Small Mobile Home Wood Heat
Stove $150, 20’ Single Axle Flatbed Farm Trailer Due to current restrictions we are changing the venue to Facebook.
1. What is the name $150, 16’ Aluminum Boat w/Trailer $250, Old Model
of the fuzzy blob that “T” Axles, Gas Water Heater $150, 1940-1970 Harley Please visit the Festival of Trees
serves as mascot Parts, Old Pepsi vending Machine $400, Elm Wood facebook page to view and
for the Western green and dry $175, 2 Table Saws $60 each, 100s
Kentucky University new old stock aricraft parts $250, Ladder Rack for purchase Trees, Wreaths and
Hilltoppers? Small Pickup $150, 50 Caliber Cannon 2’ long $175 Centerpieces!!
2. What mixed martial arts fighter won a
major upset at UFC 193 in 2015 and gave 541-709-0278 Ontario THE FUN STARTS FRIDAY MORNING!
Ronda Rousey her first loss?
3. What team selected goaltender John MISCELLANEOUS LETTER FACTS
Vanbiesbrouck with their first pick in the
1993 NHL Expansion Draft? The “Books Only” Need cash now, • The letters “A” and “I” are the shortest English
4. How many double stitches are hand- Store don’t want to have words.
sewn on the cover of an official Major an estate sale or yard
League baseball? Chris’s Book Corner sale, call the Trea- • The letter S is the most frequently used letter
5. The Hopman Cup tennis tournament is 322 State Street, sure Valley Picker for to start words, because it combines with
named after Harry Hopman, a player and Weiser Idaho unwanted items, an- every letter except B, Z, and X.
coach from what country? 208-549-8191 tiques, jewelry, tools,
6. Who did unheralded boxer Hasim Rah- Mon-Fri 9:00-5:00 furniture, musical in- • The letter T is the most frequently used
man knock out to win the unified heavy- Sat 9:00-4:00 struments, garage consonant. The letter E is the most common
weight championship in April 2001? sales items & misc. letter, found in 11% of all words.
7. Nick Nolte and country music artist We buy storage units,
Mac Davis starred in what 1979 football garages & barns. Call • Q is the least common letter in the English
comedy film? 208-405-9647. alphabet, followed by J and Z.
(c) 2020 King Features Syndicate, Inc.
Classified Advertising Rates: • W is the only letter in the alphabet that has 3
$8.00 for the first week for up to 20 words, up to 3 ad- syllables; all others have one.
ditional weeks for $4.00 each when paid at the time of
original ad placement. For additional words, add 20¢ • The dot over the letters “i” and “j” is called
per word per week, for border and yellow highlight, add a “tittle” from the Latin “titulus” meaning “a
$2.00 per week. Payment Options: Credit Card- call small mark.”
541-212-0914 - Check or Money Order - mail your legi-
ble ad with payment to: Oregon Trail Publications, P.O. • Invented in 1524 by an Italian, the letter “J”
Box 93 Ontario, OR 97914 was the last letter to be added to the alphabet.
All ad copy must be approved by Tidbits, which reserves the right to edit or reject any ad request • Only four letters (A, E, O, L) are ever doubled
that we find, in our sole discretion, to be questionable or not in good taste. In the event of typo- at the beginning of a word (aardvark, eel,
graphical errors, errors in publication, or omission in or from an ad, Tidbits liability will be limited ooze, llama, etc.), and more words start with
to the reprinting of the ad. By placing an ad in Tidbits, you waive any claim for consequential, double O than any others.
incidental, or other damages. All items listed are subject to prior sale. Tidbits considers it’s ad-
vertisers reliable and verifies as much data as possible. However, readers using this information ALPHABET FACTS
do so at their own risk. It is suggested that investors contact the appropriate consumer agency
before sending payment. Although persons and companies mentioned herein are believed to be • The English word “alphabet” comes from the
reputable, neither Tidbits nor its’ employees accept any responsibility whatsoever for their actions names of the first two letters of the Greek
or claims. For more information to help you avoid rip-offs and exercise your consumer rights, alphabet: “alpha” and “beta.”
write: FTC, 600 Pennsylvania Avenue NW, Washington, DC 20580 or log on to http://www.ftc.
gov/bcp/consumer.shtm. • The 26 letters of the English alphabet make
up more than 40 distinct sounds.
• About 100 languages are based on an
alphabet very similar to the English alphabet,
making it one of the most widely used
alphabets in the world. While some languages
have a few more and others a few less, they
all share the 23 core letters originally found
in the Roman alphabet of the Latin language.
(The Romans lacked J, V, and W.)
• There are about 250 alphabets in the history
of the human language. Of those, only 50 are
still in use today. Half of those are found in
India. (cont)
WE’RE HERE TO HELP!! PLEASE GIVE US A CALL WITH YOUR
QUESTIONS AND WE WILL HELP IN ANY WAY WE CAN.
541-889-8012
For Up To Date Information Visit www.ontariochamber.com
Ontario Area Chamber Of Commerce
Page 4 Tidbits of Lower Treasure Valley Nov 19 - Nov 25, 2020
CHOICE ∙ DIGNITY ∙ COMPASSION ∙ HOSPICE Malheur County
SIGNATURE healthcare Veteran's Service Office
at home
* On Nov. 28, 1582, William Shakespeare, Connie R. Tanaka
care where you are 18, and Anne Hathaway, 26, pay a 40-pound
bond for their marriage license in Stratford-up- Providing help with your Veterans Benefits
208-642-9222 on-Avon. Six months later, Anne gives birth to
Ask your doctor about Signature Hospice. their daughter, Susanna, and two years later, 541-889-6649
to twins.
WORD FACTS Call for an appointment
• The English words with the largest number
Memorable Movies
of separate definitions are the words “set”
(430 separate definitions, which take * On Nov. 27, 1868, Lt. Col. George Armstrong THE BIG LEBOWSKI
60,000 words to explain) and “run” with 645 Custer leads an early-morning attack on a
separate meanings for the verb form of the band of Cheyenne in Oklahoma. Custer did • “The Big Lebowski” is a 1998 comedy film
word alone. not attempt to identify the group of Cheyenne, written, produced, and directed by Joel and
or to make even a cursory reconnaissance. Ethan Coen. It stars Jeff Bridges as Jeffrey
• The 28-letter “antidisestablishmentarianism” Had he done so, he would have discovered “The Dude” Lebowski, a slacker and bowler
is considered the longest “non-coined, non- that they were peaceful people and the village with a laid-back attitude and a fondness for
technical” word in most dictionaries. It was was on reservation soil. cannabis. He is assaulted by some thugs
created to describe the Church of England who mistake him for a different guy named
in the 19th century. * On Nov. 26, 1922, in Egypt’s Valley of the Jeff Lebowski. The movie’s title establishes
Kings, British archaeologists become the first that the other Lebowski is the “big” Lebowski
• The word “incomprehensibilities,” with 21 souls to enter King Tutankhamen’s tomb in because of his wealth. The movie is a mad-
letters, has been named the longest word more than 3,000 years. Inside were several cap adventure resulting from circumstances
“in common usage.” thousand priceless objects, including a gold surrounding this case of mistaken identity.
coffin containing the mummy of the teenage
• The top ten most-used words are: “the,” king. • Before filming a scene, Jeff Bridges would
“be,” “to,” “of,” “and,” “a,” “in,” “that,” “have,” rub his knuckles in his eyes to make his eyes
and “I.” These ten words alone account for * On Nov. 29, 1942, coffee joins the list of bloodshot, to achieve the look of a stoner.
25% of the total words we use. items rationed in the United States during
World War II. Butter, sugar and milk had been • A lot of the Dude’s clothes in the movie
• The most-used adjective in English is “good” rationed earlier. By the end of the year, cars were Jeff Bridges’s own clothes, including
but the word “bad” doesn’t show up until the were limited to 3 gallons of gas per week. his Jellies sandals, which he still owns and
23rd slot, right below “public,” “few,” and uses to this day. For much of the movie he
“important.” * On Nov. 23, 1966, Elvis Presley’s 22nd film, was dressed in boxer shorts, t-shirt, and
“Spinout,” in which Elvis played a singing race bathrobe.
• The most-used verb in English is “be.” The car driver, opens in theaters.
most-used noun is “time” which dominated • The bowling shirt The Dude wears in the
all other nouns including runners-up * On Nov. 24, 1971, a hijacker calling himself movie bears the logo for a company called
“person,” “year,” “way,” and “day.” D.B. Cooper parachutes from a Northwest Medina Sod. The shirt once belonged to
Orient Airlines 727 into a raging thunderstorm a man named Art Myers, who was the
• C. S. Lewis coined the word “verbicide” to over Washington state. He had $200,000 in foreman at Medina Sod in Medina, Ohio.
denote the killing of a word or the distortion ransom money and was wearing only wrap- The costumers for the film found the shirt in
of its original meaning. For instance, “hussy” around sunglasses, a thin suit and a raincoat. a thrift shop in L.A. and figured it displayed
comes from the word housewife and used No trace of Cooper was ever found, but in the perfect amount of grunge for the part.
to refer to the mistress of a household, not 1980 a child found $5,880 of the ransom
the disreputable woman it refers to today. money. • In the script, The Dude mentions that he
To “quell” originally meant “to kill” and now was a roadie for Metallica on their (fictional)
it just means “to subdue.” “Meat” used to * On Nov. 25, 1990, after a howling wind and “Speed of Sound” tour and refers to the band
denote any solid food, not just the flesh of rainstorm on Thanksgiving Day, Washington members as a “bunch of assholes.” The
animals. “Awful” used to mean “full of awe” state’s historic floating Lacey V. Murrow Me- members of Metallica were flattered to be
rather than “terrible.” The word “artisan” morial Bridge slowly breaks apart and sinks to referred to in a Coen Brothers movie, even
used to mean “made by hand” but now the bottom of Lake Washington. News crews if it was in a derogatory way. On the other
means “quality.” captured the whole thing on camera. hand, during a bowling scene, a song by the
(c) 2020 Hearst Communications, Inc. Eagles plays on the muzak, and The Dude
• Richard Lederer coined the word “verbivore” All Rights Reserved later mentions that he hates the Eagles.
to describe someone who devours and Eagles founder Glenn Frey later confronted
feasts on words. Jeff Bridges about that scene in the movie,
which made for an uncomfortable moment.
Nov 19 - Nov 25, 2020 Tidbits of Lower Treasure Valley Page 5
PARKERBUILDINGS.COM Family owned and operated since 1919, Tires ∙ Wheels ∙ Brakes
trust us to be here tomorrow! Shocks ∙ Oil Changes
Building Material Supplier Lift Kits ∙ LED Lighting
Exceeding Your Expectations Engine Diagnostics
ENCLOSED PERMITTED BUILDING Vehicle Accessories
Fusion Bumpers
541.889.8693
280 South Oregon St
∙ Ontario ∙ Mike
www.blackabyinsurance.com Blackaby Have a smart phone?
Follow us!
“Insurance is what we do,
service is how we do it.” Facebook Website
KIT CONTAINS: (1) 3’x6’ - 8” Entry Door, (1) 11’ wide THE BIG LEBOWSKI
Slider Door, Galvanized Roof, Painted Walls & Trim.
(cont)
These buildings have Engineered Plans
& price is based on 25# Snow Load, “C” Exposure. • In one scene as The Dude writes a
check for 68 cents at Ralph’s grocery,
24 x 36 10’ Eave 12’ Eave 14’ Eave 16’ Eave 1. GEOGRAPHY: The country of Equito- he watches George H.W. Bush give the
30 x 36 $8,650 $9,490 rial Guinea lies on which continent? “This aggression will not stand” press
30 x 48 $10,165 $10,926 2. MOVIES: Which 1989 movie contains interview live on television. President
36 x 36 $10,119 $10,973 $11,736 $12,562 the line, “Have you ever danced with Bush gave the interview on the White
36 x 48 $12,091 $12,980 $15,151 the devil by the pale moonlight?”? House lawn on Sunday, August 5, 1990,
40 x 48 $12,532 $13,914 $14,444 3. U.S. STATES: Which state’s official three days after the Iraqi Army invaded
40 x 60 $11,658 $13,379 $17,425 flower is the Rocky Mountain Colum- Kuwait. The Dude’s check, however, is
$13,991 $14,978 $15,935 $19,413 bine? dated September 11, 1991, indicating
$15,957 $16,763 $17,902 $22,007 4. LITERATURE: Which 17th centu- that The Dude is so broke that he had to
$19,344 $20,642 ry Spanish novel includes the line, post-date a 68 cent check by over one
$18,441 “Wit and humor do not reside in slow year.
minds”?
Customizable Options & Prices 5. HISTORY: How many crewed moon • In one scene, a briefcase is hurled out
are available on our website. landings has the United States made so of the window of a moving car. In take
far? after take, the briefcase failed to achieve
BARNS ∙ ARENAS & STALL BARNS ∙ COMMERCIAL 6. TELEVISION: Which 1980s sitcom the desired arc. Finally the driver (John
SHOPS & GARAGES ∙ RESIDENTIAL ∙ WAREHOUSES features a character named Al Bundy? Candy) was told to drive in reverse while
7. LANGUAGE: What action is described an off-scene crew member hurled the
800-331-0155 ∙ 503-981-0890 in the term nephelococcygia? briefcase into the car. The film was then
8. GENERAL KNOWLEDGE: What color reversed.
QUALITY SINCE 1982 is cyan?
FOB Hubbard, OR. Price subject to change without notice. 9. MUSIC: Which group had the 1989 • The bowling alley scenes were filmed at
hit “Love Shack”? the former Holly Star Lanes near Santa
10. ANATOMY: What is a goiter? Monica and the U.S. 101 freeway exit
ramp. The bowling alley has since been
(c) 2020 King Features Synd., Inc. torn down and a new elementary school
stands in its place.
• The Dude is present in every scene in the
movie, even if it’s just through a window,
in the background.
• The Dude says “man” 147 times in the
movie, or about 1.5 times a minute. The
word “dude” is used roughly
161 times. The F-word (or
variation thereof) can be
heard 292 times.
• The film bombed at the box
office, making an anemic
$5 million over its opening
weekend, and barely
covering its $15 million
budget at the domestic box
office. But since its initial
release, the movie has
gained a cult following, to the
point where “Big Lebowski”
festivals are held at various
cities every year. Sales of
the movie on VHS, DVD,
and Blu-ray turned the film
into a cash cow.
• “Rolling Stone” proclaimed
“The Big Lebowski” the “Best
Stoner Movie of All Time.”
Page 6 Tidbits of Lower Treasure Valley Nov 19 -Nov 25, 2020
DIFFICULT WORDS
* Deceased scientists and researchers who • Start with the Latin word “columna” meaning
have contributed to the study of Mars will, in “pillar” or “column.” Morph that into Italian
a sense, live forever on the red planet: Cra- and it becomes “colonello” and now denotes
ters larger than 37 miles are named in their the person at the head of a “column” of
honor. soldiers. But when that word enters the
French language, the French have trouble
* Hans Steininger, who is said to have had pronouncing the word because it has two L
the longest beard in the world, died in 1567 sounds very close together. They change
from tripping over that beard while running the word into “coronel” and pronounce it
from a fire. “ker-a-nel.” Then it goes into the English
language. The English restore the original
* The blue whale is earth’s largest living Italian spelling with two L’s: “colonel” but
creature, surpassing even most dinosaurs. they continue to pronounce it the way the
Not only can it reach over 100 feet in length French had, except that they drop the
and weigh more than 100 tons, but its heart middle syllable. And that is why “colonel” is
can tip the scale at 1,300 pounds and is now pronounced “kernel.”
the size of a small car, while its arteries are
big enough for a full-grown human to swim • The town of Worcester, England, is
through -- not that we recommend you go for
a swim and attempt it. pWroAnNouTnTcOedRU“WN oYoOsUteRr”OWanNdBUrhSyImNEeSsS?with
“Prouobslitsehr.a” The word “shPiarep”emr einaYnsou“croAurnetay” in
EngIlfaYnoudC’sanEPrnovgidleis: hSa,leasnEdxpeisrienpcreo· nA oCoumnpucteerd· “sure”
lDikesekWtotphePeupbrleoisnhviinddgeSootffhtw“eaHroeap· mApoRpertasushonniirateyble.f”oFirWnasnuhciceaclnIenvsaess!tsmaenut ce
was icnCavlealenldtled1W.ion8rc0teh0set.e5srhs2ihr3eire.3ofs0aW9uo6creceasntedr, it
was is
pronouncwewdw: .WtidObOitsstwere-eskulrye.csoamuce.
* In 2007, Iran claimed 14 squirrels found MORE ON PAGE 10 ONLINE AT
near the nation’s borders were actually spies.
www.tidbitsweekly.com/publisher/treasure_valley
* New York City’s Flatiron building used to
cause enough downdrafts to lift the skirts of Information in the Tidbits® Paper is gathered from sources considered to be
women passing by, giving a then-daring view reliable but the accuracy of all information cannot be guaranteed.
of their legs and ankles. The phenomenon
resulted in groups of young men regularly Can’t Get Enough Tidbits?
gathering on 23rd Street to watch.
TRILOGY RESERVE NOW!
* People with autism are less likely to catch
yawns. LimBitoeodk E Sdeittion Send $24.95 (plus $5.00 S&H)
Reprints of Books I, II, & III. by Check or Money Order to:
* The record for most times being hit by a
baseball pitch -- a whopping 287 -- belongs Tidbits Media, Inc.
to Hughie Jennings, who finally got smart and
retired in 1918. 1430 I-85 Parkway, Suite 301
Montgomery, AL 36106
(800) 523-3096
(Alabama residents add appropriate sales tax.)
The Tidbits® Paper is a Division of Tidbits Media, Inc. • Montgomery, AL 36106
(800) 523-3096 • E-mail: [email protected] • All Rights Reserved ©2008
* A bizarre form of Victorian-era entertain-
ment was the “Fasting Girl.” Young women
appeared in public exhibits and dazzled
spectators with claims that they ate nothing
at all. Obviously they munched in secret and
most were eventually caught at it, though,
tragically, some starved to death in a bid for
authenticity.
***
Thought for the Day: “What you leave behind
is not what is engraved in stone monuments,
but what is woven into the lives of others.”
-- Pericles
(c) 2020 King Features Synd., Inc.
Nov 19 - Nov 25, 2020 Tidbits of Lower Treasure Valley Page 7
* This is a wonderful tip re- LIFESTYLE HOME MEDICAL SUPPLY
ceived via e-mail: If you have a
panic button for your car alarm, New and Refurbished Medical
keep your keys by the bedside. Equipment and Supplies
If you experience a problem
during the night, trip the panic We Will Save You Money!
alarm. Let your trusted neigh-
bors know about your intention, (541) 216-6468
and they will be able to assist
you. 2390 SW 4th Ave ∙ Ontario
* “Great gravy is only a plastic Mini Mall
bag away! This is my tip for
separating the fat from pan Crafter’s Supply House
drippings to make gravy. I take
a quart-size plastic bag and JDz Bike Shop
set it in a glass measuring cup.
Pour the pan drippings through 208-414-4011
a strainer, right into the bag. Let
it sit for 15-20 minutes, and the 445 State Street, Weiser
fat will separate to the top. Seal
the bag, and snip a small hole We also offer black & white copies
in a bottom corner, drain the
liquid into a saucepan to make And we are the only place in
gravy. It’s that easy.” -- T.C. in town offering FAX services!!
Idaho
BETTER Mathews Livestock
* Whenever I am baking and HAIRCUTS and Custom Hay
the recipe calls for, say, 1 cup
of honey (or some other sticky ONTARIO, OREGON
substance), I used to pour
the honey into the measuring GREAT PRICES Call John @ 541-889-2516
cup but then have a hard time Call or email Shannon @
getting all the honey back out GARDEN GALLERY
of the cup and into the mixing 541-212-0953
bowl. Now I rinse the measur- 469 SE 2nd Street [email protected]
ing cup with water right before Ontario
measuring, or spray with non- 971-409-4362
stick cooking spray. It slides
right out!
* To create a self-watering area
for potted plants while you are
on vacation, set plants in the
bathtub or in a kiddie pool and
use a length of cotton rope to
wick water from the bathtub
to the plant’s roots. You can
either stick it up the holes in the
bottom of the pot or dig it down
a few inches into the soil. This
should get you by for a week or
so.
* If you have a table that’s
wobbly because of an uneven
leg, and you are a wine drinker,
you’re in luck. Take a wine cork,
cut it in small slices and glue
the slices to the uneven leg un-
til the table no longer wobbles.
Easy!
Send your tips to Now Here’s a
Tip, 628 Virginia Drive, Orlando,
FL 32803.
(c) 2020 King Features Synd.,
Inc.
Page 8 Tidbits of Lower Treasure Valley Nov 19 - Nov 25, 2020
Act Now to Change Your Letters Reach Out to
Medicare Plan
Troubled Vets
Have you finished making your decisions about your Medicare plan for 2021? If you’re go-
ing to make a change, you have only a short time to pick a new one. The deadline is Dec. We’ve been in a stressful period for
7.There are so many options: Medicare Advantage, a supplemental plan or the traditional many long months, and now here
Medicare. And there are many things to consider within those options -- the drugs we cur- come the holidays. It’s going to be
rently take, eye exams, hearing aids, annual preventive tests and more. different this year: fewer (or no)
The place to start is with your current plan. By now you should have received your Medi-
care Annual Notice of Change Letter if you have an Advantage or Part D plan. (You won’t family get-togethers, no parties, little
get one for a Supplemental plan.) The letter will itemize any changes to your 2021 plan, shopping at stores ... in other words, a
including price. Compare your current plan with any changes in your plan for next year.
Have your needs changed this year? Are there new drugs you’re taking? Is your doctor potentially lonely time for many vet-
included in your network? What about the pharmacy you like to use? Are you likely to need erans who are sad or anxious or who
a procedure in 2021? What else are you likely to need in the next year?
Look at your Medicare & You 2021 book that came in the mail. Check inside the front cover have PTSD.
for information on lowering insulin costs, acupuncture for back pain, telehealth visits and The Department of Veterans Affairs
more. (If you can’t find your copy, go online to www.medicare.gov/Pubs/pdf/10050-Medi- has done a randomized evaluation
care-and-You.pdf.) of its Caring Letters Program to test
If you want to consider making a change, go online to Medicare.gov and look at plans for the effects of sending a written letter
your area. For any changes to a supplemental plan, call that plan directly. every month to veterans who have
Don’t try to do this all in one day. Give yourself time to consider what you need, and ask called the Veteran Crisis Line. One
questions. result was that when asked, 85% of
Get personalized help at State Health Insurance Assistance Program (SHIP) at www.ship- psychiatric patient veterans agreed
tacenter.org if you need it. Click on SHIP Locator for listings by state, or call them at 877- or strongly agreed that they would
839-2675. like to receive caring communication
through the mail, and the period of
(c) 2020 King Features Synd., Inc. time was monthly for one year. (This
rated higher than receiving email or
text messages.) Granted, given the
setting, most of them said that contact
with a mental health counselor or phy-
sician was preferred, but I expect that
a message from a friend or acquain-
tance or another veteran would likely
be just as welcome.
At this point, the Veteran Crisis Line
has sent letters to 90,000 veterans
over the past year.
What can you do? You can reach out
to a veteran you suspect might be
struggling, whether it’s with suicidal
thoughts or just loneliness. Monthly
cards or letters in the mail to say hello
are small things that can be huge to
receive when someone is alone and
struggling. Keep the communication
brief, but caring.
If you honestly don’t know any vet-
erans who might be struggling right
now, make a call to the chaplain of
your local American Legion or Veter-
ans of Foreign Wars and ask if there’s
anyone they’re worried about.
If you’re going to do this, make a
commitment to yourself right now that
you’ll do this monthly for a minimum
of one year. The impact of your ef-
fort might be greater than you’ll ever
know.
(c) 2020 King Features Synd., Inc.
Sports Quiz Answers Trivia Answers
1. Big Red.
2. Holly Holm. 1. Africa
3. The Florida Panthers. 2. “Batman” (The Joker)
4. 108. 3. Colorado
5. Australia. 4. “Don Quixote”
6. Lennox Lewis. 5. Six
7. “North Dallas Forty.” 6. “Married ... With Children”
7. Finding shapes in clouds
8. Greenish blue
9. The B-52’s
10. Enlargement of the thyroid gland
Nov 19 - Nov 25, 2020 Tidbits of Lower Treasure Valley Page 9
DIFFICULT WORDS
(continued from page 6)
• The Greek prefix “para” means “apart from” as in the words “paralegal” and “paramedic.” ARIES (March 21 to April 19) Your rul-
The Greek word “pherna” means a dowry. The word “parapherna” denoted “property ing planet, Mars, allows you to assume a
apart from a dowry” and denoted the odds and ends of property that a woman brought sense of command that can help you turn
into her marriage, aside from the dowry. These items belonged to the wife and could a chaotic workplace situation into one
not be sold or disposed of by the husband without her permission. Now “paraphernalia” that’s orderly, productive and, yes, even
simply means “bits and pieces” of any sort. friendly.
TAURUS (April 20 to May 20) Getting a
• Quechua is the name of a language spoken in South America in the region of the relationship that’s been stuck in a rut up
Andes. The English language has absorbed a number of Quechua words, including and running again depends on how far
“jerky” and “puma.” Another Quechua word that gives English speakers a headache is you want to run with it. Be honest with
their name for a starchy herb which yields high-protein seeds: quinoa. It’s pronounced yourself as you consider which decision
“keen-wah.” to make.
GEMINI (May 21 to June 20) Be wary of
• The original definition of “lieutenant” was “an army officer next in rank to a captain, rumors that seem to be coming from ev-
who commands the company in the absence of the captain.” The word comes from the erywhere this week. Waiting for the facts
French “lieu” meaning “place” as “in lieu of” combined with “tenant” meaning “holder” before you act means never having to
as in “holding a position.” A lieutenant is a placeholder for a superior officer. say you’re sorry you followed the wrong
lead.
• In Borneo the local natives speak Malay. In that language, the word for man is “orang” CANCER (June 21 to July 22) A difficult
and the word for forest is “hutan.” Put those words together to get “organ-hutan” personal matter might prompt you to
meaning “man of the forest.” That came into English as “orangutan.” Many people turn to a trusted friend to help you sort
mistakenly add an entry G on the ending, but there is no “tang” in “orangutan.” through a maze of emotional conflicts.
The weekend should bring some welcome
• “Mucus” comes from the Latin word for slime, and denotes any gummy substance. news.
“Mucous” has the same origin but denotes the membranes that secret mucus: the LEO (July 23 to August 22) Some of the
mucous membranes in the nose secrete mucus when you have a cold. new people coming into the Lion’s life
could play pivotal roles in future personal
• Another word for mucus is “phlegm” which comes from the Greek word “phlégma” and professional matters. Meanwhile, an
meaning “inflamed.” The Greek physician Hippocrates theorized that health and old friend might have an important mes-
emotions were ruled by four “humors” of the body, including blood, yellow bile, black sage.
bile, and phlegm. According to Hippocrates, a person who has too much phlegm in VIRGO (August 23 to September 22) A
their system is phlegmatic, making them unemotional and calm. delay in getting things moving on sched-
ule can be a blessing in disguise. Use this
• Leonhard Fuchs was a German botanist, born in 1501. In 1562 he published a book extra time to do more research so you
containing over 500 drawings and descriptions of plants. Fuchs had been dead can buttress any of the weaker points
for more than a century when another botanist described a small flowering shrub with solid facts.
discovered on a Caribbean island. That botanist named the new shrub after Leonhard LIBRA (September 23 to October 22) You
Fuchs, calling it the Fuchsia. Because the flowers were a brilliant color, that color also might need to get involved in a personal
became known as fuchsia. matter before it becomes a serious prob-
lem. Also, be wary of someone offering to
mediate, unless you can be sure of his or
her motives.
SCORPIO (October 23 to November 21)
Taking sides in a workplace or domes-
tic dispute could prolong the problem.
Stay out and stay cool. Then you can be
friends with both parties when things
settle down.
SAGITTARIUS (November 22 to Decem-
ber 21) A friendship has the potential to
become something more, and with this
week’s aspects favoring romance, you
might feel that this possibility is worth
exploring.
CAPRICORN (December 22 to January
19) The new job you want might require
you to relocate. If so, keep an open mind
and weigh all the positives and negatives
before making your decision.
AQUARIUS (January 20 to February 18)
A new relationship seems to be every-
thing you could have hoped for. Congrat-
ulations. Meanwhile, it’s not too early to
get some feedback on that new project
you’re working on.
PISCES (February 19 to March 20) You
might have decided to get out of the
fast-moving current and just float around
hither and yon for a while. But you might
find that the new opportunity is too
tempting to turn down.
BORN THIS WEEK: You believe in bring-
ing out the best in people with kind
deeds, loving words and recognition of
their “special” selves.
(c) 2020 King Features Synd., Inc.
Page 10 Tidbits of Lower Treasure Valley Nov 19 - Nov 25, 2020
1. Is the book of 1 Thessalonians in the
Old or New Testament or neither?
2. To keep Adam and Eve away after
the Fall, what did God place around the
tree of life? Smoking pits, Deep moat,
Cherubims with a flaming sword, Walk-
ing vipers
3. Who is the only daughter of Jacob
specifically named in the Bible (KJV)?
Dinah, Junias, Noadiah, Orpah
4. From 2 Samuel 12, what personality
did God name Jedidiah? David, Amos,
Solomon, Joab
5. What type water did Jesus offer the
Samaritan woman at the well? Fresh,
Cool, Living, Clean
6. From John 10, to what type of ani-
mals are Christians compared? Camels,
Sheep, Lions, Serpents
“Test Your Bible Knowledge,” a book
with 1,206 multiple-choice questions by
columnist Wilson Casey, is available in
stores and online.
(c) 2020 King Features Synd., Inc.
Nov 19 - Nov 25, 2020 Tidbits of Lower Treasure Valley Page 11
PHOTO: Scene from “Secret Life of Pets 2”
Photo Credit: Universal Pictures
---
Warning: Wholesome content ahead. You can always count on a
well-written story to lighten your mood or touch your heart. And,
darn it, sometimes you really need it. Here are a few films out in
the past year that can give you an hour plus of escape into a bet-
ter, more heart-touching world.
“A Beautiful Day in the Neighborhood” (PG) -- Inspired by real life and written about a real-life inspiration, “A Beautiful Day in
the Neighborhood” is a loving biopic of Fred Rogers (Tom Hanks). His story is told through the eyes of an emotional skeptic,
Esquire magazine writer Lloyd (Matthew Rhys), who is assigned to write a short article on Rogers as a hero.
“Jumanji: The Next Level” (PG-13) -- Spencer Gilpin, home on a college break and missing the confidence boost of being the
buff Bravestone of Jumanji, jumps right back into the game. His squad (Bethany, Fridge and Martha) hatch a plot to go after
Spencer, but Spencer’s grandpa Eddie (Danny Devito) and Eddie’s estranged business partner Milo (Danny Glover) are sucked
into the game, too. With mixed-up avatars and some fun new additions (Awkwafina joins as new avatar Ming Fleetfoot), this
fantasy comedy delivers a racing pace, some rollicking good laughs and a surprisingly sweet ending.
“Little Women” (PG) -- This treasured classic tale of the March sisters has been brought back again by director Greta Gerwig
(“Ladybird”), adapted from Louisa May Alcott’s novel and writings. It’s a simple coming-of-age tale, from the perspective of Jo
(Saoirse Ronan), the family writer, who chronicles her and her sisters’ journey to independence. An all-star cast deliver per-
formances that keep this Civil War-set tale as relevant and endearing as it ever was.
“Secret Life of Pets 2” (PG) -- Just when the neurotic Max (now voiced by Patton Oswalt) was getting used to another dog in
the family, along comes a baby to look after! When his family sets off for a visit to the country, a sheepdog named Rooster
(Harrison Ford) teaches Max to find his inner courage in the face of change. Snowball the bunny (Kevin Hart) pairs with a Shi
Tzu named Daisy (Tiffany Haddish) to rescue an adorable white tiger named Hu. These and other storylines converge in a
chuckle fest of an ending that the kids will mightily enjoy.
“Frozen 2” (PG) -- Queen Elsa’s magic has always been a source of wonder. A mysterious force beckons her from a shrouded
forest, threatening Arendale itself and sending Elsa (Idina Menzel) and Anna (Kristen Bell) off into the unknown for answers,
with Kristoff (Jonathon Groff) and Olaf (Josh Gad) in tow. They find out more than they bargained for, including revelations
from the past and the rediscovery of some forgotten people. The showstopper songs -- “Into the Unknown” and “Show Your-
self” -- are every bit as powerful as Frozen’s “Let It Go.” You’ll be singing it for days.
(c) 2020 King Features Synd., Inc.
Page 12 Tidbits of Lower Treasure Valley Nov 19 - Nov 25, 2020
PHOTO CREDIT: Depositphotos
A Happy (and Healthy) Thanksgiving!
Most people eat more at Thanksgiving dinner than they consume in a normal day, and then
continue overeating at year-end. So it helps to have a plan in place to avoid any holiday gob-
bling that you might pay for later.
Turkey, yams, mashed potatoes, green beans and cranberry sauce are all nutritious, so long as
lots of salt, sugar and butter haven’t been added to them, says Kathleen Duran-Thal, director
of nutrition at Cooper Healthy Living at the Cooper Clinic in Dallas.
An earlier study by researchers at the National Institute of Child Health and Human Devel-
opment and the National Institute of Diabetes and Digestive and Kidney Diseases found that
Americans usually gain only one pound during the winter holidays, but the weight put on then
isn’t shed in the new year.
Those findings contradict many people’s views that they gain five to 10 pounds between Thanksgiving and New Year’s Day. Researchers
said the effects of weight gain at year-end, however, are worth worrying about because they contribute to increased weight over time.
Keeping weight stable in the fall and winter may help prevent age-related weight gain and associated diseases, says Dr. Riva Rahl, medical
director at Cooper Wellness. In addition to not looking or feeling top-notch, adults with excess weight are at greater risk of heart disease,
high blood pressure, diabetes and certain cancers, she says.
Cooper Wellness experts say to go ahead and enjoy your favorite Thanksgiving foods, but consider making healthy choices at your turkey
dinner. They offer some tips for keeping you from fiddling with your belt at the end of the meal.
1. First of all, don’t arrive at a Thanksgiving dinner hungry. Eat a good breakfast, and maybe even lunch that day.
2. Fill half your plate with vegetables, one quarter of it with lean meat, and one quarter with starches like mashed potatoes and turkey
dressing.
3. Choose white-meat turkey and avoid eating the skin.
4. Avoid gravy. Turkey doesn’t need to be smothered in gravy to taste good. If you want gravy, just drip a little on your meat and pota-
toes.
5. Limit yourself to small helpings of heavily sweetened yams and cranberry sauces.
6. Use restraint when dinner rolls are passed around. Buttered rolls may melt in your mouth, but they’re full of calories, so eat only one.
7. Try sampling in moderation the many foods that you have looked forward to. And consider bringing something healthy to the dinner,
like a side dish that’s low in fat, sugar and salt.
8. Eat slowly. By eating Thanksgiving dinner slowly, your body has time to register when it is full so that you don’t consume too much.
9. At dessert time, try to choose the lightest options. Pick pumpkin over pecan pie, for example, and avoid 200 calories in the process. Or
just eat half a piece of pie, and pass on whipped toppings and ice cream. As dinner winds down over coffee, avoid any plates of additional
sweets that may be sitting on the table.
10. After Thanksgiving dinner, take a walk with your friends or family. Fifteen minutes of walking will get your blood circulating and can
burn off 100 calories, says Susie Kania, exercise physiologist and director at Cooper Wellness. The fresh air will invigorate you after a long
stay at the table.
(Information courtesy of Cooper Wellness, www.cooperwellness.com)
LIGHT SWEET POTATO PUDDING
Agave syrup is a natural sweetener that doesn’t raise your blood glucose levels. This is a great dessert for everyone, but is particular good
for diabetics.
1 1/3 cups mashed, cooked sweet potato
1/2 cup agave syrup
2 teaspoons ground cinnamon
2 teaspoons grated orange zest
1 teaspoon salt
1 teaspoon ground ginger
1/2 teaspoon ground cloves
1/3 cup egg substitute
16 ounces evaporated skim milk
1/2 cup light whipped topping, optional
1/2 cup chopped, toasted walnuts, optional
Cooking spray
1. Heat oven to 375 F.
2. In a large bowl, combine sweet potato, syrup, cinnamon, orange zest, salt, ginger, cloves and egg substitute. Beat at medium speed
with a mixer until smooth. Add milk; mix well.
3. Pour mixture into a 2-quart casserole coated with cooking spray. Bake at 375 F for 1 hour or until a knife inserted near the center
comes out clean. (For individual servings, pour 2/3 cup potato mixture into each of 4 custard cups. Bake at 375 F for 40 minutes or until a
knife inserted near the center comes out clean.)
4. Let pudding cool. Cover and chill for 2 hours. Serve with a tablespoon of whipped topping and sprinkle with walnuts, if desired. Makes
4 servings (2/3 cup per serving, 88 calories).Angela Shelf Medearis is an award-winning children’s author, culinary historian and the au-
thor of seven cookbooks. Her latest cookbook is “The Kitchen Diva’s Diabetic Cookbook.” Her website is www.divapro.com. To see how-to
videos, recipes and much, much more, Like Angela Shelf Medearis, The Kitchen Diva! on Facebook. Recipes may not be reprinted without
permission from Angela Shelf Medearis.
(c) 2020 King Features Synd., Inc., and Angela Shelf Medearis
BIBLE TRIVIA ANSWERS:
1) New; 2) Cherubims with a flam-
ing sword; 3) Dinah; 4) Solomon;
5) Living; 6) Sheep