The Sun ~ 101120

œ œ
 

INSIDE

TELLING IT AS IT IS Heated Work-from-

argument over page home balance page
80-MP limit needed
2 3

ON TUESDAY NOVEMBER 10, 2020

No. 7656 PP 2644/12/2012 (031195) www.thesundaily.my

CMCO CHECKS ... Police
personnel and Rela members
checking on motorists leaving
George Town at a roadblock near
the Penang Bridge toll plaza
following the implementation of

the conditional movement
control order on the island at

12.01am yesterday.
– MASRY CHE ANI/THESUN

Still short o1%cutinincometaxand2%
decrease in EPF work out to
just RM25 a month:Tax expert
█ BY SHIVANI SUPRAMANI That, he said, will save him RM200 a “This will have significant financial
[email protected] year, or just RM16 a month. consequences later,” he said. “It will lead to
a less favourable lifestyle and reduced
PETALING JAYA: The 1% reduction By opting to reduce his EPF contribution income-generating assets upon
in income tax and 2% cut in from 11% to 9%, the person gets an retirement.”
Employees Provident Fund (EPF) additional RM116.66 per year or just Private sector employee Supramani
contribution hardly add up to much RM9.72 per month of extra cash to spend. Sebastian agrees. “An additional RM25 a
for the average income earner’s immediate month in the pocket does not help to
spending power. “All in all, it works out to just over RM25 reduce the burden on the M40 and B40
a month,” Mohd Fairus pointed out. groups,” he told theSun.
NEXT GEN On average, he gets an additional RM25 “Instead of focusing on the 1%
to spend each month, or less than a ringgit a However small, the reduction in income reduction, the government should consider
Eye on day, according to projections by a tax tax is always welcomed but, he pointed out, steps to raise the income of
Tokyo page consultant. dipping into savings for one’s golden years workers,” he added.
Olympics should be avoided unless absolutely He is also against the idea Turn to
18 Malaysian Association of Tax necessary. of reducing EPF contributions
Accountants council member Dr Mohd —
Fairus Razak told theSun that a person He said the EPF, particularly Account 1,
should be earning RM5,833 and below to is designed for long-term investing but given that the money is vital page 3
quality for the 1% reduction in income tax. many people, if given the option, would tap for a person’s future.
into it to pay off debts, cover medical bills
and other financial emergencies.

2 theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

RAJVINDER SINGH ATTHE DEWAN RAKYAT 44,000 who
lost jobs due to
Move to limit number of MPs Covid rehired
triggers heated exchange
MORE than 44,000 people have been
rehired under several initiatives
taken by the government to find
jobs for those who had been
o Decision denies Speaker Datuk Azhar Azizan Harun, Nonetheless, Hassan retorted that the quorum after 2.30pm.” retrenched.
right to fair debate, who pointed out that the move was to the decision should not supersede He pointed out that time had been Deputy Human Resources
says opposition rep prevent the spread of Covid-19 any provision in the Constitution. Minister Awang Hashim said they
among those in Parliament. wasted and MPs should resume the had found new jobs through the
KUALA LUMPUR: A heated Azhar said it was not stated budget debate. Re-employment Placement
exchange ensued yesterday when an Hassan said the decision deprived anywhere in Articles 96 and 97 of the Programme and the MYFutureJobs
opposition representative argued MPs of their right to fair debate in the Constitution that a speaker has to “Let’s repay the sacrifices made by portal.
against the decision to set a limit of House and was against Articles 96 hear all MPs. frontliners and the Health Ministry They were among 95,000 people,
80 MPs for each sitting. and 97 of the Federal Constitution. director-general. Many have worked aged 20 to 29, including graduates
“The quorum is 26, and the party non-stop for the last seven months, and school leavers, who had
Hassan Abdul Karim (PH-Pasir Azhar then pointed out that the whips can decide who attends and even during holidays.” submitted job applications.
Gudang) ended up being ticked off by decision to limit the number of MPs participates in the debates,” he said, Awang said more than 4,000
was made through consensus among adding that while there are 100 to 120 The decision to have only 80 MPs graduates had also found jobs at the
the Speaker, the National Security MPs present at any time, not all of in each session was among several one-day Socso Karnival Penjana on
Council, Health Ministry, Parliament them remain in the House from 10am initiatives announced by Azhar last Oct 30 where 541 employers
Administration as well as party chief to 5.30pm. week. Others include cutting short participated.
whips. question time and debates as well as
“Sometimes, it’s difficult to meet ending the sitting at 2pm.

Other government-managed
initiatives include a structured
internship programme, Scholarship
Talent Attraction and Retention
programme, MyApprentice hiring
incentive programme as well as
upskilling and reskilling training
schemes.
“We also help jobseekers find
employment in government agencies
by liaising with the Public Service
Commission and the Public Service
Department.
“There are some 500,000 job
opportunities available for those
affected by the pandemic,” he told
Datuk Seri Dr Wan Azizah Wan Ismail
(PH-Pandan).
Awang said the government
continues to engage with the private
sector to address the unemployment
issue. He said it is also taking steps to
create new jobs in the information
technology sector in line with an
expected decline in demand in 10
other sectors.
In a recent report, the World
Economic Forum outlined 10 sectors
that will not need as many workers as
before such as data entry, accounting,
book-keeping, payroll management,
administration, business services and
auditing.
“We are looking at creating new
jobs instead, such as digital
transformation specialists and
information technology services.”

17 new padi
seed varieties
KEEPING TABS ... Deputy secretary-general of the Domestic Trade and Consumer Affairs Ministry Dr Alauddin Sidal (wearing cap) checking prices of goods at NSK produced
supermarket in Jalan Kuchai Lama in Kuala Lumpur yesterday under the Festive Season Maximum Price Control Scheme for Deepavali.
THE government has laid claim to 17
Anwar: Difficult to pass budget in its current form varieties of padi seeds since
2008, with 15 varieties produced by
OPPOSITION Leader Datuk Seri between 8.6% and 9.6% in 2021. “The Finance Ministry should “The Opposition wants to see the the Malaysian Agricultural Research
Anwar Ibrahim warned that the Pointing out that international review the allocation for frontliners in budget passed as it is critical for the and Development Institute
government may face an uphill task the Covid-19 war as well as measures Covid-19 war but in its current form, (Mardi), while two varieties were
getting the nod for Budget 2021 in the institutions and even Bank Negara to stimulate the economy,” he said it will be tough to do so,” he said, produced by Universiti Kebangsaan
Dewan Rakyat. Malaysia had projected a growth of during the budget debate yesterday. adding that the government would Malaysia.
only 4.4% to 8%, Anwar said the have to incorporate the views of the
He described the budget as minister should explain how he had Anwar also raised questions about Opposition. Agriculture and Food Industries
misleading, with nothing arrived at his figures. the RM85 million allocation for the Minister Datuk Seri Dr Ronald
extraordinary, and failed to touch on Special Affairs Department. “The Anwar said he also could not find Kiandee said they include padi
issues concerning the people. He said the government should be money should have gone to the details of the RM3 billion allocation varieties such as normal or inbred,
transparent and avoid any Covid-19 fund.” for Covid-19 vaccines. “I could only fragrant, colour, herbicide-resistant
“The government also has manipulation of the budget figures. see allocations for other items.” and aerobic padi.
unrealistic growth projections for the He also noted there had been no
gross domestic product.” Anwar alleged that the views on details about the one-off RM8.6 Zafrul had said the government “Currently, the most popular padi
the moratorium on loan repayment, million grant to Penggerak Komuniti was committed to acquiring vaccines seed variety among farmers is the
When tabling the budget for EPF contributions and allocations to Negara, a non-governmental through its participation in Covid-19 Mardi Siraj 297, unveiled in 2016,
debate on Friday, Finance Minister fight Covid-19 given by opposition organisation under the Local Vaccine Global Access, at an used by 43.2% of padi farmers in
Tengku Zafrul Abdul Aziz projected MPs during pre-budget discussions Government and Housing Ministry. estimated cost of RM3 billion. Peninsular Malaysia.
that the economy would expand had been ignored.
“Other padi seed varieties which
Allocations assured for Tamil schools, says Saravanan are in demand by padi growers is the
MR220 CL-2 (2010), MR 269 (2012) as
ALLOCATIONS have been made for schools under the ministry’s RM50 unhappy with the allocation for Tamil for Tamil schools, which had not well as MR 303 and MR307 (both
all schools, including vernacular billion budget. schools because usually, we get been announced. from 2018).”
schools, under Budget 2021, said about RM100 million from the
Human Resources Minister Datuk “I have discussed this issue with budget,” he said at a media He said he had not asked for a He said this when replying to a
M. Saravanan. Finance Minister Datuk Seri Tengku conference in Parliament. specific amount for Tamil schools, question by Datuk Johari Abdul (PH-
Zafrul Aziz and the Education and will leave the decision to the Sungai Petani).
He said Senior Minister minister and they both said the Saravanan was responding to minister, adding that the Indian
(Education) Dr Radzi Jidin will soon allocation is there. growing discontent among the community should not worry as Johari wanted to know how many
announce the amount for vernacular Indian community over allocations sufficient funds would be provided. new varieties of padi had been
“The Indian community is produced by research centres since
2008. – Bernama

3theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

Work-from-home balance needed

oStaff and employers should Malaysian Trades Union Congress “Covid-19 is something new that productivity),” he added.
compromise on expenses, equipment to deputy president Mohd Effendy we have to face. Working from home Apart from equipment and
make it successful: Experts Abdul Ghani said if a company has could very well be the new norm (for
the financial capability, it should the long term),” he added. facilities, there are other
provide items such as laptops to requirements that no employer
employees, as is already the case if Shamsuddin said it was best to would agree to offer.
the employee works in the office. leave it to the government to come up
However, he agreed that both with new policies on the issue. Generally, a home is not designed
█ BY HAKEM HASSAN employees to function adequately parties should come to a to double up as an office, and to make
[email protected] from home. compromise that would see the The work-from-home concept is it more conducive for work, the
PETALING JAYA: The work-from- employee use his own laptop or also not for everyone, especially employee may have to dig into his
home culture had been slow to catch On the other hand, employers desktop and the company pays part employers. As Shamsuddin pointed own pocket to set up a proper
on in Malaysia but everything may be reluctant to invest in such of his electricity and internet bills. out, the lack of supervision could workstation.
changed with the Covid-19 assets without a clear indication of Malaysian Employers Federation prove to be a problem.
pandemic. how long the situation will last. executive director Datuk All there is now for employees is
Shamsuddin Bardin believes it “For instance, one can easily get the tax exemption of up to RM5,000
It has now become the norm and As general manager of corporate should be discretionary, based on distracted by family members at for the purchase of ICT equipment if
companies and employees are being affairs at the National Tech prevailing challenges. home.” they require such devices to work
forced to review their priorities to Association of Malaysia Nor Azlina “We must understand that a from home.
ensure that it works. Ishak pointed out, it depends on the majority of businesses now have a He urged the government to
employee’s job specifications. cash flow problem.” introduce an awareness programme Ironically, the incentive has not
Most would agree that businesses Many of these companies, to help people understand and benefited the tech sector. In fact,
should supply the necessary tools “Many companies now provide especially the smaller ones, cannot accept working from home as the according to a report by global
and facilities, such as laptops and tech equipment to enable their afford that extra expenditure, he said. norm and make provisions for its research and advisory firm Gartner,
internet access, to enable their employees to work remotely but requirements. the overall sale of tech devices such
there are some that require staff to as personal computers, laptops,
bring their own devices,” she said. “It can also be stressful for the tablets and smartphones, will decline
employee and this can affect their by 13.6% in 2020.
mental health (thereby affecting their

Pay cut to help
poor proposed

KUALA LUMPUR: Former prime
minister Tun Dr Mahathir Mohamad
has proposed that people earning high
salaries in the government or private
sector should forgo 10% of their salary to
help the poor during the current
Covid-19 pandemic
He said the money could be used to
provide food to the unemployed and
those without income.
“It is a sacrifice but I don’t think it
would hurt them if there is a reasonable
cutoff point, say RM20,000 per month,”
he said in his blog Chedet yesterday.
“This pandemic is affecting the poor
the most. Those who have lost their jobs FESTIVE SHOPPING ...
and the small traders have no income at A garments store in
all. They earn today for today. If they Brickfields, Kuala
don’t, then they will have no money to Lumpur doing brisk
buy food even. They will starve. business as Hindus
prepare to celebrate
“On the other hand, those who are Deepavali on Friday.
paid high salaries continue to earn more – ADIB RAWI
than their daily needs. Of course, those YAHYA/THESUN
who are paid high salaries, such as
airline staff and business executives
may also lose their jobs,” he added.
Mahathir also expressed hope that
Budget 2021 would be modified in order Enough necessities for CMCO and Deepavali
to become more realistic and people,
including politicians, can support it.
“While the economic situation GEORGE TOWN: There is sufficient supply of Domestic Trade and Consumer Affairs supply of goods at the manufacturer and
requires more money to be spent by the basic necessities for the people in Penang Ministry Penang branch director Mohd Ridzuan wholesaler level is sufficient, stable and able to
government, the pandemic also affects throughout the conditional movement control Ab Ghapar said a check conducted on Nov 7 meet current demand,” he said in a statement
the revenue for the government. order (CMCO) period and for preparations in showed that there was no increase in the prices of yesterday.
“The budget is for the Year 2021. The conjunction with Deepavali. goods at selected supermarkets and grocery Mohd Ridzuan advised consumers not to
expectation of economic recovery is too stores. make unusual purchases as the supply of daily
optimistic,” he said. – Bernama He said among the basic necessities essentials is sufficient.
monitored were sugar, cooking oil, flour, rice, He told traders to ensure that the goods sold
To have or not to white bread, milk powder, chicken, vegetables, are clearly marked with price tags to make it
eggs, onions, face masks and sanitisers. easier for consumers to obtain price information
“Overall, there is no panic buying. However, before making a purchase.
have children there is an increase in purchases possibly due to He warned traders not to raise prices and said
preparations by the Indian community who will action can be taken under the Price Control and
oHow Covid-19 has affected couple’s celebrate Deepavali on Saturday. Anti-Profiteering Act 2011 and the Control of
“In general, the trend is normal while the Supplies Act 1961. – Bernama
decision to have or not have
% children.
What are the ‘EPF move should be optional’
60

50 58% reasons you will Supramani said Account 1 should always “But to those who are not so badly affected,
delay having remain the “last resort”, especially for the working my advice would be to opt out. Many people have
children? class. less than RM50,000 in their EPF savings when

40 “You must be fully aware of what you are they reach the age of 54. This is not enough for
giving up when you make the choice to reduce retirement,” he added.
your savings,” he added. Consumers Association of Penang president
30 34% 32% 31% Licensed financial planner Marshall From Mohideen Abdul Kadir said the tax
deduction is a welcomed move.
Wong pointed out that the reduction in
20 income tax would benefit only those with front Nonetheless, he said the government

20% Source: chargeable income above RM50,000. page should review its policy and introduce
National
10 YES Population Wong, who goes by the social media better and more progressive taxation that
and Family moniker PlanNERD, said employees should will see high income earners pay higher taxes
63%37%0 Developme
[3D pie chart]Has Covid-19 made you delay having children? Has Covid-19 NO nt Board & also be allowed to opt out of the 2% reduction in to raise funds to help those in the M40 and B40
Yes: 37%No: 64% made you
delay having vase.ai
children? Sample EPF contribution. groups.
size: 1,175 “This move, like the initiative to allow a He agreed that the reduction in EPF
Not enough savings Worry about access to pre-natal care RM500 per month withdrawal from Account 1, is contributions should remain optional as that is a
Worry about Covid-19

Financial reasons caused by Covid-19 to help those hit hardest by the Covid-19 form of savings that will help the people in
pandemic meet daily living expenses,” he said. retirement.
Childcare issues theSunGraphics©
- Magenan

4 theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

Cops to look out ‘Provisions alone to fight
for SOP flouters Covid-19 not sufficient’
on Deepavali
o Budget 2021 allocation will boost efforts but public must over the 4.3% increase in the allocation for
KUALA LUMPUR: Police will be on the also play role and follow guidelines: Health deputy DG the ministry next year compared with Budget
look out for anyone who violates 2020, apart from the additional allocations in
standard operating procedures (SOP) on the Covid-19 Fund.
Deepavali this weekend. “This increase is insufficient during a
KUALA LUMPUR: The allocation for the “I believe if we all work together and play great pandemic,” MHC said.
Senior Minister (Defence) Datuk Seri Health Ministry in Budget 2021 will boost our role, obey the standard operating It urged the government to break
Ismail Sabri Yaakob said the compliance efforts to combat Covid-19, but everyone’s procedures and adhere to guidelines, we can down the allocation by category for
task force led by police will monitor the cooperation is required to defeat the pandemic, and will defeat this pandemic. At the same medical supplies and consumables
situation to ensure those celebrating said deputy director-general of health Datuk Dr time, the government needs to act fast to amounting to RM4.29 billion which had
comply with the SOP. Rohaizat Yon. flatten the curve,” he said during the been allocated.
Mid-Day Update programme on Bernama “The government must provide a clear
“For instance, they should not have He noted that from the overall budget of TV yesterday. breakdown by category as transparency will
more than 20 guests at their homes at RM31.94 billion for the ministry, RM475 ensure no inefficiencies, leakages or
any one time. Otherwise, action will be million was for the supply of reagents and Describing the budget as rakyat-centred, wastage,” it said in a statement.
taken against them,” he told a press consumables, while RM318 million was for he said the total allocation received by the Reiterating its call to raise the health
conference yesterday. the provision of personal protective ministry would be distributed to the existing allocation to about 4% of the national gross
equipment and hand sanitisers for frontline seven programmes. domestic product, it also urged the
“Just like what we did during the Hari staff, Bernama reported. government to adopt long-term, durable
Raya celebration, we will be patrolling They are management, medical, public policies towards sustainable healthcare
villages and residential areas,” he added. However, Rohaizat said cooperative effort health, oral health, pharmaceutical, financing, establishing oversight
was necessary to defeat the pandemic, research and technical support as well as mechanisms and public-private
On another matter, Ismail Sabri said which has sparked an unprecedented health food safety and quality programmes. partnerships.
five more localities, two in Sabah and one crisis and caused major economic damage
each in Selangor, Negri Sembilan and in many countries. Meanwhile, the Malaysian Health
Sarawak, have come under an enhanced Coalition (MHC) expressed disappointment
movement control order to curb the
spread of Covid-19 within the community.

He said in Sabah, the areas affected
are the Mutiara Kasih Flats and Taman
Khazanah Indah locality as well as
Kampung Sabah Baru, both of which are
in Lahad Datu. – Bernama

Compliance essential

PETALING JAYA: Employees who are given
work-from-home (WFH) orders by their bosses
can be recalled to report for work at the office as
long as it complies with conditional movement
control order (CMCO) standard operating
procedures (SOP).

Malaysian Employers Federation (MEF)
executive director Datuk Shamsuddin Bardan
said yesterday the government’s SOP on WFH
are only for staff in managerial and supervisory
positions, and no more than 10% of such staff
are allowed to report for duty at a company
during the CMCO, and work hours are limited
from 10am to 2pm.

He said as such, the company management
might decide to rotate its staff in such positions
and recall them to work.

“As long as the management complies with
the 10% maximum workforce for these positions
and the limited working hours, it will not be
breaching the CMCO rules,” he told theSun.

Shamsuddin said as for staff in other positions,
there are no restrictions under the CMCO and they
can report for work as directed by their employers.

There have been complaints from
employees who claimed their employers have
compelled them to report for work despite the
CMCO. – by Charles Ramendran

No entry to Kelantan
without approval

Sanitation and disinfection work being carried out at an eatery in Klang yesterday. – ASYRAF RASID/THESUN KOTA BARU: Those who fail to produce letters
of approval from the police, or do not have valid
972 new cases, eight fatalities reported reasons to enter Kelantan, will be ordered to
turn back.
KUALA LUMPUR: The number of new The federal territory of Labuan had 63 cumulative number of recoveries to 29,579.
Covid-19 cases rose again yesterday, but cases, followed by Perak with 51, Penang However, the additional 972 infections The same rule applies also to travellers who
stayed below the 1,000 mark. with 34 and Kuala Lumpur with 20. arrive at the Sultan Ismail Petra Airport.
brought the number of active cases to
In the 24 hours leading up to noon Kedah and Johor had eight new cases 11,308. Kelantan police chief DCP Shafien Mamat
yesterday, there were 972 new cases, each, Malacca and Putrajaya five each while said this was necessary to prevent the spread of
according to Health Director-General Tan Sarawak recorded four cases and Kelantan, Another eight patients succumbed to the Covid-19 in the state.
Sri Dr Noor Hisham Abdullah. two. infection, bringing the death toll to 294.
“On this matter, do not try to make fake
Of the new cases, only five were Noor Hisham said six new clusters were Six of the eight were Malaysians and two excuses for interstate travel as attempts would
imported. They comprised two Malaysians detected yesterday in Sabah, Selangor, were foreigners. only cause inconvenience to others,” he told
and three foreigners who had arrived from Kuala Lumpur, Malacca, Johor and reporters at the Kelantan Information
the Philippines, Singapore and Nepal. Putrajaya. Most of them had a history of chronic Department Strategic Networking session on
illnesses such as heart disease, stroke, Sunday night.
Sabah continued to account for the bulk For the first time in several days, the hypothyroidism and hypertension.
of new cases, with 370. Negri Sembilan number of recoveries exceeded the number All states in Peninsular Malaysia, except for
recorded 260 new cases, while Selangor of new cases, with 1,325 patients So far, 86 patients are receiving Perlis, Pahang, and Kelantan, have been put
reported 137 cases yesterday. discharged from hospital, bringing the treatment in the intensive care unit, with 31 under the conditional movement control order
requiring ventilators, Noor Hisham added. (CMCO) until Dec 6.
– Bernama
Shafien said roadblocks manned by police
and Health Ministry personnel would be put up
in four areas in the state, namely two in Pasir
Puteh and one each in Jeli and Gua Musang.

He said apart from undergoing swab tests,
those stopped will also be required to produce
their approval letters from a police station for
inspection. – Bernama

5theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

Justify revival of Jasa: Patriot

o Govt urged to of RM85.5 million under Budget information “and retrained to be digital infrastructure throughout the Minister (Datuk Saifuddin Abdullah)
clearly define agency’s 2021. communicators”. country to strategically ensure an stating that the government aims to
objectives and scope effective flow of information and to develop specific activities and hire
The National Patriots Association Patriot president Brig-Gen (Rtd) counter disinformation related to the necessary staff to support the
█ BY ELLY FAZANIZA (Patriot) said Jasa’s objectives need to Datuk Mohamed Arshad Raji had Covid-19 mitigation,” CIJ executive supposed activities does not address
[email protected] be properly defined. earlier said Jasa’s original stated director Wathshlah G. Naidu said. the public’s interest in demanding an
PETALING JAYA: The government intention was to explain the academic and expert rationale.”
has been urged to explain its “They (the ministry) need to know government’s initiatives and “In the interest of accountability
objective of reviving the Special how to disseminate information to programmes but it had deviated into and transparency, we call on the Former Jasa director-general
Affairs Department (Jasa) under the rural areas. Why can’t RTM do it Barisan Nasional’s political ministry to provide a clear and Datuk Puad Zarkashi said there was
Communications and Multimedia instead? Why duplicate that role?” propaganda machinery, aimed credible rational that would identify “no need to revamp (the unit) ... (its)
Ministry with a proposed allocation Patriot public communications against its political rivals. the scope of strategic responses, and approach may be different”.
director Capt (Rtd) Dr Wong Ang justify the need for such an inflated
Peng told theSun yesterday. Meanwhile, the Centre for budget that comes at the expense of The Communications and
Independent Journalism (CIJ) said it the public’s current medical and Multimedia Ministry had said that
“What kind of information is is alarmed over the revival of Jasa. socio-economic needs and priorities. Jasa was needed to ensure
needed (to be shared to the public)? information is disseminated at a
In fact, Jasa should not be revived.” “According to the ministry, the “A mere statement from the critical time as the country aims to
increase in federal funds is aimed at Communications and Multimedia curb the pandemic.
He said those employed should be hiring more staff and developing
shown the proper way to disseminate

Seven witnesses of helicopter crash queried Contractor conned
of RM107,000
█ BY CHARLES RAMENDRAN Mohamed Sabri Baharom, 56, and Mohd On Sunday morning, two two-seater
[email protected] Irfan Mohamed Rawi, 41, and was completed Guimbal Cabri G2 helicopters, belonging to BATU GAJAH: A contractor has been duped of
KUALA LUMPUR: Police have recorded the at 1pm. My Heli Club, left the Sultan Abdul Aziz Shah more than RM107,000 in yet another Macau
statements of seven witnesses of Sunday’s Airport, Subang for Genting Sempah when scam.
helicopter crash that resulted in the death of a He said the remains of the deceased were they grazed against each other in mid-air over
pilot and a trainee pilot in Taman Melawati, then released to their families. Taman Melawati at about 12pm. This time, the syndicate had convinced the
Ampang, near here. victim that he had credit card debts.
Mohamad Farouk said the full post- The helicopter piloted by Mohamed Sabri
Ampang Jaya police chief ACP Mohamad mortem report will be ready after laboratory rapidly descended before crashing next to a Batu Gajah district police chief ACP Ahmad
Farouk Eshak said yesterday that police have tests are completed. jungle, killing him and Mohd Irfan. The other Adnan Basri said the 45-year-old victim received
identified another 20 witnesses and expect to helicopter which was piloted by former a call from a man who introduced himself as “Mr
interview them soon. He urged the public to refrain from sharing Malaysian Airlines chief executive officer Lai” and claimed to be a Bank Negara Malaysia
photos and videos of the crash to avoid Datuk Ahmad Jauhari Yahya, 66, managed to officer.
He said a post-mortem led by pathologist speculation and unwanted comments that land safely at a field of SJKT Taman Melawati.
Prof Dr Faridah Mohd Nor was conducted at might affect investigations. He said “Mr Lai” told the victim that there
Universiti Kebangsaan Malaysia Hospital Ahmad Jauhari and a female passenger was a transaction on an AmBank credit card in
yesterday on the deceased, Commander (R) Mohamad Farouk also urged those with identified as Tan Chai Eian, 51, survived the his name amounting to RM11,188.35 for the
information related to the case to come crash unscathed. purchase of goods from Lazada.
forward to meet investigators or contact the
Ampang Jaya police. Ahmad Adnan said the call was then passed
to a woman named Than Kok Hwa who claimed
to be from the money laundering division of
Bukit Aman.

“The victim was told that his credit card
account had been misused and he was required
to appear in the Kuala Lumpur High Court.

“The victim was then instructed to check his
accounts at the ATM of two banks. It was then
that he discovered that RM107,996.95 had been
deducted from his account,” Ahmad Adnan said.

He said the complainant, realising that he
had been cheated, lodged a report at the Batu
Gajah police station at about 6.15pm on Sunday.
The case is being investigated under Section 420
of the Penal Code for cheating. – Bernama

FOILED ATTEMPT ... Deputy Director-General of Customs (Enforcement/Compliance) Datuk Johari Alifiah at a press conference at the Customs Nationwide blood
Complex in Seberang Perai, Penang yesterday showing drugs wrapped in foil and hidden in electronic-circuit boards that were seized in separate raids. donation drive
– MASRY CHE ANI/THESUN
KUALA LUMPUR: St John Ambulance of
Remand on murder suspect extended Malaysia (SJAM), in collaboration with the
National Blood Centre, is organising a second
MARANG: The remand order on the suspect The suspect, who had attended the same On Nov 1, Siti Nur Surya, 19, who was blood donation drive this year at 15 locations
believed to be involved in the murder of Siti school as the victim until Form Five, is being looking after her mother who was bedridden nationwide, starting on Friday.
Nur Surya Ismail has been extended for investigated under Section 302 of the Penal due to stage three brain cancer, was found
another seven days starting today. Code. dead in the living room of her house in SJAM said in a statement yesterday that the
Kampung Lubuk Batu, Telemong. three-day drive will be held simultaneously in
Magistrate Engku Nurul Ain Engku Muda The suspect was arrested at the Telemong Perlis, Kedah, Penang, Perak, Kuala Lumpur,
allowed the police application to enable police station at 8.15am on Nov 2 when The victim’s body was found by her Selangor and Johor.
further investigations involving the 19-year- she turned up for questioning with her 15-year-old sister who returned from school
old form six student. mother. at about 2.30pm. – Bernama It said the drive is being organised following
an urgent appeal by the National Blood Centre
to replenish its supply, which is running low as
the nation is hit by the third wave of Covid-19.

“States such as Sabah are facing shortages
and the number of donors has decreased
dramatically due to the implementation of the
conditional movement control order
statewide.”

SJAM commander-in-chief Datuk Lai See
Ming was quoted in the statement as saying that
they will continue to organise as many blood
donation programmes as possible to assist the
various blood banks in government hospitals
throughout the country.

He also assured the public that all necessary
measures and standard operating procedures
will be adhered to, to ensure their safety.

The statement also said that donors will be
provided with hand sanitiser and have their
body temperature checked, and that beds and
equipment will be disinfected after every
donor leaves. For more information on the
blood donation schedule and locations, visit
the National Blood Centre social media
platforms and SJAM website at
http://sjam.org.my/blooddonation. – Bernama

6 theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

France struggles Ex-US surgeon-general
as death toll to lead Covid taskforce
passes 40,000
oVivek Murthy worked under Obama- taskforce, according to a CNN “I would tell them to put politics
PARIS: France’s prime minister urged the Biden administration before being report. out of the issues of authorisations
public to respect the lockdown as a record forced to resign byTrump and guidelines. Their
number coronavirus cases were reported in Born to Indian immigrant communication should be crystal
a single day and the death toll passed WASHINGTON: President-elect Joe the 12-member taskforce, Biden’s parents in the UK, Murthy was clear that the people driving the
40,000. Biden has picked the surgeon- deputy campaign manager Kate chosen as the 19th surgeon-general process are scientists from the
general who was fired after Bedingfield told NBC’s “Meet the of the US under the Obama FDA. They should also ensure
Jean Castex said the second wave of President Trump assumed office to Press” on Sunday. administration, and served from transparency in data and details of
Covid-19 had “arrived brutally and be head of his new Covid-19 2014 until President Trump asked the vaccine to ensure the right kind
violently” after meeting staff the CHU taskforce. The pair have both already been him to resign in April 2017 of evaluation.”
Hopital Nord in the city of Saint-Etienne. “advising (Biden) and our campaign
Vivek Murthy has been named as since this virus emerged back in He has been open in his Murthy also spoke out in
“Our caregivers are once again on the co-chair alongside former Food and March,” Bedingfield said. criticism of Trump’s policies since, support of the current head of the
deck as their CHU reaches saturation Drug Administration (FDA) including his handling of the coronavirus task force, Dr Anthony
point,” he tweeted on Saturday. commissioner David Kessler to lead Yale University’s Dr Marcella coronavirus pandemic. Fauci, who has been on target of
Nunez-Smith is also set to join the Trump. During one of his final
“Let’s respect them. Let’s respect When asked what his advice rallies in Florida, Trump hinted at
confinement. Let us limit our contacts as would be to Trump, he said: “I firing Fauci from his post if he won
much as possible.” would tell them to let science guide the election. – The Independent
the way for the authorisation of the
More than 30,000 people are in hospital Covid-19 vaccine.
in France with Covid-19, after nearly 20,000
admissions over the last seven days, India’s Tata launches faster test kit
according to the Health Ministry.
BRIEFS NEW DELHI: India’s Tata Group the healthcare arm of the cars-to- intelligence and automation will be It wants to increase testing to
Just over 4,500 of those patients are in launched a Covid-19 test kit clothes conglomerate, will begin used to test swabs, Krishnamurthy more than 1.5 million a day, though
intensive care. yesterday that it says will process manufacturing one million kits a said. health experts have warned its
results more easily and faster than month at its plant in the southern heavy reliance on the rapid antigen
On Sunday a further 271 deaths were the RT-PCR method considered the city of Chennai and can then scale India’s Covid-19 cases have risen tests that typically detect the virus
confirmed, taking the total in both gold standard for detection, at a up rapidly, CEO Girish by 45,903 to 8.55 million in the past around 80% to 90% of the time
hospitals and other establishments such as time when cases are still rising in Krishnamurthy told Reuters. 24 hours, government data showed, could under-report infections.
care homes to 40,439. the country. with the country’s infections
TataMD CHECK, as the product lagging only behind the United Antigen devices return results in
The death toll had passed 40,000 on The nasal swab test, developed is called, can return results in 90 States.’ Deaths increased by 490 to about 15 minutes compared with
Saturday evening, when 86,852 new cases jointly by Tata and the government, minutes and will be sold through 126,611. several hours for the reverse
were reported, beating the record set the is also more accurate than the rapid hospitals and laboratories from transcription polymerase chain
previous day. Sunday saw a further 40,000 antigen test currently favoured in next month with the initial focus India does more than one reaction (RT-PCR) method.
positive tests reported, taking the total to India, the ministry of science and being on the home market, million Covid-19 tests a day, nearly
1,787,324. technology said. Krishnamurthy said. 60% of them using the rapid antigen “Our aspiration is that this can
method that is faster but less become a new standard in testing,“
In its latest update, the Health Ministry Tata Medical and Diagnostics, A process based on artificial accurate. Krishnamurthy said.
warned that all metropolitan regions in
France were affected by the second wave. STORM AFTERMATH ... Residents in Bambito, Chiriqui Province 450km north of Panama City pick through mud and debris after an overflow of the Bambito
River due to the heavy rains caused by Hurricane Eta damaged the area. – AFPPIX
“The evolution of the hospital situation
for Covid-19 is very worrying and suggests
tensions in all regions in the coming weeks
if the progression of the epidemic
continues,” it added. – The Independent

SYDNEY RESTRICTS NEW
YEAR’S EVE FIREWORKS

SYDNEY: New Year’s Eve fireworks
over Sydney Harbour will go ahead
this year but will be shortened to
just a few minutes and the city
precinct will be restricted to those
with restaurant, cafe and hotel
bookings in order to limit the spread
of Covid-19. Prime harbourside
spots, normally coveted by
thousands of revellers to watch the
traditional 12-minute pyrotechnic
display, will be set aside for health
workers who have been treating
Covid-19 patients and firefighters.
– Reuters

UTAH DECLARES NEW
STATE OF EMERGENCY

UTAH: The governor of the US.state
of Utah, Gary Herbert, declared late
on Sunday a new state of
emergency to address hospital
overcrowding in response to weeks
of stress on its hospital networks
due to a surge of novel coronavirus
cases. “Due to the alarming rate of
Covid infections within our state, I
issued a new state of emergency
with several critical changes to our
response”, Herbert said on Twitter.
“These changes are not shutting
down our economy, but are
absolutely necessary to save lives
and hospital capacity,“ he said.
– Reuters

KEEP KIDS AT HOME,
PARENTS TOLD

BUDAPEST: A Hungarian teachers’
union has asked parents not to send
their children to school and
kindergarten to protect teachers
and parents from the coronavirus
pandemic, clashing with the
government which has vowed to
keep schools open. Prime Minister
Viktor Orban’s nationalist
government, anxious to minimise
further harm to the recession-hit
economy, has refrained from
reimposing a strict nationwide
lockdown. – Reuters

7theSUN ON TUESDAY | NOVEMBER 10, 2020
NEWS WITHOUT BORDERS

Suu Kyi claims victory in election

YANGON: Myanmar’s ruling party o Myanmar ruling party says it has won enough optimism that greeted the NLD’s villages in Myanmar’s Rakhine State,
said yesterday it had won enough seats to form government landslide win in 2015, Myanmar went most without citizenship, were also
seats in parliament to form the next into this election under a cloud of a unable to vote.
government, after reporting a lead hugely popular at home but has seen Union Solidarity and Development surging Covid-19 outbreak,
based on its unofficial count of votes its reputation collapse overseas amid Party (USDP) could not immediately economic hardship and escalating The Democracy and Human
from the country’s second general allegations of genocide against the be reached for comment. ethnic conflicts. Rights Party, a Rohingya party, said in
election since the end of strict Rohingya minority. a statement it was “utterly
military rule. The military, which ruled Although Myanmar is seeing an disappointed” that its people had
Up for grabs in the election are 315 Myanmar for nearly 50 years until it average of 1,100 new coronavirus been disenfranchised.
Party spokesman Myo Nyunt told seats in the 425-member lower house began withdrawing from civilian cases a day, compared with a handful
Reuters that internal reports showed and 161 seats in the 217-seat upper politics in 2011, controls a quarter of in early August, fears of the virus The Election Commission has said
the National League for Democracy house of parliament. seats in both houses of parliament, appeared not to dampen Sunday’s the polls in areas affected by conflict
(NLD), led by Aung San Suu Kyi, had under a constitution it drew up and turnout among the 37 million had to be cancelled for safety reasons
won the 322 seats in parliament The NLD came to power after a which Suu Kyi and her allies want to registered voters. and that only citizens were entitled to
needed, though no official results had 2015 landslide in which it won a total amend. vote. Most Rohingya are not
been announced by the election of 390 seats, a benchmark Myo Nyunt The Election Commission has yet considered Myanmar citizens but
commission. said it expected to exceed, according The NLD had been expected to to release data on turnout but in the migrants from neighbouring
to data compiled from reports by win but with a smaller margin biggest city, Yangon, long lines of Bangladesh even though many can
“We thank the people,” he said. party agents at polling stations across following the emergence of new voters wearing face masks and trace family roots back many
“For the people, for the party, this is the country. parties and ethnic minority parties shields formed from dawn. generations.
such an encouraging election result.” gaining support in some regions.
A spokesman for the second But more than a million people The United Nations has said there
Sunday’s election was seen as a biggest party, the military-backed In contrast to the wave of across the country were unable to was genocidal intent in a 2017 army
referendum on the fledgling vote after polls were cancelled due to crackdown that forced 730,000
democratic government led by Suu insurgencies. Hundreds of thousands Rohingya to flee to Bangladesh.
Kyi and the NLD, which remains of Rohingya, confined to camps and – Reuters

High-speed BRIEFS AUSTRIA NABS 3O
Hyperloop TERROR SUSPECTS
carries
passengers for VIENNA: Austrian police made
first time 30 arrests in more than 60 raids
yesterday as part of an anti-
LOS ANGELES: The Virgin terrorism operation, but there
Hyperloop made its first journey was no link to a deadly attack
carrying passengers on Sunday, in a in Vienna a week ago in which
test the company claimed a suspect killed four people,
represented a major step forward for prosecutors said. Austria has
the “groundbreaking” technology formally remanded in custody
capable of transporting people at 10 suspects in connection with
1,000km an hour. the attack by a 20-year-old
gunman who had previously
The Hyperloop is intended to been convicted of trying to
carry passengers in small pods join Islamic State in Syria. Police
through a vacuum tube, with shot him dead minutes after he
proponents arguing it could opened fire on bars and
revolutionise high-speed travel. bystanders in central Vienna.
Yesterday’s raids were carried
Virgin says the Hyperloop will be out in four of Austria’s nine
able to reach top speeds of 1,080km provinces: Styria, of which Graz
an hour (671mph), projecting a 45- is the capital, Carinthia, Vienna
minute journey from Los Angeles to and Lower Austria. – Reuters
San Francisco and will produce no
carbon emissions. MEDIA ON TRIAL
OVER PELL CASE
But until Sunday the technology, MELBOURNE: Australia’s
first proposed by eccentric US tech biggest news organisations
magnate Elon Musk in 2012, had not and editorial staff members
been tested with people on board. went on trial yesterday on
charges they breached a 2018
Two Virgin employees made the gag order on coverage of
500-metre journey in a two-person Cardinal George Pell’s now-
vehicle in just 15 seconds at a test site quashed sex crimes
in the Nevada desert. convictions. Several of Rupert
A Virgin Hyperloop pod is seen at its DevLoop test site in Las Vegas, Nevada. – REUTERSPIX Murdoch’s News Corp
Passenger Sara Luchian told the mastheads as well as former
BBC she felt the trip was “exhilarating Fairfax group newspapers,
both psychologically and physically”, pods will be able to transport up to 28 Richard Branson and the logistics Hyperloop, concerns have dogged now owned by broadcaster
and reported no discomfort. people at a time, Virgin says, with company DP World, which is owned developers about just how safe the Nine, are among those who
larger models for moving goods also by the Dubai government. Virgin is technology would be. One researcher dispute that they breached the
Once brought into regular use, the in development. one of a number of companies at Sweden’s Royal Institute of court order. The 18 accused
working to develop the technology. Technology, said the high speeds editorial staff members, who
Virgin’s Hyperloop has raised could turn the Hyperloop into a “barf include reporters, editors and
more than US$400 million (RM1.6 But while Branson hailed the ride”. – AFP broadcasters, face potential
trillion), largely from company CEO success of the “groundbreaking”

prison sentences, while the
media companies could be
‘Plantdemic’ hits Manila as demand for greenery grows slapped with fines. All of the
accused deny the charges.
– AFP

MANILA: A gardening craze dubbed tripled after she reopened her doors “Prior to the pandemic we hadn’t financial pressure caused by the OPEN TO FISHING
“plantdemic” has spread across the following months of lockdown. observed many plant poachers,” said pandemic have prompted many COMPROMISE
Philippines after coronavirus Maria Christina Rodriguez, Filipinos to seek solace in their
restrictions fuelled demand for Demand remained robust even as Zamboanga regional director for the gardens, earning themselves the LONDON: Britain said
greenery, sending plant prices prices for the most popular varieties Department of Energy and Natural nicknames “plantitos and plantitas”, yesterday it was open to a
soaring and sparking a rise in of indoor plants, such as alocasias, Resources. or plant uncles and aunties. “sensible” compromise on
poaching from public parks and spider plants and peace lilies, fishing and that there was
protected forests. doubled or even quadrupled. “This only became popular during “The safest way to make yourself goodwill on both sides to
lockdown.” happy is through growing little progress towards a Brexit trade
Photos of delicate flowers and “It’s hard to understand people. things,” said Norma Karasig deal as a new round of talks
broad-leafed foliage cultivated in When plants were cheap, they were Removing threatened species Villanueva, former president of the began in London. “There are
backyards and on balconies have ignored,” said the 40-year-old, who from forests is illegal under Philippine Horticultural Society. still differences, there are still
flooded social media as housebound buys her plants in bulk from growers Philippine law and carries hefty some obstacles to overcome,“
Filipinos turn to nature to relieve in nearby provinces. penalties. Collecting other native Long-time gardener Ivy Bautista, British Environment Secretary
stress and boredom. plants is allowed but only with a 30, said tending her plants helped to George Eustice told Sky. “But I
But as demand has grown, permit. “kill boredom” and earn some money think there is now some
“It’s unbelievable. People are authorities have warned that many by selling cuttings from her extensive goodwill on both sides to
super interested in plants these days,” plants on the market may not have Thieves are targeting plant collection. progress things.” After
said landscape gardener Alvin been legally obtained. varieties popular on social media, congratulating Joe Biden on
Chingcuangco, who has seen prices such as staghorn ferns and pitcher But she opposes the “insane” his US presidential election
for some varieties of monsteras reach Rangers patrolling the forests of plants, Rodriguez said. prices charged by other sellers, win, Prime Minister Boris
55,000 pesos (RM4,686) each, Zamboanga in the country’s south for fearing it could drive plant Johnson said an European
compared with 800 pesos before the illegal loggers and wildlife poachers But catching offenders is difficult, poaching. Union trade deal was “there to
pandemic. were ordered to watch out for plant once the plant has been dug up and be done” and that the broad
thieves, after officials noticed some sold “it is hard for us to prove that it “It’s ridiculous, a plant that I outlines were clear. – Reuters
Manila plant seller Arlene species posted on social media could came from forests or our protected purchased for 400 pesos is now
Gumera-Paz said her daily turnover only be found in the region’s areas”, she added. selling for 5,000 pesos,“ said Bautista.
protected areas. – AFP
The stress of lockdown and

8 theSUN ON TUESDAY | NOVEMBER 10, 2020 Biden begins transition
NEWS WITHOUT BORDERS into White House

China puts o Launches website listing
congratulatory four priorities – Covid-19,
message on hold economic recovery, racial
equity and climate change
BEIJING: China said yesterday it has taken
note of Joe Biden’s declaration of victory in WASHINGTON: US President-elect Joe Biden Biden visits family graves after attending a Sunday morning church service in Wilmington, Delaware.
the US presidential election but is holding took the first steps on Sunday towards moving – REUTERSPIX
off on sending any message of into the White House in 73 days, as Donald
congratulations. Trump again refused to admit defeat and tried Giuliani, who said he had “a lot of evidence” of 46th president of the United States.
to sow doubt about the election results. fraud. Biden, who turns 78 on Nov 20, has
Foreign Ministry spokesman Wang
Wenbin said the result of the election would With congratulations pouring in from world But former president George W. Bush said announced plans to rejoin the Paris climate
be determined under US laws and leaders and supporters nursing hangovers after the “outcome is clear” and added that he had accord and will reportedly issue an executive
procedures and that China would follow a night of celebrations, Biden and Vice- called “President-elect” Biden and Harris to order on his first day in office reversing Trump’s
international practices in extending its President-elect Kamala Harris announced they extend his congratulations. travel ban on mostly Muslim countries.
sentiments. would receive a joint briefing in Wilmington,
Delaware from their transition Covid-19 Biden’s transition website lists four priorities Biden attended church on Sunday morning
China has had a fractious relationship advisory team. – Covid-19, economic recovery, racial equity in his hometown of Wilmington, Delaware. He
with President Donald Trump, and climate change. also visited the graves of his son, Beau Biden,
characterised by growing friction over They also launched a transition website, who died of brain cancer in 2015, and his first
trade, technology and competition for BuildBackBetter.com, and a Twitter feed, “The team being assembled will meet these wife and daughter, who died in a 1972 car
influence in Asia and the world. @Transition46. challenges on Day One,” it said in a reference to accident. – AFP
Jan 20, 2021, when Biden will be sworn in as the
Analysts say Biden will likely return ties Meanwhile, Trump played golf at his course
to a less contentious state, although Beijing near Washington, the same place where he was
has stuck throughout the election to a on Saturday when news broke that Biden had
position of not commenting directly on secured enough Electoral College votes for
what it says is an internal American political victory.
issue.
“Since when does the Lamestream Media
“I noticed that Biden has declared call who our next president will be?” Trump
victory of the election,” Wang told reporters complained in a tweet on Sunday.
at a daily briefing.
Trump plans to file a string of lawsuits in the
“We understand that the presidential coming week, according to his lawyer Rudy
election result will be determined following
US laws and procedures.”

China will “follow the international
practices” regarding a statement on the
result, Wang said.

China is one of only a small number of
major nations that have yet to issue
statements on the election, in which
Democrat Biden emerged the winner over
Republican incumbent Trump after days of
ballot counting. – The Independent

15theSUN ON MONDAY | APRIL 27, 2020
ENTERTAINMENT

Stars who don't CELEB SPEAK tbawewhtefethhflroiioaeerrncvtotlewieIwvssaetnsahllkyIaynwstwsastbedyat’eu.goraenrwSuanoanmtliymlnbmgetihse,tioaemrbdueueetssislettfs,urrevlbaweeinenetddlioetlfteouvohnoerredkotgimwhntiorengel
settle for less saewtbnheso“aeoeSutnnrta“egbbecwDdvhegotelai,aaeeynmunyoutls,“btln.irpuBosotoveaetyecirureuuefatenmeoblrrewsrtseluxoeeom,eokbfcctibxitucatashatineoitttpnrwe“ctrufpmhaeanameuEoieoetetvunrecinesinltvfesemofmitedrceuatti,Iuntsifttasecnnrlioheuhyhureno,oneegnnelipbwotmd?esndnogojt.ueuancsaaouYoiiaumSnynsllsoitoturncedasoniotgfustuvegtoanodotnhsginhirbtaurdbtrldhatahmmtm.ybeeroeesrrgteaiaonpoettanaetssgolwdhoIdIaktnotaiegeisuypwelaeyoneguowoleygitoaoynotilumnoil.hbgowinsulmIsgnt.,leouyawhgigIsmatmoaIdnhtahtetlt’ny’rimiyhiod.tsteifslotsele?
All about
girl power thDae“nfLinjiuvitsinetlghyanavoibnt.egaaubtiefualutliiffeulmapaptteearsramncoer.”e
orbeydBeuemcaepupotyrweqejuurdieniegcnewJaeognmasienCnshteboenaguhtyoppeagsetoants Wp“embBmaedhagetopakteaseiotuautnrthw,npthgiyeaptespanriosthtnehdartydhtmepicasesemoieaw“gmcesamBgisaaoo;screpareeblblcmchmisaeboaloteiovyneloewuobmhoumeettntmotetnieysvhts“aynoiiafAnr?wabesygtsduibfmethgnlrnsetiahart,teaipneoeeeehgcyagrlltiooacawoatglournaemrorf’huopchosgegtmreaugihtttaeaakeeoanaybyhhoigog,vaetmrsrntn.gaeehfhoheelemdnrcsdrdreeptasembtaeekhaooirswnoreralasv.etsoiutegatw.lcoheWihtrblasitsos,tlhIhnymneeatyhilesfeoloatrwanokyseaeamnovnnwsiirrauanbnpeteeedhfsfethoneotovdoihttatnynuaedhuioerorfwevnatcrtolgtne,oedh,er

Celeb Speak J THIISNOBKIINWETEARTNVHUUEWETLRYIIARFYYUO. LNEwtbpsatfrcedatpubWoq“rhbahheloarneoioI█nrmutaesaeaegnbahhdmmssTdddprote,umeBitahoessBeymepvseinhuelerrtaiteietpdpaeapseretYhpieansyreehnasdgeAnseebtecauenrprigj.earmatshsrHeni?pktreyeaeJEsuruarwoetC’feedecsessbSeAetctwssaytdlacttNosr,tvaarufsleshhotaueeieltrycgtSoyevtueineanyhwrporsSrtnopsinocthnnerioanOrptnlnsoemygteaeatlttienaeopoa,Cgnupa-rintpaieNgwwfmv,nnottiesebooaborcrHtscyoeoebcekbstritonagjgesrtLeeparr,aoeunsiahtroeEyeesmoietsInswa,,atnhCtnIntwsMhnao,hkOaahwnilstgtpttlehgvtorhwe’eousanhooestetthetiNcebraneyteelehdensosfmethwtabhaeeobattserpeGtarssrohebrfphtflnaieatnunaeetiiddiatljoegnttheeeinyetaauavtitouftlgahhahlshnhnteiaimaesaogleertnmvbdhretttrneaavtctgacuiyaospmedrbgehpoMsptvahtftra,octmfrleeoetcnieeyneoagsbooohsvvsiaosiwr.aealwctsdmuafsohaiehlumhlnlnseiidthsetrtroeanmetw2meeegktiaienyavreneddo0rdc,wilmnoeoelt,dunAqge1.flspaidljfmattooinc9oaguesIeooysbgeisbuhbt.lniimerh,awuohcenrjtehloeeotynwoaecratdabi.iaans,e?indn–iurnhuaueepn,dgeJgtsentyttesytsysyodntscabsqhseonoeueCewmWdt“thpikmthtpjtw“hhteTienhafuhthntrpeTmsIehtmaortonoaooilooinieodaoeolmmkohnngltfarwotercwoet“rgeugwiegebtufecntekItpaneBeabrreaIreegaeofregmlienuusrgtcadnaeeintelhnmmIknahesayse,ktrlt’rdti’sgeunt,myiasvtnonokd.xsbbeIngom,Itijlseomropudgnouhy’lcrotemleevryawaheaaeywotassa.asanbIdoeobntaatwcttseerabtubtnTdhweinnesfueerhiiattnmtttlbelnoetyhehdanmoiheoenldplhtittiolfwrnwgdrseie,hnjieIioaiitassplktuneagni’olthc,madroajoehltgmciueerepojnamsvewroubjsoiy.gtapeunooyigetoefxkneugcetrdltdg;bpseeugsrtuoidcwonapaooeoureshqgtrIthialoaeriourhnrnawitopvhrteeairtownuInimintenchrerhnmtsetcant’drnsr?eelaoi,mtp,gIaeeer.itiereatrii.,tagsaI”nfse.phgtensrymryoistwynekknaenetdIdtnekoo.iefeo?e,oe’edemsimtshtonnvgi’tixeeIh.dtweitg”fnelbesrcatoosevlfiapitredhgfeeutiotesteuowtayetthosTon,r.oyronetrtr-te,oIeenekIohnjwldadybotoniItfsoutibefoahtueyntsettIiwyeou,eltdg other’s“Tbhacroksu.ghout
WpoashtplboenregdmuonvtiileMay 2021Oofrrc2tieennohR8lserar,IpAWoiaGlllonuslyeI2eenagNr0vsowdA72iefrei,1sLuIlctlnPLsaifahYdripfrnroaetaasiovidrnmncteehgdobtetteoouhydmtneunhwpitliceeonaP.diseittcmptutouoonornlntnaeieglusthonMhtsichnaiahnesgy aadcwnlootshphdmrotheaeethtehnacgeahemvieiclanlreoayttcpgownuwtiusohngrt.oawm,seeaImycetenashhrriebetyotaesoIanaifnrgpltnl,ihiighrttvsscyeheeaeweedearedtdsneossoed,
A weekly column, published every Monday, positivity.”
featuring popular and on-trend local celebrities
talking about their career, personal life, and what WtMP1ttpo“imdtothtwt5aaIuowriasihc.daw’and,amrgsceamphclpaoinrnioetsaetinhOpnpnogusoeishss“ancunatitheaiaimnketa“srwHnzecennetulnCcprghRsrpittoidsh,nftcogenpaesmetoahpoetetnpaahlgwiwsdtgehisstvrgroIiniIs’enaohtntenmoeatahaeiehbebawnitwnseartnrecvHtioaeet,ftrycdttdateschasfthtinfieieuhohhenilomgoseaae?erlnedbientd,eancahmesrnnvnmlIdsseualeeItgesttadkclsIpsterhwoyIy.ecwinnalqhenKocg.dhrraeRtpanutnetatg.noiolhaheaslasfttlcaaasonwsa2onmh’rt,aHpefeensnblopfhtf0oingrtigrnafeltailroflee2otlo’seaagicesssteetoirwepe0oarnhanetistdqd,homnoetdirtftayeanuionhenehdoTnoafIndoohtF.yiitotne’elawtnlnaVtytbtnvtuuyeoalowrerno’ayIlgseyBberusl What do you wish to
drives them, as well as current and future projects. that matters.” see in future
The celebrities featured come from a wide range wilfalliannwgdstotoidnojttfpcfrussihtthoapjutaatenpwothhshaohbau“pdhrhereohsgtetoBgnlerfieeodi“agmueewewcaf“eyoter“tNettweggmlhIhmrrsttcsraTulahsatdeerdeeieooodaohhneycaguhiasc,rsajmcivtlnn.esloauieyn”tebhtleotetmvnmtesemmylamputldgtylehuebtrrvnvhalwpeatapnsgpstosseareeephespgerln?,ayauaetyveneictosaouseaeyprsts,hgygsbernou,ynheugiteefsesermrahtlvtleevtaatpwiuhasbtroaiacadacuerpynateneepaehnanhitluw,nsrfwlodrtswusxisweanaideotuestseo,ypeluaosers.otrocreipbhnfdfflmoslmbepjtgeoomieioljiuahsncmejnsiorbtrtbativeesvhieh..hemcnolosiaeettnetcneeiapaortneeiahonnelitecsdnvbnrunate,gseseedtg,
of disciplines and include actors and directors, Mark ttnbohouetnshiwenetoehpsrerlsoldel’wssosniclhglineoredpemiscnulagomss.tuehHraeoitnloblyfomwmxoi-dooo-sfdJftuicoilesyf
musicians, chefs, models and comedians. Celebrities Wahlberg and 2LaE0der2ieaWc0pH.Mrteiatadntiekcfnrroaocbnmkyz, ,ttIThhaheenef2SeR0ahe0tio9unrrcrneaoarhvnnaeadsltbibJooyenheDinnst.
previously featured include Tiara Jacquelina, Carmen directed by hcPtMasWhheacainegivhaspcryTtehiedhouzhrlruabroasheei.epepreiabesslrshmstgoe.po,r)fefIeasr,onanysnwmratcitrthamleeheeionlvdelraiesCinwenrasoSith.innfobDfloailadsct(iwpcsyFhdunpartfohleerweefrdlacoimtfainltaeoenaCoeyenytanrsemloueftitldmoCindeger.genendaogOwhonE–rooRrtin’ijEifmlBkwniuelerovAtsropfsvhahifaooibFatmioeleoaonhlnsr,yP,rrntfoe,,t-
Soo, Maya Karin, Shalini Balasundram and Haneesya Anto i ne
Hanee.
FuqPuaar.amount
Celebrity Causes Phircteiasocsdtpruootropnenlssaceanhvsahtinoargsuetinhse
crisis, which
This column comes out every Wednesday, has led
and features a local personality
speaking about a social cause, either Relaxnews Wthheenfirysot uththoiungkhtof tbheaat uctyo,mwehsatt’os cr–ECeoCNhfniOnTesoEiUtnaRnRgnTgTtAwEbjIoShNeuYolMireOnwvEeFeNeysRTaotOrhfeCa.gtKrolEifwTeFiniUsgEaLand
as an ambassador for a social/charity Wahlberg. mind?
organisation, or as an activist. The column CELEBRITYCAUSES – AFP “I truly think everyone is beautiful in 15theSUN ON WEDNESDAY | APRIL 15, 2020
serves to create awareness of the cause,
and to inspire readers to make a change undergoing Sintrtueynssiwveasyoing–sapCitOrreaUdiRntTionEgSoYpineORnFisOJhOhikJaOensaShJT,oRInaUdfYtieaSr. LIFESTYLE
themselves. Causes/organisations that have
been highlighted include a school for refugee iTnhneecraplel oafce
children, teaching people how to live a zero- wwhoeeitrlJhlonchaejoelslrSisnktagrnnutodoywshhlefeeeadlplltginpeitgeiwnoapsle
waste lifestyle, and helping underprivileged
students stay in school. S bhCoeodlupyldbimogoaasrgdteey?noiunrgistamsw“optYaadiIdkpeeompmstbslifntu’acnoiashuospoorstCywaoeetcsusatwdDhoeprluaSalhmasowwiat█neaeftern2tnheuTalihcohantonlSlodne4iheelnceilehronroBictdlnnhdsdnaailisen.ttaeahwnlhnYnhyugeuehrhca,sfrsestiaeoeoggoschtItofceiaiwSsosboth’‘tsellsadi,uwtmusHwtrerveelsn’o.s.dfluisneaeeecerrsaesarvocSuIeEotelpasnasrsadNnseamlhptRnpc-ypedlnsybrgsDshnliswereao‘iulteehnteeeaeltoisafoawRheninrkdoley?sHehcdnnnhgseseAsditslpoaobiryfoglsdtosirJeknoniajmulmemoueessaSplodevehrom.iheordndjtieAsousoaaav’pstbmasdthnT’lhlr(mnespiiasaeveattenOec(,HmeosegplenyiaDwreOfen.rwuhIIhdai-wysscAynlhigoebhHrsaeyehJae.feduB.x’aefeanarrdto)eorn(eioSph.aiAn.slyaoaKetwirthlthmwaaJhnarLJ,cinsoyoonoutenaJeAgioiaedljofsnrgnbaeoordnNcoeeopAntkessmceSseSineiduvleiianst.natsytnnneihesioturcacaotienggswuescDmnrrdeidutterioyviai,TgribisintisoenennswdhuoofVeaacypi)icw-snwcstnahr,)ooyre2hoiuicahehdeongvat0pqeiuetsh(narYaiaseegvil1rutrwecwenndn“ne,eoerteaTrnHr7nnhemeIetoyoeysdurhgyd“dAV’HrdiaposaytWmomwrtoaIertgesoAo,soglttochpewoutpuphtcd’ikinvsereo“shuhoirnaseW&waorimt.fyainnmIskmamyh]rle.riepoensstsgtnmniosaedin“ieiohcctdtbhIhexvnprdetsl,nilttgcceteonbdSIdatfrl.uenhutuegwaetreeeoolea’oeoeokidahfunutskoyepduBvttradortlaamiaaburtcswamlih“u’ioyeoandncruedyosacsoncaiutIlnltltlihywIrsiooi.aoieyweelauoaiigotanih,nnlpttnstismoplgsnneiesufnItwogndyhtyrnerlIeunowdgtfeiedptienahtpadoglgtw,yaneryrocsuge’ygbfompgenisearrteehede,hootenpesttmntsgglhohopHlftmadeyeyRtouoRheirhheelotlureemtagbMrhfebeoatdsnodepbrhlorrepasoeeonfaakeaaohtrm’ytlvteateoaggniyiertodwoeieanatheimiulitueslefryhewnnteehkiesnaainebai,kiflieshorlhrnilyvcemboaennvdchennrtIiieoglnieatsilsims,tsnupelfetepsretgyouyeuhsgadyaighewyfrripdnhealekwspretamgsnoloiliwaaneliynteid,octtarwnghnermanalin,nchnpodirdshuirdaeaanitylkornoereacntnmapyamgtesiJitmrSoeotaaaieilnrlennpkrnaaotdsese.ktilenpo.tllbaiadt”tlsaywiybet.nheunndihpoph.leuiiloumn.sriafnetrnnbbcsinitaopnseehhaggslwIa1esienidswetdTatthsoaiegwatdnnuefttoussgl.hhilneao9nesoeteieonawtdeltd,andfegtetwgdosIup,ssottereehmepsueoentultkdtilrhariwtgo.?eablnahhrwisteanynepstoIttfinnricysofeidceesiroeI.pueteniomnhyisesraermioopoeaumt[e,oheoeq’,rspofsltIasp’ntgsrsagteglsusntsltasmtnnnaw.wo.aewuo”miptrleolonirt’yresitstltclngyIssanrngnithdrtaeoshihsoiIhiitho)ooletoilkohntlnhnowheeeebydsaeeu.evvhiarehceausrdemvsisafrtuggsetwroiAboedsnntailaivnttraegcsesacsthhlhawulrtlutaYos.odseddytpoeig?hrynyfd,?dghhhoseoaesognliettucoto.eoeauasorteett,eheeevceawaah.tpiIohuepedrthulnIelliohdlteIatiawfdrklncddoseeeemne’tsno’tp’l.arr”trste,reieaaadofah,hehwgentedtlrsoryrlypipovaieleeigoaibarnsinvltlnevfaIenitenihsercme“gekrhDnlewksuyioladerIrnentyewgseoyaoeptanhuhhcattehbmgyiudlhpeeoormohetyparcrempsrmeareunwev“ucoenhoaxrosfefeyrbbrWxe“eaaoounwlaincgouppee““erleiteoypWnTtielssvtnonouuitlShteTlesnparoavh“uchleepiponddperroctedea.durdsrtomhIyhoeubunniyresbesariecoawWnnfmfnsts.fensriereealontteeocfaulsssfiwfeatattdmogy,ssaimnSnetiarriihuhietetdirlsasnwydlxvstangmeesnontngmtasirlantihitaoslmis.elrvoidlyaslirthsleyoevsnyoedtsltleistRiion.i”bogtoytynortotseeeiwtnfstayrsshlotewvyneehelhwmeeburimshoIrzpsigcienarep.bigpa”stgnveinen“bsdarptnariamAaelhynodfginhadmenooae.rceeWisyeil”tkanrglorgeneeadnaeentongetmnwthoyafnisegletamoieebtliuwnrsarsnwinmxottrohwpahswwhttmasywtxtfianouedr.sa,aptse“rna’.oeertsaehotgdweontotehsetepepipfeimnrBrnntILoaehosenht?hr,ihgsrodvtei.ttaihrnenSnirein.enteqhyceeweaptidntromihfai.honipmainlaeItofnheesdrencsibnclcsuantttrrptweginotgnthmi.ewnayiueWemaohg’oehctetaeeeeinghgnreesgit.aefailhasoeLlrgdartsouobs,sinieelces,vngniepfyItasotheeucnanaiaeltabsegwyeyeahnietucretntwithtwdtlraecsaaseboliindtcthtgosswnseawshhcitai,ntsbeopstoin!ecedtaahlhfnnruohh,ihiuttkwvhhucsitaeotbcgeenaoearrysasnt.eyaiipuciyogoeesvaehrnsosnaoifcyfpotirlsogopratowfomT.utrimtteo,are”,taoaunaesgautonieeeideedhuhfnopeufpoyhqvpnsarihsruoqeebgwountrc.veeiybtoaflogoesryeytyueerutssgxscuheusir’aeostvpj’hioleosreynuuommrepsraebiohhaehreaefnbmcrwrhtsieemanroeyuelvivapurtsasnecmyeesaestohdinlarnnaoupty,uniaaiersntececommIgilnpmwhtaatniaeshavhbboncedwcgbanpraethuhe?ecaudronalnliiliinyoihowuirfitigpecunveloxasreoedvnnnsehnosltnitthiiadouem.h.andelonht”sweotnhitumrowfwgtdeoutyen.drue?nsaotisdaoigirrhonataestefneheioitrlkatailaibrnanolhlyceirlsceygerneoltonsnttoweo,ggeeihoptnhhdghfnhdgluauoeugaefewaeontueleorfrer,bfrhupeosesPepirsbhatnniisbrlpimnnuebtpooelo“phcbiscaragoogPdeetnnswtfreespmehnelf“heaheoapt.sfynlEpeuvnMtairoeoieebfAipseranaseolmicatoecsfgieunladdemnTdsnsurtohiinoystpopleyleiInttvgennmroKntitchhlmNifneoipruToeismedpnrpen,rhnhotsaelv,vatbtppiricen.ieenhhewfwTsEhnfseiyoelorggaogiespesratiiogRLarelSpprfciye-rmahcdegtonWrogsiidwnerifetnouhriegnwoaegfcniaeretrbcuoeastm.oeaertetwvd,bdgoodingfhdidsaprtrnisnaeanssmorsctitaahwvnacidoreuo,iefvnepmohbr,aeohniiloelpsihttepdmeblttaotidaliwfafeeidwmqaile,lgldhtaaonauiineiirnssooyodhutyvoyroetnvycelnmacrytrurneieyiihchtgsaohgingtcey,.ncaetacfnnnotnsnhmniiAhcbhaemiina“ihelnihmcishrehpyhnn,sngctasnocbecdhiilTbreasenionoodosg,nnaetgene,ch,aattciesdhsertotohioashsr.posddgftmbswrtassrhnair,htcssfbbneiiankoighioehlsiesidaffannltpylotneePoestbimfeonaaiesetehhpanuoecnsen.hrraphyagffunrrmaguiprcwanoecdiutosottioieaonwrimetenccoocysnibruhlpRtiiaiatpmsesnbtnhirercmtcfpaahohtahaebrieduaerlaeeluoeoetaofynraevdboldawibisereuthsitdoseebcrrdiisssghsashfptetletustsharnteueeerhb8icsesehcknitwthymghsaaseaealiitnrote.atsghnoomcetscn4eiilrveiieeholnso.esat–niitamnvnnledutlasppagreotdcmhiloorodo.tefagdecnsroeofslttwAftVtahriUfaobolielfaastthdstviaoaiahoeaerintynbcitrmnipibFypsnapyfybuonomeinnvtnrmorhndnervistakyisPeqghtsdhoaeaeirnmtonmdeidttwesbeaeecthtiesvaehnnfeceehulycedanypurddyeittnewosnedeeltnnmveebasnonhielydttersaLhSygshpattnreraii,otnltiiheewegnpeetcasdsocrigwttlhaej,aiergeethnanpo,fletomhchiair“tria-sehuotnitasrtelassfrfanaadsgagnaraaUplhuhderyiimsnscmetratdltihtlcarnsdmdcun.allfadeoselmereoendidil-tya(yrogiaftenrsaeraysidanAisneoinbmrimd,seiildmbrnneeetwnnlnboallw,t’bmReroyesnleibn,lybepegmoegiwearUudoihntaotsarnnoldg1tsetns)hoeddgtdh,itye2tmdreaytyee’aymsrshnl.nd8eaee1jonytal

Contact theSun's Sales & Marketing team to book your advertising space. aofbomoalflenrordaeytahyeom“alEedlnhvencaidaecinlsttialulppithaztroepebtisndlonlelioecgsrartiv,teesntowi.dh”scd–eoauathsstlucAlu.aeolpOFdstpttePnehabpo-neiReeonpsewrleltuoetlhdauarnreixynsocgn,aiotu-tetoctimhgeewcaehsremsmcrsftehosuhficronteeoogrivtpesaeynt,rroavtdbhtvieutuiianssrrdl,ieionaenngnd

03-7784 6688 [email protected] thheeraaSplhinyegatnuedasicnohgtehsyeorpgeeaxo,epsrloceiussenesdl.f

9theSUN ON TUESDAY | NOVEMBER 10, 2020
* SPEAK UP

Anxious week spent in pensive mood
PHEW!!! What a week it has
been!!! The build-up and wait That being history, what is important “Global his favour. I suppose Trump was strictly boosting minimum wages, and
for Budget 2021 announcement is that Joe Biden reached the finishing financial following the creed that if he did not fight providing more federal support for
was filled with anxiety and line and has been declared the 46th markets and for what he wanted, he would not be able housing and education.
anxiousness. It appears the Budget is the president of the United States of economic to cry for what he had lost.
biggest ever presented, incorporating a America. prospects will One common ground Trump and
rescue plan for the rakyat. be affected by Not surprisingly, Americans who are Biden shared was that both were in
What a momentous occasion it was who sits in acquainted with Trump’s tantrums general agreement on the need for more
I made it a point to listen intently, watching the 77-year-old sprinting all White House. decided that there could never be a infrastructure spending, but Biden was
trying to digest every word that came the way to rostrum with zest and zeal for pacifier big enough for the blondie and inclined to tie it directly to a “green”
from the finance minister during the his victory speech. left him to his own means. agenda.
presentation. One thing I have noticed is
that whenever a budget is presented, we He suddenly looked much younger, That the US election is keenly Another obvious and diverse
will have both critics and approvers and with neither exhaustion nor weariness watched by the global population for its supposition is related to healthcare.
that is only to be expected. showing. impact on countries across the globe is
not surprising. Trump and Biden each glorified their
On Saturday, the newspapers and It was a moment of realisation that he respective plan, often comparing them
news portals were overwhelmed with could indeed be the “healer” for the Most national elections are not global to that of Obama’s.
commentaries, feedback and criticisms United States. events but the US presidential election is
and what better way for the rakyat to an exception. People seem to favour Bidencare as
have their say and be counted! In his victory speech on Saturday he pledges to protect and build on
night, Biden called it “a time to heal in Global financial markets and Obamacare by giving Americans more
I have my opinion about Budget 2021 America” and said: “I pledge to be a economic prospects will be affected by choice, reducing healthcare costs, and
but most of them have been covered by president who seeks not to divide but who sits in White House. The outlook for making the system less complex to deal
the armchair warriors. unify, who doesn’t see red states and the world is expected to change with.
blue states, only sees the United States.” drastically, for the better.
Therefore, it would be a waste of Let’s pray for Biden to have the
valuable space here to repeat them. Humility might as well be his middle Biden has quite a diverse vision for strength to fulfil his pledges while
name as he reached out to Trump the United States, compared to what standing firm against the dark forces.
Meanwhile, how can we miss the supporters with empathy, offering Trump had.
hubbub that was happening in the amity. Congratulations to America, now that
world’s second largest democracy. From the pre-election speeches, it the “the four tumultuous years” have
Backtracking a little, it was comical to looks like Biden is more inclined to raise ended.
The battle between the Republicans witness Trump’s ugliest self when he was corporate tax rates, while prioritising
and the Democrats raged for days. preparing himself with lawyers and broad-based spending initiatives around Comments: [email protected]
lawsuits to meet any eventuality not in the expansion of healthcare coverage,

As a black woman, I am torn about Harris LETTERS

█ BY NYLAH BURTON [email protected]
WITH the recent call of Pennsylvania, it’s
become clear that Biden has won. He will Shattering racial and
become the 46th president of the United gender barriers
States.
Harris arrives to deliver remarks hope must sound. KAMALA HARRIS has for black female activists
And that, of course, means that Senator in Wilmington, Delaware, on But then, I will remember my ancestors become the next who have been long time
Kamala Harris will become the next Saturday after being declared vice-president of the United party stalwarts, in a time
vice-president. When she does, she’ll not the winner with Biden of the again. I will remember how they slaved States, shattering racial and where the contributions of
only be the first woman VP, but the first presidential election. – AFPPIX underneath the hot Alabama sun, picking gender barriers in American black women have often
black or Asian person of any gender to be Bahamas. Will Harris fight for climate cotton up until the 1950s, dreaming of a politics, at the end of a been overlooked and taken
second-in-command. action or will she give in to Biden’s plan of better life for themselves. I will remember bruising presidential race for granted.
inaction? how my ancestors had to eke out whatever that further exposed the
This is a momentous victory for And she may be black, but Harris’s standing they could amid the caste system nation’s stark political Harris’s ascension is a
representational politics, and a moment of work as attorney-general undeniably led of the slave and labour colonies of Jamaica divisions. game changer.
pride for many people everywhere – black to the increased incarceration of black and Trinidad. I will remember the family
people, Jamaican people, Indian people, people, contributing to a system that many members I have now, who have been This sends a message Her win is going to
Tamil people, and more. Harris’s identities – including myself – believe is a modern incarcerated on plantations called prisons about what kind of a world change what we think of
embody several diasporas, making her the iteration of the chattel slavery our people in Alabama, forced to work for nothing. I we live in today where leadership.
most diverse vice-president America (and endured in the Americas for centuries. will remember the world we live in now, a interracial democracy
most “Western” countries, for that matter) Harris may show my future daughter world on the brink of disaster because our represents people, men and The younger generation
has ever seen. and other black and brown girls that they government won’t save us from the women, from all over the will know the possibilities
can be anything, but do we want our climate emergency, or racial and globe. that exist for political
As a black woman wholly disillusioned children to sit at the helm of such economic injustice, or provide us with free leadership in future.
with the United States, I struggle to destructive systems? healthcare. I believe this is a good
understand what Harris’s new position That is a question that each person will thing for American Harris will be a
means for me. I grew up in a military have to answer for themselves. Some And then I will remember that no democracy. prominent face for a
family, and in my teenage years, would people’s eyes will fill with tears, feeling as matter how much my first instinct may be generation of children who
have not been able to contain my though her victory is only cause for to celebrate Harris, she is still my enemy. I And for me personally, it are a growing political force
excitement about having someone who celebration. Others may not feel like find that reality deeply saddening. I wish I gives blacks a sense of in their own right.
looked like me, ate like me, loved and there’ll be any tangible change. Still other could love her; I wish I could celebrate national belonging that
laughed with people just like me, in the people may see her occupying this office without reservation. I wish that she was may not have been there R. Murali Rajaratenam
White House. I would have felt like I did as a deeper betrayal, precisely because of someone I could be fully proud of. before. Senior lecturer
when President Barack Obama was those marginalised identities she has.
elected: positive that it was the dawn of a As for me, when I think of Harris as the I may not have pride in Harris, but I do It is a jubilant moment Faculty of University
new era, one where Harris’s marginalised vice-president of the United States, I will have the same hope I carry for all the for many women across the Foundation Studies
identity and political party affiliation allow myself a small moment of politicians that represent us: that maybe country, but most notably HELP Matriculation
meant equality and justice would rule remembrance for my ancestors, many of they will listen to our demands. That
behind those Oval Office doors. whom would stand in awe if they could see maybe, we will one day live in a world Centre
her now. I will feel a small twinge of where they don’t have the power over
But now that I’m older, my ideas and happiness, for them. I will think of the whether we live or die, whether we are free This dream is not fake news
knowledge have shifted greatly. I know fervent prayers for Kamala in her ancestral or in chains. – The Independent
how harmful the Democratic Party can be village of Thulasendrapuram in India, and I WOKE from a long caused concerns and some
to the most marginalised in our society, how beautiful that collective outpouring of nightmare and saw that in delay and it may be time to
even when our officials share our the light of day, democracy consider how to simplify it
identities. Harris may be a woman, but she had conquered disorder and so that it means the people,
has previously refused to allow it was not fake news. Not all of them, can make the
incarcerated trans women access to only is it pleasing to see decision and not a court.
gender-affirming healthcare. President-elect Joe Biden
but also, and uniquely, It is time to look to the
She may be Indian, but we do not yet Vice-President-elect Kamala future and consign the few
know whether a Biden-Harris Harris, a woman of colour. miles built of the “great,
administration will hold Indian Prime The future looks rosy and beautiful wall” to rubble as a
Minister Narendra Modi – a demagogue colourful and it’s about time. symbol of the Trump
leader similar in personality to Trump – presidency. The economy
accountable, or whether their policies will Life is balanced, with the that Covid-19 knocked down
be as milquetoast as their views towards great speech by Biden needs to be built up, the
Israel’s treatment of the Palestinian against the disturbing education system needs to
people. tweets of, soon to be be strong, equitable,
ex-president, Donald Trump. available to all and
Likewise, Harris may be Caribbean, but You cannot buy a victory, preferably truly free. It can
she joins a Biden administration that nor sue yourself into the be done!
refuses to take aggressive climate action – role. You must be given it by
even though Harris co-sponsored the the people, a reality the loser There is now hope and it
Green New Deal – which will threaten Trump must accept before is time for Biden to build a
Caribbean countries with even more he skulks back to his golf better, united America.
environmental disasters, like Hurricane course. Good Luck!
Dorian that destroyed much of the
The complexities of this Dennis Fitzgerald
electoral system have Melbourne

10 theSUN ON TUESDAY | NOVEMBER 10, 2020
SPEAK UP

COMMENT byMazliNoor LETTERS

A comprehensive budget [email protected]
HAVING dissected the 2021
Budget presented by the finance public sector, with a mild contraction of ownership, providing for both a larger Be moderate
minister recently, it is clear that 0.7% in the private sector. Demand in 2021 impact and increased multiplier effect in all aspects
it is an equally comprehensive meanwhile is forecast to grow at 2.0% and on the economy.
and empathetic one, with emphasis placed 7.1% for the public and private sectors, Such measures are anticipated to WE should all practise moderation in these
on both growing the economy as well as respectively. contribute to a construction sector growth trying times. We are faced with an
tackling the ongoing Covid-19 pandemic. 3. Of note is the government’s continued of 13.9% next year, with the manufacturing unprecedented situation with regards to the
The salient aspects that strike us as efforts to attract investments to grow the sector following with a forecast 7.0%, based Covid-19 pandemic.
particularly timely in growing the economy economy, particularly in terms of primarily on developing the export sector,
in the coming year include: incentives designed to mould the in particular strategic industries such as Lives and livelihoods have been lost and
1. A noticeable balance in the country into the region’s main healthcare. the plight of the man on the street is nowhere
economic hub, with the 5. Given the anticipated near solved.
government’s approach between commensurate growth growth in demand and
securing the government’s income in production and supply in the coming year, it I would like to humbly urge everyone to
stream and the need to safeguard the is essential that the local apply moderation in our words and actions.
rakyat’s disposable income – not an “The measures takenemployment. These populace is prepared
easy task at any given time, more so adequately to take up the There is nothing wrong with not pulling
given the ongoing economic malaise include: opportunities that will arise. your punches when you speak, but please be
brought on by the pandemic. The strategic measures mindful to not hurt or belittle someone when
2. The extension of Pakej Prihatin to by the government toa. The relaxing of tax you do so.
ensure continued growth in demand, as incentive
well as tax incentives designed to increase employmentrequirements for Harsh words can be hurtful to some and
enhance the rakyat’s disposable Principal hubs to Dec opportunities are taken by the government in no one deserves to be on the receiving end.
income, hence supporting consumer 31, 2022, this recent budget to Everyone is worthy in their own right and we
demand. very welcome.b. Concessionary tax increase employment are all equals.
The two most notable incentives in this rates of just 10% for opportunities are very
regard are clearly: five years for welcome and serves as the Being moderate in our actions is also a
a. the lowering of the personal income companies that anchor for the country’s reflection of a sense of humility.
establish Global Trading Centres in continued economic growth.
tax rate by a full per cent for those in the country, with a renewable period 6. The specific strategies taken to prepare Please do not go overboard in your
the RM50,001 to RM70,000 income of an additional five years thereafter, the country for the coming 12th conduct and demeanour.
bracket, and and Malaysia Plan are also timely, to ensure
b. those who lost their jobs as a result of c. A preferential tax incentive ranging the effective planning and execution of Treat each other with respect and
the pandemic and received from 0% to 10% for 10 years granted the 12th Malaysia Plan, when the 11th kindness.
compensation will see an increase in to manufacturers that choose to Malaysia Plan comes to an end at the
personal tax exemption from relocate and invest in new facilities in end of this year. Your positive attitude will go a long way to
RM10,000 to RM20,000, for every Malaysia. Based on our analysis and simulations, make someone’s day.
year of service completed. 4. Besides this, the budget clearly also we fully anticipate the country’s GDP to
All considered, the above measures are provides for the continuity of domestic grow within the 7.0% range in the coming I also humbly call on those who are
projected to help support the country’s economic activities, such as year. willing and able to contribute to the plight of
domestic demand sufficiently this year for manufacturing and construction. others in these troubling times to do so from
a relatively modest growth of 1.6% for the Besides the anticipated investments in Mazli Noor is vice-chairman of PAS the kindness and sincerity of your heart.
public infrastructure projects, effort has Central’s economic, real estate and
been made to also increase home entrepreneur development committee We have all been affected in our own ways
with regards to the Covid-10 pandemic.
However, do not give up prematurely.

Please soldier on and know that there is
always hope.

Our unity as one will be our pillar of
strength as we weather this storm together.

Yeap Ming Liong
Subang Jaya

URBAN
Every First Tuesday of the month

theSun’s vibrant URBAN Focus section captures all the
vibes of modern living, from digital technology and home
improvement to recreational, travel, wellness, dining, and
entertainment options. It covers the latest lifestyle and
household trends, products and services while showcasing
interiors and furnishing which give readers a peek into
what they can achieve in their own space.

PUBLICATION DATE 1 DECEMBER, 2020 (Tuesday)

Contact theSun's Sales & Marketing team to book your advertising space. BOOKING & STORY DEADLINE 17 NOVEMBER, 2020 (Tuesday)

03-7784 6688 [email protected] MATERIAL DEADLINE 26 NOVEMBER, 2020 (Thursday)

S E C U R I T I E S S D N. B H D. SunBIZ TUESDAY
NOVEMBER 10, 2020
197201001092 (12738-U)
Editorial: Tel.: 03-7784 6688
A Participating Organisation of Bursa Malaysia Securities Berhad Fax: 03-7785 2624/5

A Trading Participant of Bursa Malaysia Derivatives Berhad Email: [email protected]
Advertising: Tel: 03-7784 8888
Participation Bought Sold Net
% Fax: 03-7784 4424
RM m RM m RM m Email: [email protected]

43.6 Institutions 1997.6 2040.6 -43.0

43.8 Retail 2044.8 2005.3 39.5

12.6 Foreign 581.9 578.4 3.5

100.0 4624.3 4624.3 0.0 4.68 30.68 303.20 61.58 514.61 153.94 30.70 108.62
KLCI STI HANG SENG SCI NIKKEI TSEC KOSPI S&P/ASX200
Preliminary stats (excluding trade amendments). For final data, please refer to www.bursamalaysia.com 1,524.32 3,373.73 24,839.84 13,127.47 2,447.20
Source: Burs Malaysia 2,609.36 26,016.17 6,298.80

KL MARKET SUMMARY Malaysia’s September
November 9, 2020

INDICES 11,040.10 CHANGE +21.22 unemployment rate dips
FBMEMAS
FBMKLCI 1,524.32 +4.68
CONSUMER PRODUCTS 558.55 +2.00
INDUSTRIAL PRODUCTS 151.25 +1.46
CONSTRUCTION 164.68 -0.27
FINANCIAL SERVICES 12,267.20 -27.19
ENERGY 666.90 -1.79 PETALING JAYA: Malaysia’s o Down to 4.6%, number of unemployed 1.4% to 15.1 million persons for
TELECOMMUNICATIONS 577.83 +0.36 unemployment rate for persons drops 0.6% from previous month the quarter, particularly in
HEALTH CARE 4,122.36 -7.97 September 2020 fell slightly to services, manufacturing and
TRANSPORTATION 699.80 +20.06 4.6%, with 737,500 unemployed construction sectors.
PROPERTY 612.31 +2.84 persons registered.
PLANTATION 7,148.73 +25.35 The LFPR improved 0.3% to
FBMSHA 13,332.90 +57.51 Chief Statistician Malaysia employee’s category rose by Alternatively, the Social 68.4%.
FBMACE 11,375.10 +401.27 Datuk Seri Mohd Uzir Mahidin 14,900 persons to record 11.73 Security Organisation’s loss of
TECHNOLOGY 64.89 +0.18 said a continuous recovery has million persons as against the employment statistics reported To provide more insights
TURNOVER been seen in the country’s previous month. a decline of 20.2% to 7,388 into the labour supply situation,
11.707 BIL VALUE labour supply amid the Own-account workers persons in September 2020 the department has introduced
RM4.624 BIL challenges to contain the accounted for 2.43 million compared with 9,261 persons in three new quarterly indicators –
spread of Covid-19 pandemic persons, a 0.7% increase from the previous month. persons who work less than 30
through various phases of the August 2020. hours a week, time-related
5 MOST ACTIVES movement control order. Meanwhile, there were DOSM reported a declining underemployment and skill-
November 9, 2020 100,700 persons who were trend in retrenchment related underemployment – to
On a month-on-month temporarily not working numbers for the period and understand the concern of
STOCK VOL CLSG (sen) +/– (sen) basis, the number of compared with 102,000 persons MYFuture Jobs saw a total of labour underutilisation.
AT 2,664,102,700 21.5 +8.5 unemployed persons fell 0.6% recorded in the previous 58,607 vacancies reported in
AT-WC 647,468,000 20 +8.5 to 737,500 persons from 741,600 month. the Employment Insurance In Q3’20, there were 403,800
LAMBO 341,232,800 4 +1 persons. The department explained System as of September 2020, persons who worked less than
PHB 270,419,600 2.5 +0.5 that the group of persons, who compared to 49,811 job 30 hours a week due to working
FINTEC 266,657,900 12.5 +2.5 “On the contrary, were most likely not able to seekers. conditions or insufficient work,
employment continued to with 300,800 persons
increase, where employed work was not categorised as The chief statistician said the categorised as time-related
persons rose 0.3% (August 2020: unemployed as they had work third quarter of this year saw a underemployment since they
5 TOP GAINERS 0.5%) to 15.19 million persons to return to. decline in the unemployment worked less than 30 hours a
November 9, 2020 mainly in the manufacturing As for the labour force, it rate to 4.7% after recording a week and were able and willing
and services sector,” Uzir said in registered a total of 15.93 high of 5.1% in the second to work extra hours.
STOCK VOL CLSG (RM) RM a statement. million persons in September quarter.
DLADY 20,500 35.70 1.20 this year, a 0.2% growth The department said they
NESTLE 65,400 141.00 0.90 Nevertheless, he pointed out compared with 15.90 million “The lower rate is attributed make up 2% of the overall
PETDAG 181,000 19.00 0.78 that a decline in employment persons reported in the to the resumption of almost all employment in the third
BAT 6,411,500 10.98 0.76 was observed agriculture and previous month. The labour economic sectors including quarter of 2020; more than two
LATITUD 1,046,500 4.10 0.59 construction, which may reflect force participation rate (LFPR) social, educational and thirds of time-related
shortages of labour supply in religious activities. In addition, underemployment was in the
both sectors. remained at 68.4%. domestic tourism activities also services sector, followed by
Outside labour force rose have revived gradually agriculture.
5 TOP LOSERS In September, the ratio of 0.1% to 7.36 million persons following the permissions of
November 9, 2020 employment to population with the largest composition interstate travel during the As of the third quarter, Uzir
remained at 65.2%. was due to housework/family quarter,” Uzir explained. said, Malaysia’s employment
STOCK VOL CLSG (RM) RM responsibilities. rate, unemployment rate and
MPI 381,000 23.26 0.52 Looking at the employed With that, the number of LFPR have improved gradually,
ALLIANZ-PA 2,000 13.44 0.44 person by status of employed persons increased but still have not reached pre-
UMCCA 7,000 4.50 0.26 employment, the labour force Covid-19 levels.
AIRPORT 543,700 4.33 0.19 figures indicated that the
HAPSENG 224,200 7.80 0.15 “Although the Covid-19
A decline in employment was pandemic continued to be a
EXCHANGE RATES NOVEMBER 9, 2020 observed in agriculture and challenge in September 2020,
construction, which may reflect several policies and initiatives
shortages of labour in both implemented by the
sectors. – AFPPIX Government have helped to
stabilise and revive the labour
Foreign currency Bank sell Bank buy Bank buy market in Malaysia.

1 US DOLLAR TT/OD TT OD “Looking at the current
1 AUSTRALIAN DOLLAR 4.1880 4.0570 4.0470 situation with a spike of new
1 BRUNEI DOLLAR 3.0640 2.9390 2.9230 Covid-19 cases especially in
1 CANADIAN DOLLAR 3.1080 3.0140 3.0060 certain parts of the country
1 EURO 3.2110 3.1210 3.1090 since the end of September
1 NEWZEALAND DOLLAR 4.9860 4.8180 4.7980 2020, it is foreseen that the
1 SINGAPORE DOLLAR 2.8570 2.7480 2.7320 labour market will face more
1 STERLING POUND 3.1080 3.0140 3.0060 challenges in the forthcoming
1 SWISS FRANC 5.5120 5.3380 5.3180 months,” he added.
100 UAE DIRHAM 4.6410 4.5250 4.5100
100 BANGLADESHTAKA 115.3400 109.2200 109.0200 Uzir said DOSM has revised
100 CHINESE RENMINBI 5.0210 4.7070 4.5070 the 2020 unemployment rate
100 HONGKONG DOLLAR 63.4000 60.9000 forecast to 4.4%-4.7% as against
100 INDIAN RUPEE 54.5800 51.8000 N/A the earlier 3.5%-5.5%. With this
100 INDONESIAN RUPIAH 5.7500 5.4000 51.6000 revised rate, the forecast
100 JAPANESE YEN 0.0306 0.0277 5.2000 number of unemployed for
100 NEWTAIWAN DOLLAR 4.0450 3.9190 0.0227 2020 will be in the range of
100 PAKISTAN RUPEE 15.7000 3.9090 701,000 to 729,000.
100 PHILIPPINE PESO 2.6800 N/A
100 QATAR RIYAL 8.8200 2.5000 N/A Industrial production edges up, thanks to manufacturing
100 SAUDI RIYAL 116.2200 8.3000 2.3000
100THAI BAHT 112.8200 110.3300 8.1000 PETALING JAYA: Malaysia’s electricity indices, respectively. products (9.8%), food, sector’s output shrank 2.1% year
14.3100 107.1000 110.1300 industrial production index The country’s chief beverages & tobacco (4.9%) and on year.
12.6800 106.9000 (IPI) rose 1% in September petroleum, chemical, rubber &
12.2800 2020 compared with the same statistician, Datuk Seri Mohd plastic products (3.2%). For the third quarter of the
month of the previous year, the Uzir Mahidin, said the year, the IPI grew 0.8%
Statistics Department manufacturing sector’s output The month saw a 9.6% year- compared with the same period
reported, driven by a 4.3% in September grew 4.3% year on on-year decrease in the mining of the previous year, supported
increase in the index for year compared with a 2.2% sector output contributed by a by a 3.1% uptick in the
manufacturing, which was uptick in August 2020. decline in the crude oil & manufacturing index.
offset by 9.6% and 2.1% condensate index of 9.7% and
declines in the mining and In September, the major the natural gas index of 9.5%. However, the mining and
Source: Malayan Banking Berhad/Bernama contributing sub-sectors were electricity indices declined 6.5%
electrical & electronics Meanwhile, the electricity and 2.8%, respectively.

12 theSUN ON TUESDAY | NOVEMBER 10, 2020
SUNBIZ

Huawei Malaysia, Revenue to build e-services hub for SMEs

PETALING JAYA: Huawei ecosystem to develop digital which both parties will jointly develop based ICT solutions for devices that expertise and in-depth knowledge in
Technologies (Malaysia) Sdn Bhd innovations through which both using Huawei’s cloud and artificial can be commercialised. cloud and AI technologies, both
and Revenue Group Bhd are teaming parties can help over 900,000 SMEs in intelligence (AI) technologies. parties will be able to not only develop
up to develop an e-services hub, Malaysia move towards digital Revenue’s managing director and effective innovative solutions, but also
focusing on small and medium transformation and effectively boost In addition, using Huawei’s cloud group CEO Datuk Eddie Ng Chee build a thriving ecosystem to help
enterprises (SMEs), following the their presence in the market. and AI technologies, Revenue, taking Siong said the e-services hub which SMEs grow and transform digitally.
signing of a memorandum of on the role of platform provider in will be jointly built will be most
agreement between Revenue’s The collaboration will provide SMEs this collaboration, will develop helpful for independent software “As a leader in cloud and AI
wholly owned unit Revenue Safe Nets access to over 1,000 software available industry-driven solutions. Both vendors and app developers, as well technologies, Huawei is committed
Sdn Bhd and Huawei Malaysia. on cloud that will help businesses run parties will also will develop go-to- as for the entire ecosystem, to boost towards developing creative
In a joint statement, both parties more efficiently and effectively. market programmes, which will our country’s digital economy. solutions to fulfil technology gaps in
said the main aim of the include consultation services that the country, and to be a catalyst for
collaboration is to build an To achieve these objectives, focus on digital transformation for Huawei Malaysia’s vice president Malaysia’s digital economic growth,”
Revenue and Huawei Malaysia will businesses, as well as develop cloud- of cloud and AI Lim Chee Siong said he added.
leverage digital innovation platforms that by tapping on Huawei’s deep

Cleanroom latex gloves are one SC: Beware of
of the company’s core products. donation scam
– KOSSAN WEBSITE PIX

Kossan‘s Q3 net profit up PETALING JAYA:
sevenfold to RM348.7m The Securities
Commission
o Improvement in all three from a year ago, mainly attributable to the confident of f a further step-up in revenue and Malaysia (SC)
divisions – gloves, technical higher volume sold (+34.9%) and higher profit growth in the fourth quarter and for cautioned the
rubber products and average selling price as compared with Q3’19. FY2020 to be an exceptional growth year for public over a fake
cleanroom the group. donation letter
The technical rubber products (TRP) purportedly from
PETALING JAYA: Kossan Rubber Industries division recorded revenue of RM46.47 million “In the gloves division, demand continues “Badan Kebajikan
Bhd saw a sevenfold jump in net profit to in the current quarter as compared with to far exceed supply. The increase in average Thalassaemia
RM348.74 million, from RM49.18 million in RM46.61 million in Q3’19, while PBT rose selling price has started Malaysia (944520K)” seeking donation and
the previous corresponding quarter, 19.40% to RM9.75 million, mainly attributable falsely naming the SC chairman as its advisor.
attributable to the improvement in all three to the resumption of full operations from the to be reflected in the current quarter, and
divisions – gloves, technical rubber products lockdown imposed under the Movement the group expects further significant upward In a statement, it stated that the fraudster
(TRP) and cleanroom. Control Order (MCO) and the rebound in price adjustments on a quarter-on-quarter had also impersonated a senior management
deliveries in the infrastructure segment. basis in the Q4’20,” it said in a Bursa filing. staff of the regulator when making calls to solicit
Revenue increased by 94.51% to RM1.03 for donation.
billion as compared with RM531.26 million in The cleanroom division grew revenue and In addition, the group said its TRP division
3Q19. PBT by 118.82% and 1131.80% respectively to which had been impacted by the movement Subsequently, the SC has lodged a police
RM40.25 million and RM10.19 million in control order (MCO), has since resumed full report regarding the letter.
The glove division’s revenue increased 3Q20, as compared with RM18.4 million and operations with a substantial improvement in
103.24% to RM946.57 million in Q3’20 from RM0.83 million in Q3’19. The improved its performance in the current quarter. The regulator pointed out that it does not
RM465.75 million in Q3’19, with PBT rising performance was mainly attributable to the solicit donations from members of the public.
670.8% to RM416.65 million in the current increase in the demand for the division’s “With the anticipated gradual uptick in
quarter as compared with RM54.06 million products as a result of the Covid-19 pandemic. economic activity and infrastructure Any person who receives any request for
spending domestically and regionally, the donation purportedly for or on behalf of the SC
For the cumulative period, the group saw a TRP’s division, which comprises the or any of its officials should immediately
net profit of RM544.6 million on a revenue of infrastructure and automotive segment, is contact its consumer and investor office at
RM2.35 billion, from RM163.78 million and well placed to capitalise on the continued [email protected] or call 03 - 6204 8999
RM1.64 billion respectively a year before. recovery in these sectors, and the Group to verify and report the said request.
expects this division to remain profitable,” it
Looking ahead, the group said it is said. United Plantations
9-month earnings
PUC, Sharp in MoU to develop internet-based lifestyle ecosystem increase to RM300m

KUALA LUMPUR: PUC Bhd plans to and Internet of things technologies which will thriving in “stay-at-home economy”, a KUALA LUMPUR: United Plantations Bhd’s
collaborate with Sharp Electronics (Malaysia) benefit both groups in the new economy. paradigm shift in the consumer spending net profit rose to RM300.1 million for the nine
Sdn Bhd (SEM) to develop an Internet-based behaviour towards e-commerce amid the months ended Sept 30, 2020 from RM203.06
integrated lifestyle ecosystem for consumers “It includes, among others, connecting COVID-19 pandemic. million recorded in the same period a year
and businesses. SEM customers with reliable payment ago.
gateway and providing on time service status “It also will cause both parties to
The digital services provider said it signed to SEM product owners, which aim to participate in joint projects on development Revenue was higher at RM947.26 million
a memorandum of understanding (MoU) complement Sharp products,” it said in a filing and application of technologies such as AI, versus RM871.45 million mainly due to the
with the home electrical appliance company with Bursa Malaysia. big data analytics and other emergent increase in revenue for the plantation
today with the aim of negotiating and technologies,” it said. segment by 20.2%, the company said in a filing
finalising the partnership for operating the The MoU will be valid for 12 months or any with Bursa Malaysia.
system. further term to be mutually agreed by both “The MoU is not expected to have any
parties, or until the execution of the definitive immediate material effect on the earnings per For the third quarter, the plantation
“Through the collaboration, PUC and SEM agreement, whichever comes first. share, net assets per share and gearing of PUC company’s net profit stood at RM95.32 million
will develop an Internet-based integrated for the financial year ending Dec 31, 2020,” it from RM60.19 million recorded in the same
lifestyle ecosystem for consumers and The collaboration, PUC said, would give an added. -Bernama period a year ago, while revenue was up to
businesses using artificial intelligence (AI) opportunity for both parties to leverage on RM334.03 million against RM278.66 million.
each other’s strengths for the purpose of
“Whilst United Plantations has so far
managed to avoid a Covid-19 outbreak, the
company has to remain vigilant and will
continue to enforce the various standard
operating procedures introduced by the
government as well as by the group.

“With the escalation of the pandemic
around the world and in Malaysia during
September 2020, it is of utmost importance to
keep our guard up in order to minimise the
risk of Covid-19 (virus) entering UP’s premises
which would result in a temporary shutdown
of its factories or plantation operations,” it
said.

The board views this as being the single
largest risk in the foreseeable future and due
attention is therefore being directed towards
doing everything that is practically possible to
mitigate this risk.

In spite of the above, the board
nevertheless wishes to emphasise that with
UP’s positive liquidity and conservative
capital resources, it believes the company,
based on the present fundamentals, will be
able to perform satisfactorily without the need
for any asset impairments arising from the
current Covid-19 pandemic. – Bernama

13theSUN ON TUESDAY | NOVEMBER 10, 2020
* SUNBIZ

Foreign investors back In terms of retail participation,
as net buyers on Bursa last week saw retailers as net buyers
with RM26.7 million worth of
oMIDF: Inflow of RM115.14m the first close, with net buying gaining equities last week, while local
after seven straight weeks of selling momentum. The outcome of US institutions sold RM141.8 million
and potentially marks shift in sentiment Presidential and Senate election during the same period.
played a role influencing investors’
QES to take over PETALING JAYA: Foreign its fund flow report yesterday. decisions. The largest inflow was on Retailers as net buyers on Bursa
Nikon’s industrial investors were net buyers last week As the market reopened on Friday at RM240.43 million. The continued its streak to the fourth
metrology amounting to RM115.14 million, other net inflow was on Thursday at week since early November albeit
business in M’sia the first net inflow after seven Monday last week, foreign RM140.90 million. moderate tapering as cautionary
weeks of consecutive net selling. investors sold RM104.42 million sentiment clouded the momentum
PETALING JAYA: QES Group Bhd’s net of local equities, with retailers “So far in 2020, foreign investors due to the anticipation on Budget
wholly owned subsidiary QES (Asia- “This potentially marks a shift and local institutions as net buyers net selling has reached RM22.88 2021 announcement last Friday.
Pacific) Sdn Bhd (QAP) has been on sentiment post an at RM1.39 million and RM103.03 billion worth of equities on Bursa.
appointed to take over Nikon Corp’s expansionary budget that strive to million respectively. In comparison to another three “We may expect retailers buying
industrial metrology business in rejuvenate the Malaysian South East Asian markets that we momentum to continue next week
Malaysia effective Jan 1, 2021. economy,“ MIDF Research said in However, this outflow was tracked last week; Indonesia signalling positive affirmation on
reversed as the week draw to a recorded the most foreign net Malaysian fiscal directions for
The appointment was announced inflow while Thailand experienced 2021.”
by Nikon following the decision to the biggest outflow compared to the
cease its Malaysian unit Nikon (M) others,“ said MIDF. Net buying amounted to
Sdn Bhd (Nikon Malaysia) operations RM11.69 billion and came from
by year end. retailers thus far in 2020, while
institutions bought to the tune of
QAP is principally involved in the RM10.82 billion.
distribution of inspection, test and
measurement equipment across Asean In terms of participation, retail
countries. It is currently the authorised investors recorded a weekly
distributor for Nikon Malaysia’s decrease of 1.49% in average daily
industrial metrology business. trade value (ADTV) while foreign
investors experienced decrease of
QES managing director and ADTV of 11.25% and local
president Chew Ne Weng (pix) said institution saw ADTV drop 16.99%.
Nikon Malaysia and QES have been
key partners since 2009. The Three green
appointment will see QES further solutions and
strengthening its sales and after-sales one social
service support. solution under
the Air Selangor
“Nikon’s products have always been Sustainable
one of the top three suppliers’ of QES. Development
We are honoured to be appointed to Sukuk
take over Nikon’s industrial metrology Kelestarian
business in Malaysia,“ he added. Framework have
also been
Petronas to pay assigned EB and
extra RM10b SB ratings. – AIR
dividend to govt SELANGOR
WEBSITE
KUALA LUMPUR: In light of the
unprecedented challenges brought RAM Sustainability assigns EB, SB ratings to Air Selangor’s sukuk
about by Covid-19, Petroliam Nasional
Bhd’s (Petronas) board has approved KUALA LUMPUR: RAM Sustainable Development Sukuk presented by climate change. The ratings agency’s second
an additional RM10 billion dividend Sustainability Sdn Bhd has assigned Kelestarian Framework (the “We believe that Air Selangor’s opinion on the framework concluded
payment to the federal government by Environmental Benefit (EB) and framework) had also been assigned that it provides clarity on important
the end of this month. Social Benefit (SB) ratings to the EB and SB ratings. proposed Sukuk Kelestarian will aspects such as the intended use of
Sukuk Kelestarian Air Selangor create a positive environmental and proceeds, project evaluation and
The company said it had previously (Sukuk Kelestarian) to be issued RAM Sustainability head of social impact by financing projects selection, management of proceeds
committed to maintain the scheduled under Pengurusan Air Selangor Sdn sustainability services Gladys Chua and solutions that are important to and reporting commitments, said
RM24 billion dividend payment to the Bhd’s RM10 billion Sukuk said it was imperative that Air the issuer’s operations, as well as the RAM Sustainability.
government based on its financial year Murabahah programme. Selangor supports the water industry national sustainable development
2019’s performance, and confirmed through efficient and sustainable agenda,” she said yesterday. RAM Sustainability is a provider
that the company has fully paid the The ratings agency said three management systems, especially of sustainability services and
dividend as planned for this year. green solutions and one social given the growing demand for water Chua added that the instrument environmental, social and
solution under the Air Selangor supply along with the challenges also carried credit ratings assigned governance analytics. – Bernama
“In determining whether this by RAM Ratings.
additional dividend is affordable, the
Petronas board first satisfied itself that AME: Second Shengda plant at i-Park@Senai Airport City JHM to move
the company could comfortably to Main Market
continue to fund its operations, service PETALING JAYA: AME Elite international customers, in line upon expected completion of the
its debts and meet its obligations as Consortium Bhd is constructing with the rapid development of the second plant in June 2021. PETALING JAYA: JHM
well as invest in its future growth,” it Shengda New Energy Sdn Bhd’s global solar energy industry,” said Consolidation Bhd will transfer
said in a statement yesterday. second plant in i-Park@Senai AME Elite’s group managing Its products are distributed its listing to the Main Market of
Airport City, boosting its director Kelvin Lee Chai. mainly to the United States, as Bursa Malaysia Securities Bhd
Petronas added that it remained expansion plans. well as Australia and Chile. on Thursday.
resolute in its efforts to preserve cash The plant would also house a
and strengthen its financial resilience The second plant, adjoining power station demonstration AME had previously The company has been listed
during this unprecedented time. the first manufacturing facility, project to enable visual completed Shengda New on the then Malaysian Exchange
would expand Shengda New presentation to customers, as well Energy’s first plant in i- of Securities Dealing and
Previously, Minister in the Prime Energy’s products to include solar as research and development Park@Senai Airport City in Automated Quotation or
Minister’s Department (Economy) tracker slew gear (tracking driver) (R&D) testing lines for solar December 2019 which Mesdaq Market (now known as
Datuk Seri Mustapa Mohamed said and solar cleaning robots. tracker, battery energy storage, manufactures solar tracking the ACE Market) of Bursa
Petronas will pay RM34 billion in and solar cleaning robots. systems, including steel coil Securities, for 14 years, since July
dividend to the federal government “We note that the new plant slitting, precision tubing, 13, 2006.
this year. – Bernama not only increases Shengda New With the second plant, precision stamping, and related
Energy’s total production floor Shengda New Energy has components. The market capitalisation of
space by more than 50% upon invested over RM95 million in JHM is RM981.38 million. About
completion in June 2021, but also land and buildings in Malaysia to AME Elite is an integrated 50.79% of its issued shares were
helps them move up the value date, with total manufacturing industrial property development, held by 5,983 public
chain and develop more built-up area of about 361,100 sq construction, engineering services shareholders holding not less
advanced solutions for their ft in i-Park@Senai Airport City and property management services than 100 shares each.
provider.

14 theSUN ON TUESDAY | NOVEMBER 10, 2020 S E C U R I T I E S S D N. B H D.
SUNBIZ
197201001092 (12738-U)

A Participating Organisation of Bursa Malaysia Securities Berhad

A Trading Participant of Bursa Malaysia Derivatives Berhad

SoftBank: First-half profit surges more than fourfold to ¥1.9 trillion

TOKYO: Japan’s SoftBank Group said topped ¥2 trillion for the period. the firm had displayed “a steady sharing firm WeWork – which some funding rounds, or (which) are
yesterday its first-half net profit However, it said it would not offer performance” in line with robust analysts say are overvalued and lack benefiting from the accelerated
soared 346.7%, sealing a strong gains in the global equities markets. clear profit models. adoption of digital services during
recovery after a massive annual loss, a forecast “as it is difficult to foresee the Covid-19 crisis”.
as tech stocks rally and the firm sheds consolidated results due to Founder Masayoshi Son has Son has insisted that his strategy is
assets to shore up its finances. numerous uncertain factors”. transformed the telecoms company sound, and that SoftBank’s portfolio The results come after SoftBank
into an investment and tech behemoth is broad enough to weather the launched an aggressive plan to sell up
Net profit for the six months to SoftBank reported a nearly US$9 with stakes in some of Silicon Valley’s storm. to US$41 billion in assets to finance a
September came to ¥1.88 trillion billion (RM37 billion) net loss in the hottest start-ups through its US$100 stock buy-back and reduce its debt.
(RM74 billion), up from ¥421.6 billion previous full fiscal year, but quickly billion Vision Fund. The firm said its SoftBank Vision
a year earlier, the conglomerate said. returned to the black in the first Fund saw strong results thanks to It has ended up far surpassing that
quarter. He has battled opposition to his recovering stock markets and goal, raising US$56 billion, and said
The profit surge was mainly driven strategy of pouring money into start- increases in portfolio firms where plans for the additional money made
by gains on its investments, which Masahiko Ishino, an analyst at ups – including troubled office- “exits have been decided or have new have “yet to be determined”. – AFP
Tokai Tokyo Research Institute, said

SIA posts record loss for Q2 Norwegian Air suffers
body blow as govt
o Airline continues to reel rules out more aid
from Covid-19 impact with
S$2.34 billion setback in OSLO: The Norwegian government will not
July-September quarter provide additional financial support for
pandemic-hit Norwegian Air the Industry
SINGAPORE: Singapore Airlines (SIA) on Carrier has concluded talks with Airbus on a revised schedule for the delivery of aircraft orders. - Ministry and the Ministry of Transportation
Friday reported a record net loss for its fiscal REUTERSPIX said yesterday, leaving the cash-strapped
second quarter as the carrier continued to carrier in a precarious situation.
reel from the impact of the coronavirus negotiations with Boeing were at an But it offered passengers the chance to
pandemic on global air travel. “advanced stage”. dine on board two parked A380 superjumbos Norwegian Air, which has been hit hard by
– the world’s biggest passenger jet – and is also the coronavirus crisis and grounded most of its
The airline, which has shed thousands of Last month the firm said it was cutting offering home deliveries of plane meals. fleet, said in August it would run out of cash in
jobs and grounded much of its fleet, said its about 4,300 jobs – around 20% of its the first quarter of 2021 unless it could secure
net loss in July-September totalled S$2.34 workforce. Industry body the International Air fresh funds and has held talks with the
billion (RM7.16 billion), down from a net Transport Association (IATA) estimates that government in the hope of winning support.
profit of S$94.5 million in the same period the With the aviation industry in deep crisis airlines operating in the Asia-Pacific region
year before. due to the pandemic, airlines have turned to stand to lose a combined US$27.8 billion A pioneer in low-fare transatlantic air travel,
alternative ways to raise cash, from offering (RM115 billion) this year. Norwegian Air’s rapid expansion left it with
Revenue for the quarter plunged 81.4% to “flights to nowhere” to tours of aircraft. debt of close to US$8 billion (RM33 billion) by
S$783.8 million, the airline said in a IATA forecast in July that global air traffic is mid-2020, making it vulnerable to the fallout
statement. Singapore’s flag-carrier scrapped earlier unlikely to return to pre-coronavirus levels from the Covid-19 pandemic.
plans for no-destination flights following an until at least 2024 – a year later than previously
First-half net losses amounted to S$3.47 outcry over the potential environmental projected. – AFP The government’s rejection leaves
billion. impact. Norwegian in a “challenging situation”, the
carrier said in a statement.
“The recovery from the Covid-19
pandemic is likely to remain patchy, given “That the government has decided to reject
the new waves of infections around the the request for funds is disappointing and feels
world and concerns about imported cases,“ like a punch in the gut for everyone at
it said. Norwegian,“ CEO Jacob Schram said.

The carrier added that it had concluded The company’s shares have already plunged
talks with Airbus on a revised schedule for 98% this year.
the delivery of aircraft orders and similar
The Industry Ministry and the Ministry of
Reliance’s deal talks with Saudi Aramco gaining momentum Transportation began a news conference on the
airline industry at 0800 GMT.
BENGALURU: Reliance Industries Ltd and billion (RM62 billion) as of August last year, Mukesh Ambani told shareholders in July that
Saudi Aramco are resuming talks over a 20% had stalled over price, Reuters reported the deal had been delayed due to “unforeseen Norwegian Air, which reports third-quarter
stake sale by the Indian conglomerate in its earlier this year. circumstances in the energy market and the results on Tuesday, said it will hold its own news
oil-to-chemical business after a brief pause Covid-19 situation.” conference at 0930 GMT.
due to Covid-19 pandemic, ET Now reported Reliance’s shares have been on a tear in
yesterday, citing sources. 2020, rising more than 35% so far this year, as The oil-to-telecoms company in October Creditors and lessors took control of the
it raised billions of dollars from global reported a 15% drop in September-quarter airline in May with a financial rescue that
Both companies were committed to the deal investors for its digital and retail arms. profit as the coronavirus crisis hammered its allowed it to access state-guaranteed loans of
and Aramco wants to do physical inspection of mainstay energy business, although it reaped three billion Norwegian crowns (RM1.4 trillion)
Reliance’s assets in India, the report said. Reliance and Aramco did not immediately double-digit revenue growth at its Jio telecom as the company sought to operate a slimmed-
respond to Reuters’ request for comments. service. – Reuters down service.
The deal, estimated to be about US$15
Reliance chairman and Asia’s richest man Norwegian last month operated only 21 of its
aircraft, leaving more than 100 grounded,
including its entire fleet of 37 Boeing 787
Dreamliners used for transatlantic journeys.

Scandinavian carrier SAS is a major
competitor in Norway, and Hungary’s Wizz Air
recently launched several services to
Norwegian cities. – Reuters

China Evergrande ends Shenzhen listing plan

HONG KONG: Debt-laden China Evergrande 1.3% gain in the benchmark Hang Seng Index.
Group said it has decided to terminate a Stock of Shenzhen Special Economic Zone
reorganisation plan with Shenzhen Special
Economic Zone Real Estate & Properties Real Estate & Properties Group climbed as
Group Co Ltd, ending a long-awaited much as 6.4% after falling 7.3% in early
backdoor listing plan in Shenzhen. morning trading. The shares had been
suspended since September 2016.
Market concern has mounted in recent
weeks that Evergrande - whose borrowings In September, Reuters reported that
totalled 835.5 billion yuan (RM512 billion) at Evergrande had sent a letter to the Guangdong
end-June – was headed for a cash crunch if it provincial government asking for accelerated
could not get Chinese approval for the listing approval to float subsidiary Hengda Real
plan that has languished for four years. Estate via the reverse merger in Shenzhen.

But some investors in the listing plan have It warned of risk to China’s financial
agreed not to demand repayment, the stability if Evergrande failed to meet a January
company said in a filing to the Hong Kong listing deadline, which would have triggered
bourse on Sunday. some 144 billion yuan in payments to backers.

“The move in our view should have Of the 130 billion yuan of equity interests
minimum impact on its operation as they held by strategic investors, investors holding
have already settled with most strategic 86.3 billion yuan equity interests have agreed
investors to convert their investment into not to require the company to repurchase
equity,“ Raymond Cheng, head of Hong their equity interests and will continue to hold
Kong/China research at CGS-CIMB Securities their interests in Hengda Real Estate.
Ltd, said in a note.
Investors holding 35.7 billion yuan of
The Hong Kong shares of China’s second- equity interests will enter into agreements
largest property developer slid 2.3% in early soon, and Evergrande is still in talks with
trading before rebounding 2.5% to HK$16.90, investors holding five billion yuan, the Hong
their highest since Oct 12. That outpaced a Kong-listed firm said in the stock exchange
filing.

Education FocusONTUESDAYNOONVETMUBEESRDA10Y,N2O02V0EMBER10,2018

 Every second Tuesday of the month Email [email protected] To advertise email [email protected]

R12ESEARCHERS have long nGeroxot mgeinngeErdtahutecioantion As a top university in Malaysia,
known that life expectancy MSU prioritises student development
increases with income. What
surprises them is that the Focusto enhance graduate employability.
fact has never come to a plateau, i.e., With 98.7% of its graduates
there is no income above which a successfully securing employment
higher income does not associate within six months of their graduation,
with longevity, and there is also none leading to MSU’s ranking by the
below which a lower income does not Ministry of Higher Education
associate with survivability. (MOHE) as Malaysia’s #1 for graduate
employability.
Management and Science Blending technical vocational
University (MSU) has teamed up with education and training (TVET) with
Education Focusliteracy and wealth management

knowledge to MSUrians.
UOB Kay Hian Wealth Advisors o Entrepreneurship Week 2020 to bring financial literacy 13traditional academic curricula,
(UOBKHWA) to bring financial and wealth management knowledge to MSUrians
MSU’s mission for excellence in
The new collaboration signed at human capital development is
benchmarked by industry
employability, entrepreneurship, and
the end of September at the MSU community sustainability; supported
Entrepreneurship Week 2020 has by research, lifelong learning, and
among its proposed transactions a flexible education.
public lecture on ageing, a Global MSU houses the Faculty of Health
Money Week in partnership with Strategic and Life Sciences, the Faculty of
OECD and UNSDG, business chat partnership Business Management and
sessions on investment and actuarial Professional Studies, the Faculty of
between MSU
careers, a Malaysia Youth Financial and UOB Kay Hian Information Sciences and
Literacy Survey, and a Wealth Wealth Advisors Engineering, the International
Management Symposium. Medical School, the School of
Describing the university-industry …. (from far left) Pharmacy, the School of Education
MSU VP for and Social Sciences, the School of
collaboration as essential to building Industrial Hospitality and Creative Arts, the
the next generation of talents, Linkages & School of Graduate Studies, the
Professor Tan Sri Dr Mohd Shukri Ab Entrepreneurship Graduate School of Management,
Yajid urged MSUrians to be ahead by Prof Dr Abdul Jalil and the Centre for Fundamental
building their employability as well as Ghazali, MSU Vice Studies.
entrepreneurability. Going beyond is Chancellor Prof In all, as an applied, enterprise,
fundamental to success, he said, and Puan Sri Dr holistic and international university,
creativity as well as innovation will Junainah Abd MSU offers foundation,
turn circumstances and churn Hamid, Mohd undergraduate, postgraduate and
opportunities. It is the insight of Shukri, and
opportunity in every circumstance flexible programmes through an
that makes the entrepreneurial UOBKHWA’s CEO entry system that facilitates
mindset. Tan Chin Cherng. admission of students from all walks
“Entrepreneurship is a pillar of the of life, where it aims to Transform
University; a culture, not an academic Lives and Enrich Futures.
component. Find your purpose in symposiums and forums, MSU e-Business (U-Concourse, U-Plaza, the University’s Leadership and
entrepreneurship, and use Entrepreneurship Week 2020 saw a and digital platform). A virtual Entrepreneurship Advancement and
learnability as a platform for the re- mix of events being held on campus presentation of the Economics and Development (LEAD) Institute, For further information regarding
learning essential to lifelong as well as online; among them the Statistics Symposium was delivered Faculty of Business Management and the courses offered at MSU, contact
learning,” remarked the MSU Young Leaderpreneurs Challenge by MSU’s Industrial Linkages. Professional Studies (FBMP), the Engagement and Enrolment
President. (online), the International Business Represented at the closing Department of Accounting and department at 03 – 5521 6868. For
Filled with self-development as Challenge (Chancellor Hall), and the ceremony of the MSU Finance, and Research Management additional information, visit
well as competitions alongside Entrepreneurship Mega Carnival and Entrepreneurship Week 2020 were Centre (RMC). www.msu.edu.my.

16 theSUN ON TUESDAY | NOVEMBER 10, 2020
ENTERTAINMENT

█ BY BISSME S. All about his mother Scenes
from
TAIPING-BORN filmmaker o Malaysian Jacky Yeap has completed his first feature film Sometime,
Jacky Yeap explores an which is currently showing at international film festivals Sometime.
intense relationship between wanted to work on anything related
a mother and a son with a the movie comes from his Yeap on why I loved watching these Chinese to films. He graduated from
touch of subtlety in his first feature relationship with the award-winning the set dramas.” University Malaysia Sarawak,
film Sometime, Sometime. filmmaker Tan Chui Mui, who is his of his majoring in filmmaking.
boss and his mentor. film. But as he got older, he understood His all-time favourite filmmakers
The 107 minute-long film first and managed to convince Tan, who is that he loved the visuals that was are Iranian directors Mohsen
premiered at the 23rd Shanghai “I have been working for her for also the producer of the film, to play presented in these dramas. Slowly, he Makhmalbaf and Abbas Kiarostami.
International Film Festival in July, the last four years,” he says. the mother. learned that visuals can be powerful “Their stories are sincere and
earning him a nomination in the “I believe this casting will help my and impactful, and that they can be lively,” he says.
Asian New Talent Awards category. “I always thought there is a film to be as close as possible to what used to tell stories. Speaking of his family, Yeap has
hierarchy between a boss and their I have imagined in my mind,” he says. two older brothers, one who is
This month the film, made with staff. This hierarchy between us does His passion for film started way When he was in Form Five, he working in Singapore as a
the budget of RM200,000, will be not exist. Our communication is not back as a child, when he grew up used his handphone to make silly businessman, while the other is a
screened at the 57th Taipei Golden limited to work matters. We talk watching Chinese dramas on short films, and would show them to lecturer. His father sells fish in the wet
Horse Film Festival. television. his friends. market.
about life. Sometimes, we even “At that time, I could not find any He says: “Since I am the youngest
The story centres on the go grocery shopping friends to talk to about the shows I “They admired my work, and I in the family, I do not have many
relationship between Zi Kien and his together.” watched, since most of my friends was glad to hear their compliments.” burdens. I have the freedom to
single mother. One day, he finds out In some ways, he is were watching cartoons,” he says. choose my ambition. My father is
that his mother has a new boyfriend, trying to make sense of “I was too young to understand It was then that he decided that he supportive of whatever I do.”
Mr Lee, and he is worried that he his unique relationship He adds that for his next project,
might lose her to this stranger. This with his boss through he will be wearing the hat of a
creates an emotional rift this film. Interestingly, he producer and searching for funds for
between mother and son. decided to play the two filmmakers, Lim Han Loong and
role of the son, Isyraqi Yahya, who want to direct
The 28-year-old their first feature films.
filmmaker says: “I lost my Lim’s work centres on family
mother to cancer when I was drama dealing with death, while
only five years old. I grew up Isyraqi’s film deals with the idea of
without really experiencing narcissism.
the bond between a mother “I love their stories,” he says. “It is a
and her son. dream for every budding filmmaker
to make their first feature film. I have
“Subconsciously, I fulfilled this dream. Now, it is my time
might be talking to help other filmmakers to make
about my mother their first feature film a reality.”
in the film.” The idea to help other filmmakers
came from watching his mentor Tan
What he is help many young Malaysian
certain is that the filmmakers to grow.
inspiration for “Making films in Malaysia is hard,”
Yeap explores the he says.
relationship “So, we shouldn’t be selfish and
between a mother only think about our dreams. We
and son in his first should help our friends to make their
feature film. own films too.”

Grammys: Is the World Music Demon Slayer rules
category no longer relevant? Japanese box-office

AFTER changing their of different communities. from India, South Africa and WHILE several cities have Anime adaptation Demon Slayer: Mugen Train has shattered
“urban” category to The Grammy Awards Benin, as well as twice to implemented lockdown or all-time box office records for opening numbers in Japan.
“progressive” a few months Malian and French artistes. curfew measures to curb
ago, the Grammy Awards launched the “Best World the Covid-19 pandemic theatres to reopen last May, And now it seems that
organisation has just Music Album” category back The term “World Music” worldwide, Japanese no film released since that Demon Slayer: Mugen Train
announced that it is renaming in 1992, to celebrate has been criticised by cinemas are welcoming time has managed to draw was the film many were
“Best World Music Album” to excellence in music albums members of the music hordes of moviegoers that many viewers to waiting for. This anime,
“Best Global Music Album” to from around the world. This industry for several years. For thanks to Demon Slayer: cinemas. inspired by Gotōge ‘s manga
avoid “connotations of definition comprised very instance, former Talking Mugen Train. The film Kimetsu no Yaiba, tells the
colonialism.” different genres including Heads leader, David Byrne, adaptation of Koyoharu A Gem Standard study, story of a young man who
non-Western classical music wrote an opinion column in Gotōge’s manga broke conducted in Japan in has to sell coal to support
The Recording Academy to world beat, world jazz, The New York Times in 1999 Japanese box-office records August, indicated that close his family. However, he
announced that this decision stating: “I hate World Music.” for its weekend debut. to 60% of respondents becomes a Demon Slayer
was made after long talks with world pop and weren’t comfortable with when his family gets
artistes, linguists and transcultural “It’s a label for anything at Eagerly awaited by fans the idea of going to the slaughtered and when he
ethnomusicologists from music. all that is not sung in English of the Kimetsu no Yaiba cinema despite the safety finds out that his sister has
around the world who had According to or anything that doesn’t fit into manga, this animated measures implemented in been turned into an evil
encouraged the US Billboard, this the Anglo-Western pop feature went far beyond the country. Over a third of creature. Over 100 million
institution to rename the prize has been universe this year ... It’s a none expectations, amassing 4.62 Japanese respondents copies of this manga have
“Best World Music Album” awarded five too subtle way of reasserting billion yen (RM180 million) (38%) said that they were been sold worldwide since
to adopt a “more relevant, times to Brazilian the hegemony of Western pop in revenue during its first waiting for a film that truly the first volume was
modern and inclusive artistes, four culture. It ghettoises most of three days of screening. It interested them before they released in 2016. – AFP-
term.” times to US ones, the world’s music. A bold and even surpassed the first would set foot in a movie Relaxnews
three times to audacious move, White Man!”, three days of Disney’s theatre.
The awards thus want to musicians Byrne wrote at the time. Frozen 2 which had grossed
better represent current RM123.4 million in the
listening trends and the This change for the “Best country.
cultural evolution World Music Album” will
Beninese singer come into effect during the Almost 3.5 million
Angelique Kidjo Japanese moviegoers went
was the last 63rd edition of the Grammy to theatres between Oct 16
artiste to claim Awards, next Jan 31. and 18 to discover Haruo
Best World Music Sotozaki’s movie Demon
Album at the The Recording Academy Slayer: Mugen Train, shown
62th edition of had announced last June in 403 locations. These
the Grammy figures represent 2.7% of
Awards. that the “Best Urban the country’s total
Contemporary Album” population.
would be renamed “Best
Progressive R&B Album” “to While Japanese
appropriately categorise and authorities allowed movie
describe this subgenre.” – AFP-
Relaxnews

17theSUN ON TUESDAY | NOVEMBER 10, 2020
* GOING PLACES

Saving Angkor Wat

o Cambodia’s ninja gardeners tame jungle growth gardeners’ teamwork.
“They are so brave,” tourist Roth
STACKING a ladder against the “When local and international Gardeners preparing to climb up the tower of the Angkor Wat temple to remove
towering spires of Cambodia’s tourists see us climb up the temples, Veasna says, holding his breath while tree saplings growing on it.
archaeological marvel Angkor it seems scary to them and they think watching a worker scale a ladder as
Wat, Chhoeurm Try gingerly there is a lack of technique,” says his colleagues grip it tightly.
scales the temple’s exterior to hack team leader Ngin Thy. Untamed once, manicured now
away foliage before it damages the Leaving the temples unmanicured
ancient facade. But using ropes or climbing gear is could bring back the vision French
out of the question, as it could naturalist and explorer Henri
The 50-year-old is part of a crack damage the fragile stone work, while Mouhot had encountered in the
team of gardeners ensuring the scaffolding would take weeks to build 1860s when he chanced upon the
kingdom’s most valued heritage site and pull down. site.
is not strangled by overgrown tree
saplings sprouting from the “It could cause problems for them It had been abandoned for
sandstone’s cracks. instead,” Ngin Thy tells AFP. “It is centuries, its ancient stonework and
safer for them to just carry a pair of carvings hidden under jungle growth.
For two decades, Chhoeurm Try scissors and go straight for the
has made the treacherous climbs sapling trees.” “It is grander than anything left to
barefoot up to Angkor Wat’s central us by Greece or
tower, which rises 65 metres high There are also tight sections in R o m e ,“
(213 feet) above the archaeological certain temples that require workers Mouhot
complex in the northern city of Siem to crawl through, navigating their way wrote in
Reap. around jutting sculptures as they his travel
attempt not to unnecessarily come journals,
“If we make a mistake, we will not into contact with the friezes. which
survive,” he tells AFP after returning helped
to the ground. “At temples with brick work,
the job is even more difficult,” Angkor Wat is under constant threat by jungle overgrowth.
But he soldiers on, aware that the Chhourm Try says,
fight to hack away tough roots is an recounting a near miss popularise it with the West as an experiment first because we are
ongoing battle against nature. a few years ago when important archaeological site. worried that it could also damage the
a brick fell on his Today the officials of Apsara stones when we pour it onto the
“When the sapling trees grow head and cracked Authority – a government roots,” says deputy director Kim
bigger, their roots go deep and cause his helmet into two. body managing the park – Sothin.
the stones to fall apart,” he says. says they are searching
A handful of for a liquid substance to “If we could use it, it will reduce
Preserving the dozens of temples local tourists their burden.”
at Angkor Archaeological Park is a and Buddhist
delicate year-round job taken on by monks gaze Until then, it is up to the nimble-
the 30-member team. up in awe footed gardeners to maintain the
admiring grandeur of Angkor Wat.
The world heritage site contains the
monuments dating from the 9th to “Other people don’t want to do
15th century, and was Cambodia’s eliminate root this job because it is risky,” says
most popular tourist destination growth, so as to Oeurm Amatak, a 21-year-old who
before the coronavirus pandemic lessen the joined the team a year ago.
seized up global travel. risks to the
gardeners. As an apprentice, he does not yet
“We love and want to preserve the But “we dare to climb all the temples and his
temples,” Chhoeurm Try says. “If we need to skillset is developing under the
don’t preserve them ... the younger mentorship of his more experienced
generation would not get a chance colleagues.
to see them.”
“You really have to love it, it’s not
No safety gear for everyone,” he says. – AFP-
With just blue hard hats as Relaxnews
their only safety precaution,
the gardening team are
used to performing their
duties under the gaze of
visiting tourists.

Danish coast surfs on
virus wave

ON Denmark’s rugged western coast, of waves you’re going to get. It’s Far from paradise islands in the tropics, ‘Cold Hawaii’ has become the place to be for avid surfers stranded by travel
far from paradise islands in the always different. If you go to Bali or restrictions.
tropics, “Cold Hawaii” has become Tahiti, you know exactly how the
the place to be for surfers stranded by wave is going to break. Here, it ago “for the surfing”. His enthusiasm expect surfing to take off in Denmark, promotes a sense of well-being,
travel restrictions during the changes all the time,” says Itchner. hasn’t waned a bit, as interest in the a country already known for its Klitmoller epitomises the art form
coronavirus pandemic. Surf life is ‘hygge’ town continues to soar. kitesurfing. better than any other place.
A new addition to the world’s surfing
As the name suggests, surfers hot spots, it has yet to be invaded by “A couple of years ago I told myself “It’s going to become a famous “The right word is ‘cosy’: go
seeking out the perfect wave near the the masses. this is the peak ... But no, it still surf spot!” boasts Itchner. surfing and then go home and light a
town of Klitmoller are not put off by expands.” fire and drink a hot chocolate.” – AFP-
chilly waters, nor the lack of palm Klitmoller, a town of just 1,000 In the land of ‘hygge’ – the Danish Relaxnews
trees. inhabitants, is an unexpected Itchner and Meluka say they concept of cosiness and comfort that
destination for surfers, due to its
This rugged coastline under grey geographic location.
and skies, has drawn a growing
number of aficionados in recent One of many fishing villages that
years. dot the coast, it has long been
popular with windsurfers. Surfers
Covid-19 has “created a big started coming in the 1990s, with
boom,” says Mor Meluka, a 34-year- locals initially eyeing the newcomers
old Israeli who settled here with his with suspicion.
family 11 years ago.
“It was new for the locals ... The
Surfing enthusiasts from fishermen had to share the ocean,“
Denmark and nearby countries she explains. “But a surfer with a
“used to travel the world”, but now, board doesn’t require so much
“since they can’t go anywhere we are space.”
definitely experiencing more guests
than usual,” he tells AFP. Nowadays surfing is part of the
local culture and is even part of
Together with his wife Vahine children’s schoolday, with surfing
Itchner, Meluka runs the “Cold lessons on their schedule.
Hawaii Surf Camp”, a surf school that
employs 15 instructors in the Sjoerd Kok was one of the early
summer months and continues to pioneers.
give daily lessons even in the off-
season. A 42-year-old Dutch computer
programmer, he moved here 17 years
“You can’t really know what kind

Next Gen 18 theSUN ON TUESDAY | NOVEMBER 10, 2020
YOUTH

The Karate Kid

o Malaysian karateka Prem Kumar Selvam is going all out to qualify
for the upcoming Tokyo Olympics

█ BY S. INDRA SATHIABALAN
ONE of our more
promising future
Olympians is 26-year-
old Prem Kumar Selvam,
who won the gold medal in the
men’s kumite 55kg event at the
2019 SEA Games, and the bronze
medal for the same event at the 2019
Asian Karate Championships held in
Tashkent, Uzbekistan.
The third child in a middle-class
family of six, Prem followed in his older
brother’s footsteps when taking up
karate. Neither of his parents nor his
other siblings have ever taken up martial
arts.
Though he stayed at home with his
family during the early days of the
movement control order (MCO), he
returned to the Bukit Jalil National Sports
Institute in June. He spent a month
under quarantine before joining several
other athletes in training for the Olympic
Qualification Tournament, which is set to Mental preparation is just as important as physical training, says Prem. – COURTESY OF
take place next June in Paris, France. PREM KUMAR SELVAM
He admitted that it was tough initially
to get back into full training, even though categories, but once I was in the senior
he had been working out on his own at category, it took me five years before I
home. \TRIVIA won anything. Sometimes I wanted to
give up but after talking to my coach, the
Prem is How were you introduced to Favourite athlete: National Sports Institute staff and my
concentrating karate? “Cristiano Ronaldo.” friends, they became my backbone,
on earning a “My family used to live in a tough Favourite colour: telling me to stop thinking negatively.
place at the neighbourhood with a high crime rate in “White.”
next Olympics. Segambut. Then my father decided Hobby: “Winning and losing is part of any
– COURTESY OF that we needed to learn self-defence, “I like tinkering with my motorbike sport. The performance is the main
PREM KUMAR and that is when he sent us to learn and car.” thing.”
SELVAM karate. Cheat day meal: How do you control your weight?
“Fried food or mamak food.” “It is easy to gain weight, but muscle is
“I was four years old when I was sent hard to build. So you must control what
to the Hayashi Ha Ipoh Road Karate What else are you doing besides you eat. You must be disciplined.
Centre. preparing for the Olympic qualifiers?
“Right now I am fully concentrating on “We must check our food and make
“My older brothers also took up that only, because going to the Olympics sure we are not dehydrated. The National
karate, but they are no longer competing. has always been my dream. This will also Sports Institute staff helps us.
Karate used to be a hobby, but eventually be the first time that karate will be
it became my full-time pursuit. featured in the Olympics. “Sometimes I have cheat days, but if
my coach finds out I will get punished!”
“I learned a lot throughout my “If I took up something else, like What is the hardest part of training
sporting career. I also have sweet teaching karate, it would be a while following strict SOPs?
memories [of competing], whether I win distraction.” “It is hard. This is a combat sport, so
or lose.” there is a lot of contact and different
How do you cope mentally with sparring partners. But it is more
When did you start entering competitions? important to be safe.”
competitions? “ The staff here help us train mentally. What are your plans after your
“It started with small competitions We must prepare ourselves, too. We put competition days are over?
within the club. I then began competing in a lot of hard work. “I plan to become a businessman, maybe
at a district level, and my first major have my own 99 Speedmart store in the
competition was at the Malaysian “It was easy winning the junior near future.”

Games (Sukma). From then on, I was
competing at both the national and
international level.”

19theSUN ON TUESDAY | NOVEMBER 10, 2020
FEATURE

Championing
American literature

█ BY CHERYL LU-LIEN TAN o A bookworm starts a novel chapter in 2020

FOR four years, Lisa Lucas has How have you made your going to be working with. Lucas will be the publisher at Pantheon in January.
been championing American work-from-home experience a What advice can you give for
literature as executive director success? someone just starting out?
of the National Book I work in different rooms. The You can learn something from
Foundation. morning is for the kitchen, the couch everything you do, so even if you feel
for the afternoon, then maybe I’ll do a like “This isn’t the job I want” or “I’m
Her diverse job experience, little typing in bed – don’t tell. having trouble finding a job,” take that
starting as a salesgirl in her teens, lesson that ordinary life, imperfect
helped the 40-year-old push books I’m used to movement, where you though it may be, gives to you,
into prisons, and deliver more than get up, get dressed, commute to whether it’s resilience or learning
1.4 million volumes to public housing work, go for coffee ... There’s a lot of how to be better at anything.
residents across the country. actual motion we had that happened
during the work day that isn’t there Our job right now is just to hang in
In January, Lucas will start a new any more. So I decided to make use of there no matter what your
chapter at Pantheon and Schocken all the space I have to change things circumstance is. There is a future –
Books as senior vice president and up in order to not feel crazy. we’ve just got to do everything we can
publisher. Taking on a new job in a Who have been your big mentors in do to get ourselves there.
pandemic is a challenge, but her your career? Where will you travel as soon as the
unlikely resume reveals how Two huge ones – David Steinberger, world opens up again?
departing from the typical storyline the board chair of the National Book Paris is the best city. I miss it so much.
can move a career forward. Foundation who opened the whole
world for me, starting with hiring me In this moment, our passports get
“I was a copy editor for an ice but also teaching me how to manage us nowhere and travel is terrifying. I
hockey magazine, I’ve sold and persevere when things are feel so cut off from the rest of the
concessions at a theatre, I’ve been a difficult. world. Also, with my new job, I’m
nanny, ... all the way to becoming thinking a lot about translated
publisher of Pantheon,” said Lucas, And Fiona McCrae, publisher of literature and wandering through a
who served as publisher of Guernica Graywolf Press, who’s been a friend, French language bookstore seems
and director of education at the teacher and cheerleader. I admire the the most appealing inspiration and
Tribeca Film Institute before joining way she has navigated her own experience possible.
the National Book Foundation. career, forged her own path and How have you found doing things
followed her taste, instincts and heart differently in 2020?
Lucas spoke to Reuters about how in the work that she’s done. Nothing is the same. Life is
her experience and philosophy are Do you have any advice for those unrecognisable professionally and
guiding her through the pandemic. seeking a job or starting a job in personally. But I’m learning to sit still.
Below are edited excerpts. these times? I was traveling every week, going to
What was your very first job? Buckle up. Even if you get the job events every night, having meetings
I was a sales shopgirl at Jean Country you’re all excited about it, you’re not and places to run to – that time is
at the Garden State Plaza Mall in going to go into the office, you’re not empty now.
Bergen County, New Jersey. I was going to meet all your colleagues face
probably 15 or 16. to face. You’ll have to find new ways Just learning to be at peace with
to connect to the work and the job less motion is something that I think
Working in retail was difficult – and to bond with the people you’re will always help me. – Reuters
you had a wide variety of people
coming in, some of them were
friendly, some were unfriendly. It was
a lesson in responsibility at a time
when you’re so young that you didn’t
understand what work meant.

Riley says we Life shapes leadership choices
should remain
optimistic in JAMES RILEY, 59, is used to being on How do you maintain a work-life technology like iPhones that can speak
tough times. the go as the Mandarin Oriental Hotel balance? to you, or that you can use to dictate or
Group’s chief executive. I exercise every day one way or another, record means I can do anything.
and I do my exercise – whether it’s Do you have a favourite business
“I would be traveling 60 to 70% of the running, swimming or playing tennis – book?
year,” said the Hong Kong-based CEO. during the mornings so events during I don’t believe in business books. I love
the day can’t interfere with it. reading history. I think I can learn more
Riley joined the parent company, from reading about Napoleon’s retreat
Jardine Matheson Group, in 1993. But I also maintain a series of interests from Moscow or the writings of Cicero
since early March, he has been forced to that don’t relate to work. I’m chairman than I can from reading business books.
navigate a new normal due to the of the Royal Geographic Society in
coronavirus pandemic, which led to the Hong Kong. Reading about great leaders like
closure of three-quarters of his hotels at What’s the best piece of job advice Churchill or Napoleon is incredibly
some point. All but two have since you’ve received? valuable and insightful in terms of
reopened. However happy you are in your job, understanding the present, and also
always make sure that you are aware of reading about great mountaineers and
However he is optimistic, stressing market opportunities and other jobs exploration leaders and how they
the need to stay nimble and relevant you could be doing. achieved their ends.
ahead of an eventual economic What advice do you have for those
rebound. Keep in touch with headhunters. who are trying to navigate this
When you’re conscious of what other changing world today?
For example, Mandarin Oriental opportunities are out there, you’ll have Believe that there is a future. We’re
partnered with The Oberoi Group in a sense of how good your job is. It helps going through a temporary change and
India in September to offer loyalty you maintain a reality check. there will be some consequences. The
programme members benefits across Do you have advice for someone issues we’re facing at the moment may
both companies’ properties. starting out right now? well stretch on but they will pass.
Now is a terribly difficult time to be
Riley spoke to Reuters about the life actually starting work, but we can It’s crucial that people don’t lose their
experiences that shaped his leadership always use this time to improve, to self confidence and business energy
choices in 2020. Edited excerpts from attain greater skills and train further. and passion.
the interview are below. When one can travel freely again,
What did your first job teach you? Think about how you can enhance where do you plan to go first?
I was working at a bank in the center of your competitive advantage and For business, it would be to each and
London as a foreign exchange clearing positioning with skills, so when the every one of the Mandarin Oriental
clerk after I left school. It taught me not market does start to come back, you will hotels, to make sure they’re still in a
only that I was quite good with be in a robust position. great place.
numbers but also how easy it was to Have you acquired any new work
make a serious mistake. habits? Where would I most like to go for
The main one is that I’m losing my leisure? India. I would like to travel
I made a mistake in a transfer into sight. It’s happened over the last 12 to 18 around and enjoy the sights and sounds
someone’s account that resulted in a months. I’m largely blind now and can’t and colours and smells of India. –
loss of US$10,000 (RM41,142). As an 18- read. Being able to use amazing Reuters
year-old in 1980 or 1979 that was an
enormous sum of money. I had debited
it rather than credited it. It was fixed,
but I had a couple of nights when I was
sleepless, wondering what I had done.

20 theSUN ON TUESDAY | NOVEMBER 10, 2020
FEATURE

Begin by tidying up

oAfter following the KonMari Method for five years,
Rebecca Jo-Rushdy became a certified consultant

KonMari is about reevaluating your life R█ BY AZIZUL RAHMAN ISMAIL don’t need or already have,” said Jo- Bathroom sink ... before and after. – COURTESY OF REBECCA JO-RUSHDY
through the lens of your belongings, EBECCA JO-RUSHDY is Rushdy. Workspace ... before and after. – COURTESY OF REBECCA JO-RUSHDY
says Jo-Rushdy. Malaysia’s first KonMari
consultant. The 33-year-old She noted that tidying up is a useful
mother-of-two has lived all tool for those who are working from
over the world and has called Malaysia home as well. For example, in a tidy
home for the past two years, thanks to home, children would know where their
her husband’s current job. things are. Even if they ask a parent, the
parent can know where it is and can ask
She first started practising the the child to get it themselves if it is
KonMari method five years ago after accessible and they are old enough.
reading The Life-Changing Magic of
Tidying Up. In February, She sold off her If you use a space, for example, the
business, started Spark Joy & Flow, and dining table, for work, play for your
became Malaysia’s first KonMari children, and meals, being tidy will
Method-certified consultant. make switching between the different
uses easier and more systematic.
The KonMari Method was developed
by Marie Kondo, a Japanese organising “Everyone’s lifestyle goal is different
consultant whose life-changing and the KonMari method will work on
methods led her to write four books on them differently. For most people the
organising and host a TV series on item categories that I mentioned:
Netflix. clothes, books, papers, miscellaneous
items, and sentimental items works. But
Her methods are so stark to most what if you’re a hobbyist or collector?
people, that they also became the target
of misinformation and misconceptions. “One thing you can do is to beautify
your collection. If your hobby is a part of
So what is the KonMari Method? Jo- the lifestyle that you want, display them
Rushdy explains: “To debunk the myth, prominently. If its plastic models,
KonMari is not about minimalism, miniatures, books, or something else,
getting rid of everything or having a treat these items that spark joy in your
home that looks like a catalogue. life accordingly,” said Jo-Rushdy.

“It’s about reevaluating your life A concept in the KonMari method
through the lens of your belongings to that most people point to is getting rid of
authentically cherish and surround things that do not spark joy. A concept
yourself with belongings that truly bring that sounds alien to those who are not
you joy – as a result, creating a home used to Japanese culture. At its crux, it’s
that is a wonderful sanctuary for you to about being thoughtful.
live your life to the fullest.
“Imagine, for example, you found a
“The basics of the KonMari Method piece of clothing that doesn’t fit your life
begins with tidying things up by anymore. [You can] say ‘thank you for
category: beginning with clothes, then your service’ and give it away, while
books, then papers, miscellaneous thinking to yourself how you’ve
items, and sentimental items. changed [or been affected by it] and
reflect on that,” said Jo-Rushdy.
“The aim is to establish a lifestyle
that you want. That act of tidying up And when something no longer
alone can change your life, and it works sparks joy in your life, donating it or
in many ways.” selling it is an option. This is a common
practice among collectors.
She gives the example of using
tidying up for a few minutes between When an item they collect no longer
hours of work as a way to relax and fits their life or sparks joy, they would
continue to be productive. Once a sell or give it to other collectors who
workspace is organised, you would have would find joy in the item.
a mental invoice of everything you have
and where they are. Jo-Rushdy noted that there are several
groups, for example on Facebook, where
“Knowing what you have and where people can sell, donate, or give away
they are is a powerful thing. It saves you things that no longer have a place in their
time, lessens your stress levels, and journey in life.
saves you money by preventing you
from spending money on stuff you At Spark Joy & Flow, she not only
offers her consulting services to
individuals, but organisations as well.

What are resilient cities?

WHAT do the cities of Barcelona, the 2015 Paris terror attacks, and the CO2 emissions, yet exchanges, the
Durban, Melbourne and Paris have outbreak of the novel coronavirus who sees scenes of implementation of a first-aid
in common? They are all resilient pandemic in late 2019 in China. total devastation training initiative, and turning
cities. And as lockdown measures when the Earth schoolyards into cool zones
return to cities worldwide due to the Faced with all manner of shocks, unleashes its power? with gardens and vegetable
Covid-19 pandemic, the concept – cities the world over are committing plots, for example.
which originated in the early 21st to rethinking their urban Taking action Initiatives are multiplying
century – seems more relevant than environments to better face the Since the early 2000s, all over the world. While an
ever. realities of a changing world. a host of cities have increasing number of
Welcome to resilient cities. been working on municipal authorities are
A variety of dramatic events have establishing strategies looking to appoint Chief
seen populations worldwide follow According to the OECD, resilient of resilience to prevent Resilience Officers, Covid-
similar patterns: healing their cities “have the ability to absorb, and manage such concept that originated in the early 2000s. 19 has prompted the
wounds before getting up and recover and prepare for future shocks risks. In 2013, The In the French
carrying on with life. With 20,000 (economic, environmental, social & Rockefeller Foundation Urban resilience is a establishment of food
buildings flooded and some 150,000 institutional)”, while also promoting programmes, in New Orleans, for
people affected, the 1910 Great Flood sustainable development, wellbeing launched a network of capital, this strategy for resilience has example, where partner restaurants
of Paris was a major natural disaster. and inclusive growth. And the need “100 Resilient Cities” – including given rise to an action plan that aims prepare meals that are distributed
for resilience is pressing, especially Paris, France; Melbourne, Australia; to encourage residents to help make twice a day to those in need. That
In August 2005, Hurricane Katrina considering that some 70% of the Durban, South Africa; and Barcelona, the city more inclusive, while also concerns some 12,000 residents.
was one of the world’s deadliest world’s population will be living in Spain – to better manage the rethinking urban spaces. This And this plan of action seems to
hurricanes, as well as proving the cities by 2050. consequences of major shocks such includes measures such as be here to stay. Across the Atlantic,
costliest natural disaster in history for as natural disasters, pandemics, mass supporting the creation of new, local the city of Edinburgh is focusing on a
the USA. Since then, Typhoon But why do cities, in particular, unemployment, sprawling slums etc. jobs, studying basements and cellars digital strategy to help solve social
Haiyan has wreaked havoc in the have a role to play? The answer is This notably involves financial to reduce the risks of structural and environmental problems. A
Philippines, and Hurricane Sandy, because they are simultaneously the and logistical support to help cities collapse or flooding, developing the three-year plan was unveiled at the
Hurricane Irma and more have victims of environmental, social and recruit a Chief Resilience Officer, like circular economy, promoting local beginning of October to help reduce
caused destruction elsewhere. Then economic shocks, while also being Sébastien Maire in Paris. manufacturing and non-monetary poverty. – AFP-Relaxnews
there’s the 2005 London bombings, guilty of contributing to such events.
Who is responsible for the majority of

HHoommee RReeppaaiirrss BBuussiinneessss Hamilton hails 21theSUN ON TUESDAY | NOVEMBER 10, 2020
MMaaiinnttaaiinnaannccee OOppppoorrttuunniittiieess underrated Bottas * SPORTS

LEWIS HAMILTON believes fellow Face-off in Dubai
111100 226600 Mercedes driver Valterri Bottas “doesn’t get Mighty Mumbai out to shatter Delhi’s maiden IPL dream
the credit he deserves”.
Home Repair ROHIT SHARMA’S defending final, meaning a new name could be added to
Both men race for Mercedes and have champions Mumbai Indians are the trophy if the Ricky Ponting-coached
enjoyed a fine rivalry in recent years. But aiming for a record-extending fifth Capitals beat Mumbai, who lifted it in 2013,
that hasn’t stopped the Brit from hailing title in the Indian Premier League 2015, 2017 and 2019.
his teammate. final today but Delhi Capitals under Shreyas Led by the 25-year-old Iyer and mentored
Expert Plumbing, Iyer are threatening a changing of the guard. by the Australian great Ponting, Delhi have
Tiling, Wiring and Hamilton has won six F1 Drivers The 13th IPL final will be been the surprise package of 2020, though
Championships over the years and is played in an eerily their path to the final was not smooth.
A/Cond closing in on win No. 7 in 2020. empty Dubai stadium They started the season brilliantly,
because of the winning seven of their first nine games and
From RM60 Bottas, meanwhile, is yet to win the c o r o n a v i r u s briefly battling Mumbai for top place in the
prize throughout his career – but pressed pandemic but league, before four straight defeats.
onward Hamilton close since signing for Mercedes back home a TV They lost all three of their matches against
from Williams back in 2017. audience of more Sharma’s Mumbai, including the first playoff
Call : than 200 million are match last Thursday.
332222 NNoottiicceess He’s currently second for the year, expected to watch the The Mumbai-born Iyer said Delhi, with
017-320 8888 behind only Hamilton and ahead of Red showdown. Shikhar Dhawan shining with the bat and the
IINN TTHHEE MMAATTTTEERR OOFF TTHHEE Bull’s Max Verstappen, Renault’s Daniel Delhi outplayed impressive pace bowling Kagiso Rabada, had
332222 NNoottiicceess CCOOMMPPAANNIIEESS AACCTT 22001166 Ricciardo and Ferrari’s Charles Leclerc. S u n r i s e r s now to hold their nerve to counter Mumbai’s
Hyderabad big match experience.
IINN TTHHEE MMAATTTTEERR OOFF AANNDD And Hamilton, speaking to the official yesterday “This has been a rollercoaster. A lot of ups
TTHHEE CCOOMMPPAANNIIEESS AACCTT,,22001166 IINN TTHHEE MMAATTTTEERR OOFF Formula One website, has expressed a to reach and downs. We have stuck together like a
AAVVEERRYY GGLLOOBBAALL SSDDNN BBHHDD belief Bottas is underrated by many within t h e i r family,” Iyer said after his team’s 17-run win
AANNDD 220011330011002266445588 ((11005566228888--TT)) the sport. first over Hyderabad in the final playoff match took
IINN TTHHEE MMAATTTTEERR OOFF ((MMEEMMBBEERRSS’’SS VVOOLLUUNNTTAARRYY them to the final.
KKLL TTAANN SSDDNN BBHHDD “I think Valtteri doesn’t get the credit “A lot of responsibility comes as a captain,
WWIINNDDIINNGG UUPP)) that he’s due because he does an and on top of that you have to maintain
((IInn MMeemmbbeerrss’’ VVoolluunnttaarryy LLiiqquuiiddaattiioonn)) NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN ppuurrssuuaanntt amazing job,” said the 35-year-old. consistency as a batsman.
((CCoommppaannyy NNoo.. 889999662277--KK)) ttoo SSeeccttiioonn 445599 ooff tthhee CCoommppaanniieess “In the next game too, we have to play
((““tthhee CCoommppaannyy””)) AAcctt 22001166,, tthhaatt tthhee FFiinnaall MMeeeettiinngg “He’s an incredibly fast driver, freely and maintain our temperament.”
ooff MMeemmbbeerrss ooff tthhee aabboovveennaammeedd and I think he’s better than a Sharma’s Mumbai remain favourites
NNOOTTIICCEE OOFF FFIINNAALL MMEEEETTIINNGG CCoommppaannyy wwiilll bbee hheelldd aatt 117711,,JJaallaann large portion of the field that against Delhi with a strong batting line-up that
SSrrii PPeellaannggii,, TTaammaann PPeellaannggii,, 8800440000 are here – not only in his includes rising star Ishan Kishan, South
NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN TTHHAATT JJoohhoorr BBaahhrruu oonn 1100tthh DDeecceemmbbeerr driving but also in his African wicketkeeper Quinton de Kock and
tthhee FFiinnaall MMeeeettiinngg ooff tthhee CCoommppaannyy 22002200 aatt 22..0000 pp..mm.. ffoorr tthhee ffoollloowwiinngg mental attitude and Suryakumar Yadav.
ppuurrssuuaanntt ttoo SSeeccttiioonn 445599((22)) ooff tthhee ppuurrppoosseess:: approach, because being The pace duo of Jasprit Bumrah and Trent
CCoommppaanniieess AAcctt,, 22001166,, wwiilll bbee hheelldd ((aa))TToo rreecceeiivvee aann aaccccoouunntt ffrroomm a driver is not just about Rohit Boult, who moved from Delhi Capitals this
aatt 1100..0000 aa..mm.. oonn 1144 DDeecceemmbbeerr driving, it’s not just Sharma year, have shared 49 wickets in their
22002200 aatt BBaakkeerrTTiilllyyTToowweerr,,LLeevveell1100 tthhee LLiiqquuiiddaattoorr sshhoowwiinngg tthhee about practice.
TToowweerr 11,,AAvveennuuee 55,, BBaannggssaarr SSoouutthh mmaannnneerr iinn wwhhiicchh tthhee wwiinnddiinngg
CCiittyy,, 5599220000 KKuuaallaa LLuummppuurr.. uupp hhaass bbeeeenn ccoonndduucctteedd aanndd “It’s about how you
tthhee pprrooppeerrttyy ooff tthhee CCoommppaannyy bring and elevate
AAGGEENNDDAA ddiissppoosseedd ooff aanndd ttoo hheeaarr aannyy people around you,
11.. TToo rreecceeiivvee tthhee LLiiqquuiiddaattoorrss’’ eexxppllaannaattiioonnss tthhaatt mmaayy bbee ggiivveenn and he’s great at that.” –
bbyy tthhee LLiiqquuiiddaattoorr;; Express Newspapers
ssttaatteemmeenntt ooff aaccccoouunnttss sshhoowwiinngg ((bb))TToo rreecceeiivvee tthhee rreessiiggnnaattiioonn ooff tthhee
hhooww tthhee wwiinnddiinngg--uupp hhaass bbeeeenn LLiiqquuiiddaattoorr;; aanndd impressive run to the final.
ccoonndduucctteedd aanndd ttoo hheeaarr aannyy ((cc))TToo ddeetteerrmmiinneedd bbyy RReessoolluuttiioonn “Having such a versatile squad it gives me
eexxppllaannaattiioonnss tthhaatt mmaayy bbee ggiivveenn tthhee mmaannnneerr iinn wwhhiicchh tthhee bbooookkss,, 332222 NNoottiicceess 332222 NNoottiicceess the luxury to change the batting order and
bbyy tthhee LLiiqquuiiddaattoorrss.. aaccccoouunnttss aanndd ddooccuummeennttss ooff tthhee
22.. TToo rreessoollvvee tthhaatt tthhee bbooookkss,, CCoommppaannyy aanndd ooff tthhee LLiiqquuiiddaattoorr DDAALLAAMM MMAAHHKKAAMMAAHH SSEESSYYEENN DDAALLAAMMMMAAHHKKAAMMAAHHMMAAJJIISSTTRREETT rotate the bowlers,” Sharma said after the win
aaccccoouunnttss aanndd ddooccuummeennttss ooff sshhaalll bbee ddiissppoosseedd ooff.. DDII JJOOHHOORR BBAAHHRRUU DDIISSEELLAAYYAANNGG against Delhi in the opening playoff.
tthhee CCoommppaannyy bbee ddeessttrrooyyeedd LLOORR LLII MMEENNGG “When you have bowlers like Bumrah, it
aafftteerr tthhee eexxppiirraattiioonn ooff tthhrreeee ((33)) ((LLiiqquuiiddaattoorr)) DDAALLAAMM NNEEGGEERRII JJOOHHOORR DDAARRUULL DDAALLAAMMNNEEGGEERRIISSEELLAANNGGOORR makes your life easy. And Bumrah and Boult
mmoonntthhss aafftteerr tthhee ddiissssoolluuttiioonn ooff DDaatteedd:: 1100 NNoovveemmbbeerr 22002200 TTAAKKZZIIMM,, MMAALLAAYYSSIIAA DDAARRUULLEEHHSSAANN,,MMAALLAAYYSSIIAA are in top form.” – AFP
tthhee CCoommppaannyy.. NNoottee:: SSAAMMAANN PPEEMMUULLAA
AA mmeemmbbeerr eennttiittlleedd ttoo aatttteenndd aanndd PPEENNGGAANNGGKKAATTAANN ((BBAAHHAAGGIIAANNSSIIVVIILL))
DDaattoo’’ HHeenngg JJii KKeenngg vvoottee aatt tthhee MMeemmbbeerrss MMeeeettiinngg iiss GGUUAAMMAANNNNOO::
AAnnddrreeww HHeenngg eennttiittlleedd ttoo aappppooiinntt aa pprrooxxyy ttoo aatttteenndd NNOO:: JJAA--5588--110077--0099//22002200
LLiiqquuiiddaattoorrss aanndd vvoottee iinn hhiiss sstteeaadd,,aa pprrooxxyy nneeeedd BBDD--AA7722NNCCVVCC--112200--0099//22002200
nnoott bbee aa mmeemmbbeerr ooff tthhee CCoommppaannyy.. DDaallaamm PPeerrkkaarraa mmeennggeennaaii AAkkttaa AANNTTAARRAA Medvedev Masters Zverev
DDaatteedd tthhiiss 1100 NNoovveemmbbeerr 22002200 TThhee iinnssttrruummeenntt aappppooiinnttiinngg aa pprrooxxyy PPeennggaannggkkaattaann ((AAddooppttiioonn)) 11995522
mmuusstt bbee ddeeppoossiitteedd aatt 117711,, JJaallaann ((AAkkttaa 225577)) ddaann KKaaeeddaahh--KKaaeeddaahh PPUUSSHHPPAANNAATTHHAANNAA//LLSSUUBBRRAAMMAANNIIAAMM
AA mmeemmbbeerr eennttiittlleedd ttoo aattteenndd aanndd vvoottee aatt SSrrii PPeellaannggii,, TTaammaann PPeellaannggii,, 8800440000 PPeennggaannggkkaattaann 11995555.. ((NNooKK//PP::775500442244--0077--55008855))
tthhiissmmeeeettiinnggiisseennttiittlleeddttooaappppooiinntt aannootthheerr JJoohhoorr BBaahhrruu aatt lleeaasstt 4488 hhoouurrss
ppeerrssoonn ((wwhheetthheerr aa mmeemmbbeerr oorr nnoott)) aass tthhee bbeeffoorree tthhee ttiimmee aappppooiinntteedd ffoorr DDaann ……PPLLAAIINNTTIIFF RUSSIAN Daniil Medvedev outclassed fiercely contested third game in the second
pprrooxxyy ttoo aattteenndd aanndd vvoottee ffoorr tthhee mmeemmbbeerr.. mmeeeettiinngg.. DDAANN German Alexander Zverev 5-7, 6-4, 6-1 in the set, which he won, but he dropped serve in
TThhee iinnssttrruummeenntt aappppooiinnttiinngg aa pprrooxxyy mmuusstt DDaallaamm ppeerrkkaarraa MMAASSTTEERR KKAAWWIINN 11..KKOOMMAATTHHEEAA//PPRREENNOOOO Paris final yesterday to claim his third Masters the ninth game when he sent a crosscourt
bbeeddeeppoossiitteeddaatttthheeaabboovveeaaddddrreessssnnoottlleessss IINN TTHHEE MMAATTTTEERR OOFF TTHHEE SSHHAAOOXXIIAANN WWOONNGG ((SSiijjiill KKeellaahhiirraann ((NNooKK//PP::660000883300--0077--55661188)) title. backhand long.
tthhaann 4488 hhoouurrss bbeeffoorree tthhee ttiimmee ffoorr hhoollddiinngg CCOOMMPPAANNIIEESS AACCTT,, 22001166 11--33880011--0000004411--3322--44)) sseeoorraanngg 22..SSAAKKTTHHIIRRAANNIIAA//PPSSUUPPPPIIAAHH
tthhee mmeeeettiinngg.. kkaannaakk--kkaannaakk lleellaakkii yyaanngg aakkaann ((NNooKK//PP::882200661111--1144--66005544)) The third seed, who also defeated Zverev Medvedev won his service game to love to
AANNDD ddiikkeennaallii sseebbaaggaaii WWOONNGG SSHHAAOOXXIIAANN.. 33..TTHHUURRAAIISSIINNGGGGAAMMAA//LLNNAAGGAALLIINNGGAAMM in the Shanghai final last year, returned level the match and send it into a decider.
IINN TTHHEE MMAATTTTEERR OOFF IINN TTHHEE MMAATTTTEERR OOFF ((NNooKK//PP::881111000022--1144--66551133)) strongly throughout the match to take his first
TTHHEE CCOOMMPPAANNIIEESS AACCTT 22001166 BBIIZZII GGLLOOBBEE SSDDNN.. BBHHDD.. ((11222244443355--KK)) AAnnttaarraa title of the year. He broke to love, held serve after saving
AANNDD ((IInn MMeemmbbeerrss’’ VVoolluunnttaarryy ……DDEEFFEENNDDAANN--DDEEFFEENNDDAANN four break points and broke again thanks to a
IINN TTHHEE MMAATTTTEERR OOFF WWOONNGG GGUUEEKK HHUUII PPEENNYYAAMMPPAAIIAANNGGAANNTTIIWWRRIITTSSAAMMAANNDDAANN Medvedev, 24, had more energy in the booming service return as he moved 4-0 up.
NNEEEESSUUMM BBEERRHHAADD WWiinnddiinngg--uupp)) ((NNOO KKPP:: 775500332277--0011--55004488)) deciding set and made the most of his
[[RReeggiissttrraattiioonn NNoo..:: 220000880011001122553344 NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN ppuurrssuuaanntt ttoo PPEERRNNYYAATTAAAANNTTUUNNTTUUTTAANN opportunities against an inconsistent Zverev, With his confidence shattered, Zverev
((881133882222--AA))]] SSeeccttiioonn 443399((22)) ooff tthhee CCoommppaanniieess AAcctt,, ……PPeemmoohhoonn NNOOTTIISS who had won five of their six previous never looked capable of mounting a
((IINN MMEEMMBBEERRSS’’ VVOOLLUUNNTTAARRYY 22001166,,tthhaatt tthhee ssppeecciiaall rreessoolluuttiioonnss sseett oouutt meetings. comeback as Medvedev added to his 2019
WWIINNDDIINNGG UUPP)) bbeellooww wweerree dduullyy ppaasssseedd bbyy tthhee MMeemmbbeerrss DDaann DDaallaammppeerrkkaarraaWWrriittSSaammaannyyaannggddiikkeelluuaarrkkaannppaaddaa Shanghai and Cincinnati Masters titles.
oofftthheeCCoommppaannyyoonnMMoonnddaayy,,0099NNoovveemmbbeerr 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 ddaann PPeerrnnyyaattaaaann A double fault earned the Russian his
NNoottiiccee iiss hheerreebbyy ggiivveenn ppuurrssuuaanntt ttoo 22002200aatt1100..0000aa..mm.. 11.. MMAASSTTEERR KKAAWWIINN SSHHAAOOXXIIAANN TTuunnttuuttaannbbeerrttaarriikkhh1155hhaarriibbuullaannSSeepptteemmbbeerr22002200.. eighth ATP title after two hours and seven Both players will take part in the season-
SSeeccttiioonn 443399((22))((bb)) ooff tthhee CCoommppaanniieess AAcctt SSPPEECCIIAALL RREESSOOLLUUTTIIOONNSS WWOONNGG KKeeppaaddaa:: minutes. ending ATP Tour Finals at the O2 in London
22001166,, tthhaatt tthhee RReessoolluuttiioonnss sseett oouutt bbeellooww WWIINNDDIINNGG UUPP,, AAPPPPOOIINNTTMMEENNTT OOFF ((SSiijjiill KKeellaahhiirraann 11--33880011-- 11))KKOOMMAATTHHEEAA//PPRREENNOOOO from Nov 15-22.
wweerreedduullyy ppaasssseedd bbyy tthhee MMeemmbbeerrss ooff tthhee LLIIQQUUIIDDAATTOORRAANNDDPPOOWWEERRSSOOFFLLIIQQUUIIDDAATTOORR 0000004411--3322--44)) Medvedev said he pulled off the win by
CCoommppaannyy oonn 33 NNoovveemmbbeerr 22002200:: TTHHAATT tthhee CCoommppaannyy bbee wwoouunndd uupp bbyy ((NNoo..KK//PP::660000883300--0077--55661188)) making his “opponent crazy”. Medvedev, the fourth Russian player to
wwaayy ooff mmeemmbbeerrss’’ vvoolluunnttaarryy wwiinnddiinngg 22.. KKAANNYYAARRAATT HHOOMMSSOOMMBBAATT DD--22--77,,PPaannggssaappuurriiLLaakkssaammaannaa,, win at Bercy after three-time champion Marat
SSPPEECCIIAALL RREESSOOLLUUTTIIOONN -- MMEEMMBBEERRSS’’ uupp ppuurrssuuaanntt ttoo SSeeccttiioonn 443399((11))((bb)) ooff tthhee ((NNOO..PPEENNGGEENNAALLAANN:: 11--44330033-- KKggLLaakkssaammaannaa,, Both players had a high first serve Safin, Nikolay Davydenko and Karen
VVOOLLUUNNTTAARRYY WWIINNDDIINNGG UUPP CCoommppaanniieessAAcctt,,22001166.. 0000002233--0088--66)) 6688110000BBaattuuCCaavveess,,SSeellaannggoorr.. percentage early on, holding comfortably. Khachanov, said he would go into the
AANNDD TTHHAATT ppuurrssuuaanntt ttoo SSeeccttiioonn 444455((11)) ooff DDAANN//AATTAAUU Zverev went 40-0 up on the Russian’s serve at tournament full of confidence.
““TThhaatt aapppprroovvaall bbee aanndd iiss hheerreebbyy ggiivveenn ffoorr tthhee CCoommppaanniieess AAcctt,, 22001166,, MMrr.. SSaatthhiisshh 33.. JJAABBAATTAANN KKEEBBAAJJIIKKAANN NNoo11,,JJaallaannTTSSMM22CC--11,, 6-5 to earn the first break points of the match.
tthheeCCoommppaannyyttoopprroocceeeeddwwiitthhaammeemmbbeerrss’’ AA//LL VV SSrreeee VVaalllaabbhhaann NNaaiirr ooff MMeessssrrss.. MMAASSYYAARRAAKKAATT TTaammaannSSeellaayyaannggMMuuttiiaarraa,, “I’m coming in better shape than last year.
vvoolluunnttaarryy wwiinnddiinngg uupp ppuurrssuuaanntt ttoo SSeeccttiioonn LLllooyyddss EEaarrllee CCoonnssuullttiinngg SSddnn.. BBhhdd..,, SSuuiittee ……RReessppoonnddeenn--RReessppoonnddeenn 6688110000BBaattuuCCaavveess,,SSeellaannggoorr.. Medvedev saved the first two by dictating Last year I was real exhausted, I had lost in the
443399((11))((bb)) ooff tthhee CCoommppaanniieess AAcctt 22001166..”” 11..0000AA,,LLeevveell1111BBAAkkaaddeemmiiEEttiiqqaa,,2233,,JJaallaann 22)) SSAAKKTTHHIIRRAANNIIAA//PPSSUUPPPPIIAAHH the rallies, but he whacked a forehand long on first round in Paris. That’s when you lose your
MMeellaakkaa,, 5500110000 KKuuaallaa LLuummppuurr,, bbee aanndd PPEENNGGIIKKLLAANNAANN SSAAMMAANN PPEEMMUULLAA ((NNoo..KK//PP::882200661111--1144--66005544)) the third and conceded his second set of the confidence,” he said.
OORRDDIINNAARRYY RREESSOOLLUUTTIIOONN -- iiss hheerreebbyy aappppooiinntteedd LLiiqquuiiddaattoorr ffoorr tthhee PPEENNGGAANNGGKKAATTAANN DD--22--77,,PPaannggssaappuurriiLLaakkssaammaannaa,, tournament.
AAPPPPOOIINNTTMMEENNTT OOFF LLIIQQUUIIDDAATTOORR ppuurrppoossee ooff wwiinnddiinngg uupp tthhee aaffffaaiirrss aanndd KKggLLaakkssaammaannaa,, “When you lose first round you always lose
ddiissttrriibbuuttiinngg tthhee aasssseettss ooff tthhee CCoommppaannyy iinn AAMMBBIILL PPEERRHHAATTIIAANN bbaahhaawwaa 6688110000BBaattuuCCaavveess,,SSeellaannggoorr.. Zverev faced his first break points in a your confidence.” – Reuters
““TThhaatt MMrr CChheeaaii WWeenngg HHoooonngg ooff DD--33--77,, ssppeecciiee oorr ootthheerrwwiissee wwiitthh ssuucchhppoowweerrssaass ssaattuu ppeerrmmoohhoonnaann uunnttuukk PPeerriinnttaahh 33))TTHHUURRAAIISSIINNGGGGAAMMAA//LLNNAAGGAALLIINNGGAAMM
GGrreeeennttoowwnn SSqquuaarree,, JJaallaann DDaattoo’’ SSeerrii aarreeccoonnffeerrrreeddbbyySSeeccttiioonn445566oofftthheeAAcctt.. PPeennggaannggkkaattaann KKaannaakk--KKaannaakk ((NNoo..KK//PP::881111000022--1144--66551133))
AAhhmmaadd SSaaiidd,, 3300445500 IIppoohh,, PPeerraakk DDaarruull SSiiggnneedd MMAASSTTEERR KKAAWWIINN SSHHAAOOXXIIAANN WWOONNGG DD--22--77,,PPaannggssaappuurriiLLaakkssaammaannaa,,
RRiiddzzuuaann bbee aanndd iiss hheerreebbyy aappppooiinntteedd aass NNGGGGOOOOPPHHAAII tteellaahh ddiiffaaiillkkaann oolleehh WWOONNGG GGUUEEKK KKggLLaakkssaammaannaa,,
tthhee LLiiqquuiiddaattoorr ffoorr tthhee ppuurrppoossee ooff tthhee DDiirreeccttoorr HHUUII ((NNOO KKPP:: 775500332277--0011--55004488)) ddii 6688110000BBaattuuCCaavveess,,SSeellaannggoorr..
aaffoorreessaaiidd wwiinnddiinngg uupp aatt aa rreemmuunneerraattiioonn DDaatteeddtthhiiss::1100tthhNNoovveemmbbeerr22002200 mmaahhkkaammaahh iinnii ppaaddaa 99..99..22002200 ddaann DDAANN//AATTAAUU
ttoo bbee ddeetteerrmmiinneedd bbyy tthhee ddiirreeccttoorrss..”” sseemmuuaa ppiihhaakk yyaanngg bbeerrkkeennaaaann hhaaddiirr NNoo11,,JJaallaannTTSSMM22CC--11,,
IINN TTHHEE MMAATTTTEERR OOFF TTHHEE ddii hhaaddaappaann HHaakkiimm DDaallaamm KKaammaarr TTaammaannSSeellaayyaannggMMuuttiiaarraa,,
CChheeaaii WWeenngg HHoooonngg CCOOMMPPAANNIIEESS AACCTT,, 22001166 MMaahhkkaammaahh SSeessyyeenn ppaaddaa hhaarrii 6688110000BBaattuuCCaavveess,,SSeellaannggoorr..
SSeeccrreettaarryy KKhhaammiiss 33 DDiisseemmbbeerr 22002200 99..0000 ppaaggii AAMMBBIILL PPEERRHHAATTIIAANN bbaahhaawwaa ssaattuu WWrriitt SSaammaann
IIppoohh AANNDD uunnttuukk mmeennddeennggaarrkkaann ppeerrmmoohhoonnaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 ddaann
DDaattee:: 1100 NNoovveemmbbeerr 22002200 IINN TTHHEE MMAATTTTEERR OOFF oolleehh PPeemmoohhoonn--PPeemmoohhoonn tteerrsseebbuutt PPeerrnnyyaattaaaann TTuunnttuuttaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann Mexico’s Ortiz wins first PGA Tour title
BBIIZZII GGLLOOBBEE SSDDNN.. BBHHDD.. ((11222244443355--KK)) bbaaggii ppeerriinnttaahh ppeennggaannggkkaattaann aannaakk.. SSeepptteemmbbeerr 22002200 tteellaahh ddiikkeelluuaarrkkaann tteerrhhaaddaapp
IINN TTHHEE MMAATTTTEERR OOFF ((IInn MMeemmbbeerrss’’ VVoolluunnttaarryy kkaammuu ddaallaamm MMaahhkkaammaahh iinnii oolleehh PPllaaiinnttiiff iiaaiittuu
TTHHEE CCOOMMPPAANNIIEESS AACCTT 22001166 SSaammaann PPeemmuullaa PPeennggaannggkkaattaann iinnii PPUUSSHHPPAANNAATTHHAANN AA//LL SSUUBBRRAAMMAANNIIAAMM yyaanngg MEXICO’S Carlos Ortiz held off world No. 1 really hard to hold the emotions all the way to
AANNDD WWiinnddiinngg--uupp)) bboolleehh ddiippoohhoonn aattaauu ddiippeerriikkssaa ddii bbeerraallaammaatt ddii NNoo 2233,, JJaallaann MMeeddaann BBaattuu CCaavveess 33,, Dustin Johnson and Japan’s Hideki the end, but I’m really happy the way it played
IINN TTHHEE MMAATTTTEERR OOFF NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN TTHHAATT tthhee MMaahhkkaammaahh SSeessyyeenn ddii JJoohhoorr BBaahhrruu.. TTaammaann MMeeddaann BBaattuu CCaavveess,, 6688110000 BBaattuu CCaavveess,, Matsuyama to clinch his maiden PGA Tour title out and the way I played, too,” said Ortiz.
NNEEEESSUUMM BBEERRHHAADD ccrreeddiittoorrss ooff tthhee aabboovveennaammeedd ccoommppaannyy SSeellaannggoorr DDaarruull EEhhssaann.. ddaann MMaahhkkaammaahh tteellaahh with a two-shot victory over the decorated
[[RReeggiissttrraattiioonn NNoo..:: 220000880011001122553344 wwhhiicchh iiss bbeeiinngg wwoouunndd uupp vvoolluunnttaarriillyy aarree BBeerrttaarriikkhh99 SSeepptteemmbbeerr 22002200 mmeemmeerriinnttaahhkkaann bbaahhaawwaa WWrriitt SSaammaann bbeerrttaarriikkhh duo at the Houston Open yesterday. “I wasn’t really thinking about the other
((881133882222--AA))]] rreeqquuiirreedd oonn oorr bbeeffoorree 1100tthh DDeecceemmbbeerr 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 ddaann PPeerrnnyyaattaaaann guys, I wasn’t worried. I knew if I played good I
((IINN MMEEMMBBEERRSS’’ VVOOLLUUNNTTAARRYY 22002200 ttoo sseenndd iinn tthheeiirr nnaammeess aanndd TTeellaahh ddiittaannddaattaannggaannii oolleehh TTuunnttuuttaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 Ortiz, who began the day one shot back of was going to be hard to beat because… if I
WWIINNDDIINNGG UUPP)) aaddddrreesssseess wwiitthh ppaarrttiiccuullaarrss ooff tthheeiirr ddeebbttss MMOOHHDD ZZUULLHHIILLMMII BBIINN IIBBRRAAHHIIMM ddiisseerraahhkkaann kkee aattaass kkaammuu mmeellaalluuii ppeennyyaammppaaiiaann overnight leader Sam Burns, shot a bogey- finished strong, there was no chance for them
oorr ccllaaiimmss aanndd tthhee nnaammeess aanndd aaddddrreesssseess ________________________________________________ ggaannttii ddeennggaann mmeennggeeppoosskkaann sseessaalliinnaann WWrriitt free 5-under 565 to reach 13-under at to catch up.”
NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN tthhaatt tthhee ooff tthheeiirr ssoolliicciittoorrss ((iiff aannyy)) ttoo MMrr.. SSaatthhiisshh SSaammaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 Memorial Park Golf Course where he became
ccrreeddiittoorrss ooff tthhee aabboovveennaammeedd CCoommppaannyy AA//LL VV SSrreeee VVaalllaabbhhaann NNaaiirr ooff MMeessssrrss.. PPeennoolloonngg KKaannaann PPeennddaaffttaarr ddaann PPeerrnnyyaattaaaann TTuunnttuuttaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann the third player from Mexico to win on the Australian former world No. 1 Jason Day,
wwhhiicchh iiss bbeeiinngg wwoouunndd uupp vvoolluunnttaarriillyy LLllooyyddss EEaarrllee CCoonnssuullttiinngg SSddnn.. BBhhdd..,, SSuuiittee MMaahhkkaammaahh RReennddaahh SSeepptteemmbbeerr 22002200,, ddaann sseessaalliinnaann PPeerriinnttaahh PGA Tour. who also began the day one shot off the lead,
aarree rreeqquuiirreedd oonn oorr bbeeffoorree 3311 DDeecceemmbbeerr 11..0000AA,, LLeevveell 1111BB AAkkaaddeemmii EEttiiqqaa,, 2233,, JJoohhoorr BBaahhrruu bbeerrmmeetteerraaii bbeerrttaarriikkhh 0022 NNoovveemmbbeerr 22002200 sseeccaarraa had four bogeys through his first 11 holes en
22002200 ttoo sseenndd tthheeiirr nnaammeess aanndd aaddddrreesssseess JJaallaann MMeellaakkaa,, 5500110000 KKuuaallaa LLuummppuurr,, tthhee ssiijjiill ppeennggeeppoossaann ddii aallaammaatt--aallaammaatt tteerraakkhhiirr kkaammuu That left him one shot clear of Matsuyama route to a closing 71 that left him six shots
wwiitthh ppaarrttiiccuullaarrss ooff tthheeiirr ddeebbttss oorr ccllaaiimmss LLiiqquuiiddaattoorr ooff tthhee aabboovveennaammeedd ccoommppaannyy PPEENNGGIIKKLLAANNAANN SSAAMMAANN PPEEMMUULLAA yyaanngg ddiikkeettaahhuuii sseeppeerrttii yyaanngg ddiinnyyaattaakkaann ddii aattaass..,, (63), whose red hot finish stalled at 18 where back of Ortiz.
aanndd tthhee nnaammeess aanndd aaddddrreesssseess ooff tthheeiirr aanndd iiff ssoo rreeqquuiirreedd bbyy nnoottiiccee iinn wwrriittiinngg PPEENNGGAANNGGKKAATTAANN iinnii tteellaahh sseerrttaammeennggiikkllaannkkaannNNoottiissiinniisseekkaalliiddaallaammssaattuu((11)) he missed a 13-foot birdie putt, and Johnson
ssoolliicciittoorrss ((iiff aannyy)) ttoo tthhee uunnddeerrssiiggnneedd ffrroomm tthheessaaiiddlliiqquuiiddaattoorr,,bbyytthheeiirrssoolliicciittoorrss ddiiffaaiillkkaann oolleehh TTEETTUUAANN JJUULLIIEE LLIIMM,, aakkhhbbaarrBBaahhaassaaIInnggggeerriisstteemmppaattaann,,““TThheeSSuunn””ddaann (65), who nearly grabbed a share of the lead at Burns, who had the first 54-hole lead of his
LLiiqquuiiddaattoorr ooff tthhee aabboovveennaammeedd CCoommppaannyy;; oorr ppeerrssoonnaalllyy,,ttoo ccoommee iinn aanndd pprroovvee tthheeiirr VVAASSAANNTTHHAANN && CCOO,, PPeegguuaammbbeellaa && bbaahhaawwaappeennggeeppoossaannddaannppeennggiikkllaannaannsseeddeemmiikkiiaann 16 where his putt from 20 feet rolled just left career and was also seeking his maiden PGA
aanndd iiff ssoo rreeqquuiirreedd bbyy nnoottiiccee iinn wwrriittiinngg ssaaiidd ddeebbttss oorr ccllaaiimmss aatt ssuucchh ttiimmee aanndd PPeegguuaammccaarraa yyaanngg bbeerraallaammaatt ddii LLoott hheennddaakkllaahh ddiiaannggggaapp sseebbaaggaaii ppeennyyaammppaaiiaann yyaanngg of the cup. Tour win, had a bogey, birdie and double-
ffrroomm tthhee LLiiqquuiiddaattoorr,, eeiitthheerr bbyy tthheeiirr ppllaacceeaasssshhaalllbbeessppeecciiffiieeddiinnssuucchh nnoottiiccee 2211--0022,,LLeevveell 2211 PPuubblliicc BBaannkkTToowweerr,, sseemmppuurrnnaa ddaann ccuukkuupp WWrriitt SSaammaann bbeerrttaarriikkhh bogey over his first four holes en route to a
ssoolliicciittoorrss oorr ppeerrssoonnaalllyy ttoo ccoommee iinn aanndd oorriinnddeeffaauulltttthheerreeoofftthheeyywwiilllbbeeeexxcclluuddeedd NNoo.. 1199,, JJaallaann WWoonngg AAhh FFooookk,, 8800000000 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 ddaann PPeerrnnyyaattaaaann “I’ve played great this week and it was closing 2-over 72. – Reuters
pprroovvee tthheeiirr ddeebbttss oorr ccllaaiimmss aatt ssuucchh ttiimmee ffrroomm tthhee bbeenneeffiitt ooff aannyy ddiissttrriibbuuttiioonn mmaaddee JJoohhoorr BBaahhrruu,, JJoohhoorr TTuunnttuuttaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann SSeepptteemmbbeerr
aanndd ppllaaccee aass sshhaalll bbee ssppeecciiffiieedd iinn ssuucchh bbeeffoorreessuucchhddeebbttssoorrccllaaiimmssaarreepprroovveedd.. [[NNoo..TTeell::0077--22227755551155 22002200 kkee aattaass kkaammuu,,DDeeffeennddaann--DDeeffeennddaann sseelleeppaass
nnoottiiccee oorr iinn ddeeffaauulltt tthheerreeooff tthheeyy wwiilll SSiiggnneedd NNoo.. FFaakkss:: 0077--22226655115555 ttuujjuuhh ((77)) hhaarrii ddaarrii ttaarriikkhh tteerraakkhhiirr ppeennggeeppoossaann
bbee eexxcclluuddeedd ffrroomm tthhee bbeenneeffiittss ooff aannyy SSAATTHHIISSHHAA//LLSSRREEEEVVAALLLLAABBHHAANNNNAAIIRR EEmmeell::jjllvvccoo@@yyaahhoooo..ccoomm]] ddaann ppeennggiikkllaannaann tteerrsseebbuutt.. WWrriitt SSaammaann bbeerrttaarriikkhh
ddiissttrriibbuuttiioonn mmaaddee bbeeffoorree ssuucchh ddeebbttss aarree ((LLiiqquuiiddaattoorr)) [[RRuujj::JJLLVV//77995588//2200//AADDOOPPTTIIOONN//RRVV//FF]] 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200 ddaann PPeerrnnyyaattaaaann
pprroovveedd oorr ssuucchh pprriioorriittyy iiss eessttaabblliisshheedd oorr DDaatteeddtthhiiss::1100tthhNNoovveemmbbeerr22002200 TTuunnttuuttaann bbeerrttaarriikkhh 1155 hhaarriibbuullaann SSeepptteemmbbeerr 22002200
aass tthhee ccaassee mmaayy bbee,, ffrroomm oobbjjeeccttiinngg ttoo tteerrsseebbuutt bboolleehh ddiippeerriikkssaa oolleehh kkaammuu ddeennggaann
ssuucchh ddiissttrriibbuuttiioonn.. mmeemmoohhoonnkkeeppaaddaaMMaahhkkaammaahhiinnii..

IIppoohh BBeerrttaarriikkhhppaaddaa0022NNoovveemmbbeerr22002200..
DDaattee:: 1100 NNoovveemmbbeerr 22002200
.................tt..tt.................
CChheeaaii WWeenngg HHoooonngg PPeennddaaffttaarr
LLiiqquuiiddaattoorr
DD--33--77,, GGrreeeennttoowwnn SSqquuaarree MMaahhkkaammaahhMMaajjiissttrreett
JJaallaann DDaattoo’’ SSeerrii AAhhmmaadd SSaaiidd SSeellaayyaanngg
3300445500 IIppoohh,, PPeerraakk DDaarruull RRiiddzzuuaann
NNoottiiss PPeennyyaammppaaiiaann GGaannttii WWrriitt SSaammaann ddaann
PPeerrnnyyaattaaaann TTuunnttuuttaann iinnii ddiiffaaiillkkaann oolleehh TTeettuuaann
TThhee
CChhaammbbeerrss ooff GGaannaaeesshh RRaauu ppeegguuaammccaarraa ppiihhaakk
PPllaaiinnttiiff,, yyaanngg mmeemmppuunnyyaaii aallaammaatt ppeennyyaammppaaiiaann
ddii NNoo 3333,, JJaallaann MMuuttiiaarraa 66//55,, TTaammaann SSeellaayyaanngg
MMuuttiiaarraa,,6688110000BBaattuuCCaavveess,,SSeellaannggoorrDDaarruullEEhhssaann..
[[TTeell((++6600))001100--22550099667799;;
FFaaxx::0033--6611228800002211;;
EEmmaaiill::cchhaammbbeerrssooffggaannaaeesshhrraauu@@ggmmaaiill..ccoomm]]
[[GGRR//PPSS--KKRR//004444//2200]]

22 theSUN ON TUESDAY | NOVEMBER 10, 2020
SPORTS

ZLATAN IBRAHIMOVIC missed a penalty Erratic Zlatan grabs point for AC Osimhen header sealed a 1-0 win over Bologna.
before scoring a late equaliser as Serie A leaders Roma are equal on points with Napoli, both
AC Milan salvaged a point in a 2-2 Serie A draw four points clear at the top of the table in the over the crossbar before redeeming himself
against Hellas Verona yesterday to let rivals final match before the international break. deep into injury time by heading in his eighth one point ahead of fifth-placed Juventus, after a
Juventus and Inter Milan off the hook after both league goal this season. Henrikh Mkhitaryan hat-trick delivered a 3-1
were held 1-1 in earlier games. But the leaders were two goals down in the win at Genoa.
San Siro after Antonin Barak opened the scoring Milan avoided a first league defeat after their
In Rome, Cristiano Ronaldo opened the in the sixth minute and Milan defender Davide 24-match unbeaten run was ended with a Earlier Juventus once again demonstrated
scoring for Juventus after quarter of an hour, Calabria bundled into his own goal quarter of Europa League loss to Lille during the week. how dependent they are on Portuguese star
but Lazio’s Felipe Caicedo scored five minutes an hour later. Ronaldo, letting three points slip after he
into injury time after the Portuguese star went Pioli’s side are top of Serie A with a two- limped off with 15 minutes to go.
off with an ankle injury. Ibrahimovic had a chance for the equaliser point advantage on second-placed Sassuolo,
after 66 minutes, after Verona defender who were held to a goalless draw against “Ronaldo is a crucial player,” said Juventus
Inter Milan and Atalanta also shared the Giangiacomo Magnani’s own goal had reduced Udinese on Friday. coach Andrea Pirlo.
spoils in Bergamo after Aleksey Miranchuk the deficit for the hosts.
scored on his first Serie A start for the hosts to Napoli continued their fine away form Simone Inzaghi’s Lazio, embroiled in
cancel out Lautaro Martinez’s header. But the 39-year-old embarrassingly fired moving up into third place after a Victor coronavirus chaos, are ninth, six points off the
leaders.
Stefano Pioli’s Milan had the chance to pull
“This team has heart, difficulties are part of
Real recovery hits snag our DNA,” said Inzaghi. – AFP

SHORTS
Lille suffer first defeat of season

Three Valencia penalties and an own-goal put dent in Madrid’s credentials LIGUE 1’S last unbeaten run was ended
REAL MADRID were yesterday when Lille followed up their
thrashed 4-1 at struggling quality up front to make a midweek triumph over AC Milan with a 3-2
Valencia yesterday as Carlos difference.” defeat at Brest, while Lyon downed local
Soler scored a hattrick of rivals Saint Etienne 2-1.
Yesterday’s win over Madrid was
a a personal milestone for Valencia Lille remain second in the French top-
penalties to raise further doubts over manager Javi Gracia. flight five points behind Paris Saint-Germain
La Liga’s reigning champions. “I had never beaten Real Madrid and one above Rennes after suffering their
Madrid took the lead through as a coach before,” Gracia told first loss since February.
Karim Benzema but presented managingmadrid.com.
Valencia with four gifts at Mestalla, “We put in a great effort. It isn’t Ronael Pierre-Gabriel got his first
including three spot-kicks and an usual for you to receive three professional goal with a header for the
own-goal scored by Raphael Varane, penalties, but in my opinion they opener on 15 minutes and Brest raced to a
to fall to another surprise defeat. were all very clear. The result is a 3-0 lead before half-time with goals from
“After the goal, we let our guard consequence of the many things the Romain Perraud and Irvin Cardona.
down a bit and changed what we team did well.
were doing,” Zidane told Spanish “We didn’t let the opposition play Christophe Galtier’s side never gave up
sports daily Marca at fulltime. comfortably. We had good pressure however and earned a penalty in first-half
“It’s difficult to understand our in their half and our defensive injury time with Turkish striker Yilmaz Burak
game. I don’t think Valencia were work was very good. slotting home. Burak also grabbed Lille’s
better than us tactically. But I’m the “In attack, we not only second after 57 minutes to set up a tense
one responsible because I have to had the four goals, but also finish.
find solutions. other chances. I am
“There are no excuses. After the happy with the work we “We thought kickoff was going to be at
first goal, we dropped our guard. have done.” 2pm, we were wrong by an hour,” said
Everything piled up today. It’s true Real Sociedad Galtier.
that we weren’t how we were before regained top spot after winning 2-0
at the back. It’s a bad game and a bad against a depleted Granada, who “When there’s such a difference between
day.” could face punishment for fielding the first and second half, there’s only one
This is the first time Madrid have fewer than the required number of person responsible and that’s me. The
conceded four goals since letting in first-team players. starting XI was my choice and it didn’t work
five against Barcelona in October Nacho Monreal scored in the at all.”
2018 and puts the brakes on their 22nd minute and Mikel Oyarzabal
recovery that had followed a rocky converted a penalty in the 27th at Lyon moved into fifth place by beating
start to the season. Anoeta to send la Real back strugging rivals Saint-Etienne 2-1 with a
After back-to-back losses to Cadiz above Atletico Madrid, who brace from Tino Kadewere after his team
and Shakhtar Donestsk last month, had briefly taken first place had fallen behind in the first half when
Zinedine Zidane’s side appeared to after beating Cadiz on goalkeeper Anthony Lopes put through his
have turned a corner with wins over Saturday. own goal five minutes before the interval.
Barca, Huesca and Inter Milan. Atletico are three
Yet this result puts the pressure points behind but Gattuso sends players
back on ahead of the international have two games to the stands
break, with Madrid now fourth in the in hand. –
table, four points behind early A F P / NAPOLI coach Gennaro Gattuso, famously
leaders Real Sociedad. Agencies combative in his playing days, is not one to
tolerate a lack of effort from his players as
A disappointing night also got he again showed yesterday.
worse when Benzema was forced off
late on with what looked like a groin Having slammed his team for their
injury. performance in the 2-1 Europa League win
“Everything happened to us,” at Rijeka last week, Gattuso dropped Mario
Zidane said. Rui and Faouzi Ghoulam from yesterday's
Solidity was the key to Madrid match at Bologna because he was not
winning the title last season but they pleased with their efforts in training.
are now seven matches without a Valencia midfielder Carlos Soler (centre) celebrates with teammates Uros Racic and Maxi Gomez (right)
single clean sheet. after scoring a goal during their Spanish La Liga match at the Mestalla stadium yesterday. – AFPPIX “I sent them to the stands because they
“We have to be strong in defence,” were strolling around in training,” he said
said Zidane. “If we have this, we have after the 1-0 win.

Alario stars as Bayer win seven-goal thriller Gattuso still made the pair travel to
Bologna with the squad and told them of
LUCAS ALARIO struck twice as The 28-year-old Alario, who has Gladbach had clear first-half forward Valentino Lazaro used the his decision after they arrived.
Bayer Leverkusen climbed to fourth scored two goals in each of his last chances as defender Ramy back of his heel to volley a
in the Bundesliga yesterday with a three league games, is the Bensebaini clattered the post and spectacular shot. “It is too easy to be at home on the
4-3 win over Borussia Bundesliga’s second highest scorer forward Marcus Thuram had a shot couch. I brought them with us because they
Moenchengladbach, who suffered behind Bayern Munich striker saved. “There were too many mistakes are part of the squad, but they didn’t
their first defeat since the opening Robert Lewandowski, who has 11. against a very good team, that’s deserve to play,” he said.
day of the season. Alario equalised for the second not good enough,” admitted
Gladbach captain Lars Stindl time when he outleapt his marker Gladbach keeper Sommer. “This is a team that needs to be kept on
Alario now has seven goals in converted a penalty after only 18 and his header flew past Gladbach their toes, we still have too many off days.”
six league games after twice minutes when Leverkusen goalkeeper Yann Sommer, who Earlier, Wolfsburg climbed to
equalising before Jamaica winger goalkeeper Lukas Hradecky mistimed his clearance, to make it sixth after goalkeeper Koen Bologna boss happy with VAR
Leon Bailey and midfielder Julian upended striker Breel Embolo in 2-2 at the break. Casteels pulled off a late stunning
Baumgartlinger netted second-half the area. penalty save to help seal a 2-1 BOLOGNA coach Sinisa Mihajlovic said he
goals for Leverkusen. Leverkusen sealed the win home over Hoffenheim, who have still had something to celebrate after
Alario levelled by curling in a when Bailey fired home from a struggled since their shock win yesterday’s defeat against Napoli – a VAR
“It was a very intense game,” superb shot into the top far corner tight angle, then Baumgartlinger over Bayern Munich. decision in his team’s favour.
said Baumgartlinger. on 27 minutes. finished off a flowing move eight
minutes from time. Bayern opened a two-point gap Napoli defender Kalidou Koulibaly
“We put in a really good Stindl grabbed his second when over second-placed RB Leipzig on thought he had scored a second goal for
performance and can go into the he snapped up a stray Leverkusen Arguably the best goal of the Saturday with a 3-2 win at rivals his side in the 52nd minute but it was ruled
international break with a lot of pass in the area and fired home game came in the 90th minute Borussia Dortmund, who move out for handball by teammate Victor
self-confidence.” with a half an hour gone. when Gladbach replacement down to third. – AFP Osimhen after the referee reviewed the
incident on the pitchside monitor.

“Finally, a referee who went to look at
the monitor to disallow a goal against us…
it’s been a year and a half since we last had
a VAR episode in our favour,” Mihajlovic
said.

Mihajlovic also said that he himself
deserved to be sent off and thanked the
fourth official for tolerating his behaviour.

23theSUN ON TUESDAY | NOVEMBER 10, 2020
* SPORTS

Toughest League to win: Mourinho
TOTTENHAM boss Jose Mourinho has Spurs boss praises captain Kane ‘s impact after win over Baggies
reiterated how hard it will be to win
the Premier League title after his side direct opponents,” he said after edging a tight England captain scored his 13th goal of the recovered, this number of duels won. This
briefly went top of the table with a 1-0 game at the Hawthorns. season to go joint ninth in the all-time list of number of balls that he saved his team in a
win at West Brom. Premier League scorers. defensive set-piece. This is Harry Kane. It’s
“I would say that this team could be goals plus this and this and this and that.
Harry Kane’s 150th Premier League goal champions in many European countries. Kane headed home Matt Doherty’s cross in
two minutes from the end sent Spurs to the the 88th minute to continue his incredible “For me it’s not one more goal or one less
summit for the first time since August 2014, “The Premier League is the most difficult start to the campaign. goal, it’s about what he is as a player.”
even though they were displaced after one to be, because in the Premier League you
Leicester beat Wolves. can do a good season, can have lots of points, “When you go to stats in relation to the West Brom were heartbroken by conceding
but in the end: Liverpool, Man City, Chelsea, strikers, I always say that the stats should be so late as they probably deserved a point for
Spurs are now unbeaten since the opening Man United, Leicester, Arsenal. So you can how many goals has a striker scored, and what their performance.
day of the season and, with four successive have a good season and not be champion. he did for his team in the matches where he
away wins, appear to be contenders for the didn’t score,” he added. The wait for their first win back in the
title. “So what can we do? We go match after Premier League goes on, but Slaven Bilic is not
match. We try to win, we don’t care about the “And many of the strikers that history will concerned about his future.
Mourinho is not being kidded about how others… and then at the end of the season let’s show an incredible number of goals that they
hard it will be to win his fourth Premier League see where we are.” score, plus zero. “The players are not playing for me, they
crown, though. are playing for the club – it is a nonsense to
Having a striker like Kane in his ranks will “Harry Kane you have to say has this many raise that question about my future,” he said. –
“When a team is champion or plays for the surely help Mourinho’s chances as the goals, this many assists, this number of balls The Independent
title, there is always a direct relation to your

Rodgers Cardiff boss Harris feels Cardiff City’s Joe Bennett.
warns title robbed after Bristol defeat
rivals as
Foxes go top NEIL HARRIS said he felt gutted comparison to the Bristol’s two,
and like “he had his wallet but it counted for nothing in
BRENDAN RODGERS is feeling good pinched out of his pocket” after the end.
about his high-flying Leicester City side Cardiff City fell to a 1-0
following their victory over Wolves Severnside derby defeat against Harris admitted that,
yesterday. Bristol City last week. following the international
break, his side simply have to
Jamie Vardy scored the only goal of Chris Martin found the back find that clinical edge if they are
the game from the spot, before seeing of the net with fewer than two to start firing their way back up
a second penalty saved. minutes on the clock, with the that table.
Bristol capitalising on an errant
Although the former Celtic boss Joe Bennett pass and breaking “The amount of
watched his side throw away their away to score the opener. chances we’ve created
chances of Champions League there, we’ve done
qualification last season, he believes Cardiff dominated the game enough to win two
they have shown another side to their thereafter, but just could not or three games of
game. find the back of the net and the football.,” he added
manager was visibly
Speaking to Sky Sports, he said: disappointed not to have come “We have to
“Everything about the game was very, away with anything from the find our clinical
very good and should have been more clash. edge… it just
than one goal up. baffles me how
“I’m absolutely gutted, I feel we’ve not won
“We had to show resilience in the like I’ve had my wallet pinched a game, let
second half when Wolves had more of out of my pocket,” he said after alone not got a
the ball. the match. point.” –
WalesOnline
“Kapser Schmeichel made an “We were by far the better
amazing save and Harvey Barnes team, created chance after
misses a chance to close the game out. chance, dominated the
Nine wins out of 11 shows the game, the ball, set plays,
mentality of the team. every duel on the pitch.
One misplaced pass and
“Our football was outstanding the ball ends up in the
against a very good side. back of our net.

“If you think of the games we’ve “It has to change
had, we know sometimes we have to and can’t keep
show that (resilience). You’re not always happening but it has
going to have it all your own way. happened again. I feel
robbed. It’s a game we
“The more we work together the deserved to win and
more we are able to deal with that should have won.”
pressure.”
The Bluebirds had
Before adding of the first penalty the lion’s share of
incident: “I haven’t seen it back and I possession and also
think there’s so many disputes now had 17 shots on
about the handball rule and whether goal in
it’s in a natural or unnatural position or
not. But we got the penalty and took it Neil Harris
well.”
SIDENETTING … and accuses Aguero of yesterday with one of the worst performances
And saying of the season so far: On Keane says Walker is‘a car crash’ ‘piling on the pounds’ he can remember seeing from the club in their
going top: “It’s been an incredible start, 3-0 defeat by Aston Villa. Former Arsenal striker
I’m so happy for the players. ROY KEANE delivered stinging criticism of Kyle THE former Manchester United captain also and club favourite Wright was concerned with
Walker’s performance in the first half of accused Sergio Aguero of returning from injury the team’s performance, given how their attack
“It’s important in any season your Manchester City’s Premier League showdown overweight earlier this season. Aguero was left failed to give Villa any problems. After beating
first steps are positive. with Liverpool. Walker was responsible for out of Man City’s squad to face Liverpool Manchester United 1-0 the previous weekend
conceding an early penalty when he clattered yesterday as he continues his recovery from a and seeing off Molde in the Europa League in
“With all players available it into Sadio Mane, and Mohamed Salah scored hamstring issue, which he sustained earlier this midweek, Arteta rotated his side to bring in
would’ve been really good, but for the from the spot to give Liverpool the lead. Gabriel term after returning from a knee injury. And fresh legs for the visit of high-flying Villa, yet
players we’ve had out for the guys to Jesus’s equaliser made it 1-1 at the break, but Keane has suggested that the striker has not watched helplessly as they produced a drab
show that quality and resilience, it’s speaking on Sky Sports, Keane did not hold back been looking after himself as best as he could. and below-par display. “It’s as bad a
what you want as a manager.” in his assessment of the City defender. “He’s up “My issue with Aguero when he came back was performance as I’ve seen from an Arsenal side,
against an idiot,” said Keane, explaining why he looked overweight,” Keane said of the 32- when you consider only two of them were
But for Schmeichel’s wonderful save, Mane won the penalty. “People keep telling me year-old on Sky Sports. “God knows what size playing in midweek,” Wright said on BBC’s
Wolves would have headed back to the Kyle Walker’s playing well – I don’t think so. He’s shorts he was wearing. He did look really Match of the Day. “It was poor in every
Black Country with a point. an international, 30 years old, and he’s a car heavy.” department. They need to break the lines, they
crash.” Fellow pundit and former City defender need space to hit the ball into, they were
“We will keep on improving,”Wolves Micah Richards defended Walker. “He’s been one ... while Wright laments limp Gunners dithering on the ball. It was a million miles
boss Nuno Espirito Santo told BBC of our best players this season. I think Roy’s away from the performance against
Sport. being a bit overboard there,” he said. IAN WRIGHT believes Mikel Arteta’s apparent Manchester United. They were streets ahead of
Arsenal revolution was halted in its tracks us today.”
“All the squad will now basically go
for international duty and we hope
they return healthy.

“We are always looking for
improvements, the players are working
very hard and it’s up to us to improve
them and get them to fine levels of
performance.” – Daily Star/Agencies

TUESDAY • NOVEMBER 10, 2020 QUOTE OF THE DAY

The Premier League is the most difficult one
to be, because in the Premier League you can
do a good season, can have lots of points… So you can

have a good season and not be champion. So what can we
do? We go match after match. We try to win, we don’t
care about the others… and then at the end of the
season let’s see where we are.”

Tottenham Hotspur manager Jose Mourinho

Arteta takes full responsibility for Gunners’ horror-show

MIKEL ARTETA has taken full former goalkeeper Emiliano situation but we lost all the races, how we react.” “That’s what pleased me the
responsibility for Arsenal’s “unique” Martinez, two strikes from Ollie the duels and we were sloppy on The loss means that Arsenal are most and we could’ve scored more.
defeat to Aston Villa. Watkins with 15 minutes left ended the ball.
any chance of a comeback. 11th, six points off League leaders “We created some great chances
The Gunners were left stunned “When we created chances we Leicester after eight games. from our ball carrying skills with
by the West Midlands side as they And Arteta said it was the first didn’t hit the target. It’s a really bad Jack Grealish and Ross Barkley and
came away with a 3-0 win in north time he had seen his side play in combination. We left spaces and on Arteta added: “I’ll keep what I Trezequet and Ollie Watkins’ non-
London. such a manner. the counter we looked really said to my players in the dressing stop running.
vulnerable. room private, my role is to get the
Dean Smith’s side put pressure Speaking to Sky Sports, the team performing at the highest “You can’t underestimate the
on them straightaway, with John Gunners boss said: “First of all “ I am responsible to make the level every three days. work they do off the ball.
McGinn finding the net in the first congratulations to Aston Villa for team perform on the pitch and
minute – only to be ruled out for the way they played and the today we were not a team and it is “Today we haven’t done that and “We have to take each game as it
offside. victory. my job. It is why I am standing here. since I got appointed it’s the first comes and that’s all we can do and
time I haven’t seen that team on the want to do.
But the side that had beaten “After that, we performed below “It is a frustration. It takes a lot pitch.”
Liverpool 7-2 last month did not our standards and I have to say it’s to build momentum, to build a way “We won our first four of the
rest on their laurels and forced an the first time I’ve seen us play and of being, living and performing and Villa boss Smith feels his players season and got our first bloody
own goal from Bukayo Saka after we weren’t a team. when something like that comes up are meeting expectations after nose against Leeds so it can happen
25 minutes. it’s a hard one to take but in a hard yesterday’s victory . if you’re not at it and the players
“I take full responsibility. We moment you learn more than in a know it that you have to be at it
Despite Arsenal getting back didn’t start well enough, we got positive moment and I want to see “We set the tone from the off – right from the off.” – Express
into the game and threatening away with VAR for an offside we knew we had to be at our best Newspapers
without the ball.

Arsenal goalkeeper Bernd
Leno (right) attempts to
punch the ball clear of

Aston Villa defender Tyrone
Mings (left) and striker
Anwar El Ghazi (centre)

during yesterday’s English
Premier League match at

the Emirates Stadium in
London. – AFPPIX

United front
Big clubs close ranks in row over schedule and substitutions after City, Liverpool share points

█ MARK CRITCHLEY Having witnessed that slow finish to the Klopp also revealed that he had held a Ferguson, Arsene Wenger and Rafa Benitez
game and an injury to Trent Alexander-Arnold, meeting with the Premier League’s head of were complaining the same thing about what
THE meetings between Manchester City both Jurgen Klopp and Pep Guardiola spoke broadcasting to discuss the scheduling of Klopp and Solskjaer is saying.
and Liverpool over the past few seasons more passionately about player welfare than television games.
have, to use an old cliche, been “a great anything that had happened during the biggest “I don’t have any optimistic solution. I
advert for the Premier League”. 90 minutes of the top flight season to date. “We played after the last international break understand that the TVs have to decide. I am
Yesteray’s 1-1 draw at the Etihad lived up to at 12.30pm at Everton. Some of my players were pretty sure it is not going to change.”
that billing, as the two finest teams in the A day after Ole Gunnar Solskjaer accused the on Wednesday night in Peru. These kinds of
country played out a pulsating, high-tempo Premier League of setting Manchester United things should not happen,” he said. The Premier League has just survived the
contest that could have swung either way. up to fail with their fixture scheduling, here greatest threat to its existence in its current form
came two other managerial broadsides against Guardiola stopped short of calling out for some time, but even after the failure of
For the opening 45 minutes, that is. The the League’s decision-makers. individual Premier League officials by name but Project Big Picture, the debate about the future
second half was significantly more sedate. agreed entirely with Klopp, insisting that he of English football post-Covid rages on.
Klopp even took the extraordinary step of would support a change regarding
City and Liverpool managed seven shots on questioning the leadership of Premier League substitutions. It was therefore striking to see Klopp,
goal between them after the break and none chief executive Richard Masters, referencing Solskjaer and Guardiola – not just managers but
whatsoever during the final quarter-of-an-hour, him by name while arguing that the increase to “All the leagues in the world except this one – the public faces of their clubs, which are three of
almost as if not particularly interested in taking five substitutions per game during Project maybe because it likes to be different – accepts the biggest in the league – vociferously criticise
points from their closest rivals. Restart should have been retained. five (subs) to protect the players, protect the the way things are currently being done, all on
football and the physicality of playing every the same weekend.
And if anyone watching from the Premier “In my understanding it is a lack of three games,” he said.
League’s headquarters thought that second half leadership,” the Liverpool manager said. That is not a great look for the Premier
was not a particularly “great advert” for their “Richard Masters sold it completely wrong in But on scheduling, he was less hopeful of League and, when everyone should have been
lavishly marketed product, here’s hoping they my understanding. It is the only big league compromise. revelling in what was supposed to be the game
missed the press conferences. where you have only three subs. Surprise!” of the season so far, not a particularly “great
“I remember when I was a young, young lad advert” either. – The Independent
and I read the news from England. Sir Alex

theSun is published and printed by Sun Media Corporation Sdn Bhd (221220-K) of Lot 6, Jalan 51/217, 46050 Petaling Jaya, Selangor. Tel: 03-7784 6688 Fax: 03-7783 7435 • Tel (Editorial): 03-7784 6688 Fax: 03-7785 2624/5 Email: [email protected] • Tel (Advertising): 03-7784 8888 Fax: 03-7784 4424 Email: [email protected]