Starfinder Alien Archive 3

4254510
4254510

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

Graft: A tsukumogami is a kami that permanently merges CREATING MONSTERS AND APPENDIXES
with a small object; these kami gain the tsukumogami OTHER NPCS
template graft (see page 63).
Starfinder Alien Archive 3 provides all the information
Traits: Darkvision 60 ft., low-light vision; fast healing
(see below); immunity to bleed, mind-affecting effects, you need to use and quickly modify the creatures
petrification, and polymorph; resistance 10 to acid,
electricity, and fire; telepathy 100 ft.; no breath; merge presented in this book. For information on creating
with ward (see below); some kami gain other abilities from
new monsters and other NPCs, see pages 126–143 of

the Starfinder Alien Archive.

having specific wards.

Fast Healing (Ex): A kami within 120 feet of or merged

with its ward has fast healing. A kami of CR 10 or lower psychic shunt, shakalta telepathy, and starlight sustenance

has fast healing 5, while one of CR 11 or higher has fast racial traits. A shakalta can use the following spells as

healing 10. spell-like abilities: at will—dancing lights and energy ray

Merge with Ward (Su): A kami has a specific ward—a (electricity or fire only).

creature with an Intelligence of –4 or lower, an object, or a Shatori
location—listed in parentheses in the kami’s stat block. As a

full action, a kami adjacent to its ward can merge body and This subtype is applied to shatoris and creatures related

mind with that ward. While merged, the kami can observe to shatoris.

the surrounding region with its senses as if it were using Traits: If the NPC is of the shatori race (see page 94), it

its own body, as well as via any senses its ward might has the Boneyard conditioning, psychometry, and shared

have. Typically, this trait allows a kami no control over its stillness racial traits. A shatori can use the following spells

ward, although some kami (such as the tsukumogami) are as spell-like abilities: at will—detect magic, grave words,

exceptions. If the kami has no control over its ward, it can and stabilize.

take no actions while merged other than to emerge from Shimreen
its ward as an action. The kami can emerge adjacent to the

ward, provided the kami’s body is at least one size smaller This subtype is applied to shimreens and creatures related

16651306 than the ward. If the ward is a location, the kami can emerge to shimreens. 4254510

at any point within that location. If the ward is destroyed Traits: If the NPC is of the shimreen race (see page 96),

while a kami is merged with it, the kami dies. If the ward it gains resistance 5 to electricity and the amplify, radiant,

is destroyed while the kami is not merged with it, the kami and shift limb racial traits.

loses its merge with ward and fast healing traits, and the Skittermander
kami becomes sickened. It can take on a new ward by

spending 7 days doing so, and it regains its traits and loses This subtype is applied to skittermanders and creatures

the sickened condition once it does. related to skittermanders.

Some kami have additional abilities and limitations relative Traits: Low-light vision; if the NPC is of the stridermander

to their wards. race (see page 104), it also gains the camouflage, feeding

Native tendril, and gorge racial traits.

Creatures that have this subtype are outsiders native to the Spectra

Material Plane. They can be returned to life (such as with the Spectra are neutral outsiders native to the Drift.

raise dead or mystic cure spells), just as other living creatures Traits: void adaptation; DR 5/chaotic, evil, good, or law

can be. (CR 8; increases to DR/10 at CR 13, increases to DR/15

Plantlike at CR 18); immunity to electricity; resistance 5 to cold
and sonic; spell resistance equal to 10 + CR; Computers,

Plantlike creatures have many of the characteristics of plants. Engineering, and Mysticism as master skills; machine

Traits: Most plantlike creatures have the plantlike universal telepathy (see below); truespeech; slip drive (see page 150);

creature rule (see page 153). spaceflight (Mysticism).

Shakalta Machine Telepathy (Ex): A spectra can communicate with
and through technological devices within a certain range

This subtype is applied to shakaltas and creatures related (usually 100 feet), as well as with other creatures that have

to shakaltas. machine telepathy. A spectra can also attempt Computers and

Traits: If the NPC is of the shakalta race (see page 92), Engineering checks at this range.

it has immunity to disease and poison, as well as void Slip Drive (Ex): A spectra has an internal biomechanical

adaptation. It also has the aura of light, bonded souls, Drift engine that allows it to travel freely between the Drift

APPENDIXES 149

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651306
16651306

4254511
4254511

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

A and other planes, as well as between two non-Drift planes, as a move action, or it can remove itself from its target as a
using the normal rules for Drift navigation. A slip drive has move action.

an effective Drift engine rating equal to the half the spectra’s Format: Melee attach +6.

CR, and a spectra need remain stationary for only 1 round Aura (Ex, Sp, or Su)
(6 seconds) before engaging its slip drive.

APPENDIX 2: TEMPLATE GRAFTS Unless an aura says otherwise, a target is affected by an
aura automatically, with no action required on the creature’s

The following section lists the creatures in this book that part, whenever the target is within the aura’s listed range

include template grafts, which can be easily added to existing (either when the target enters the aura on its turn or when

stat blocks to create new creatures or variants of existing it begins its turn in the aura, whichever comes first). If the

creatures. For more information on using template grafts, see aura deals damage, it damages a target only the first time

page 141 of the Starfinder Alien Archive. the target is in the aura each round, regardless of how many

times within the round the target enters and leaves the aura.

Template Graft Page A creature can suppress its aura for 1 round as a move action

Abysium Dragon (CR 3+) 23 unless noted otherwise.

Adamantine Dragon (CR 3+) 23 Format: Aura radiation (30 ft., Fortitude DC 17); if

Animated Armor 7 additional information is needed, the aura also has an entry

Driftdead (CR 1+) 27 in Special Abilities.

Driftdead Amalgam (CR 7+) 27
Flayer Leech Effigy (CR 5+)
37 Breath Weapon (Su)

Horacalcum Dragon (CR 3+) 23 As a standard action, the creature can exhale a cone or

Mind-Swapped 137 line of energy or another magical effect. A breath weapon

Noqual Dragon (CR 3+) 23 attack usually deals damage, and it is often energy-based.

Siccatite Dragon (CR 3+) 23 A breath weapon usually allows a target to attempt a

Tsukumogami 63 Reflex saving throw for half damage, though some breath

Vorthuul (CR 6+) 129 weapons require a successful Fortitude or Will save

16651307 instead. A creature is immune to its own breath weapon 4254511
APPENDIX 3: UNIVERSAL CREATURE RULES 16651307
and the breath weapons of others of its kind unless

The following are special abilities you can select when creating otherwise noted. Each breath weapon also indicates how

a creature, many of which appear in the various aliens of this often it can be used.

book. Most rules have a format entry that gives an example Format: Offensive Abilities breath weapon (60-ft. cone,

of how the rule appears in a stat block. Many also have a 8d6 F, Reflex DC 18 half, usable every 1d4 rounds); if the

guidelines entry to help GMs who are adding the ability to breath weapon has more complicated effects, it also has an

new creatures determine its damage or other values. If an entry in Special Abilities.

ability allows a saving throw, the save DC is determined by Guidelines: 1d6 damage + 1d6 per CR, usable once every 1d4

the CR of the creature using it (see the arrays starting on page rounds. A cone is usually 30 feet long, increasing by 10 feet

129 of the Starfinder Alien Archive). for every size category above Medium or decreasing by 5 feet

Amphibious (Ex) for every size category below Medium. A line is twice as long
as a cone would be.

The creature has the aquatic subtype or water breathing (see Compression (Ex)
page 155), but it can breathe air and survive on land.

Format: Other Abilities amphibious. The creature can move through an area as small as

Attach (Ex) one-quarter of its space without squeezing or one-eighth its
space when squeezing.

The creature can attempt a special attack against KAC as a Format: Other Abilities compression.

standard action. If it succeeds, it deals no damage, but the Construct Immunities (Ex)
creature adheres to its target. Once attached, the creature

gains a +4 bonus to its AC (from cover) and a +2 circumstance Constructs are immune to the following effects, unless the

bonus to melee attacks, but it can attack only the creature effect specifies that it works against constructs.

to which it is attached. An attached creature can’t move D Bleed, death effects, disease, mind-affecting effects,

on its own (though it moves with its target), take actions necromancy effects, paralysis, poison, sleep, and

that require two hands, or make attacks of opportunity. stunning.

An attached creature can be removed with a successful D Ability damage, ability drain, energy drain, exhaustion,

Strength check (DC = 10 + 1-1/2 × the creature’s CR) made fatigue, negative levels, and nonlethal damage.

150 ALIEN ARCHIVE 3

16651307 paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

4254512
4254512

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

D Any effect that requires a Fortitude save (unless the effect Fast healing does not restore Hit Points lost from starvation,

works on objects or is harmless). thirst, or suffocation, nor does it allow a creature to regrow or

Format: Immunities construct immunities. reattach lost body parts, unless otherwise stated. Fast healing APPENDIXES

Crush (Ex) continues to function until a creature dies, at which point the
effects of fast healing end immediately.

When ending a flying or jumping movement, the creature Format: Defensive Abilities fast healing 5.

can land on targets that are at least three size categories Ferocity (Ex)
smaller than itself. Targets are automatically knocked prone,

take the listed damage, and are pinned. Each crushed target When the creature is brought to 0 Hit Points, it can fight on for

can attempt to escape the pin normally on its turn, and the 1 more round. It can act normally until the end of its next turn;

pin ends automatically if the crushing creature moves out of if it has 0 Hit Points at that point, it dies. If it would lose further

the target’s square. A crushed target does not take damage Hit Points before this, it ceases to be able to act and dies.

from the crush more than once, unless the crushing creature Format: Defensive Abilities ferocity.

moves fully off that creature and then back onto it. Fly (Ex or Su)
Format: Offensive Abilities crush (4d6+8 B).

Guidelines: Use the same damage amount as for the The source of the creature’s fly speed (whether extraordinary,

creature’s standard melee attack. supernatural, or from another source such as an item) is noted

Detect Alignment (Sp or Su) before its maneuverability. Unless otherwise noted, a creature
whose ability to fly is extraordinary can’t fly in a vacuum.

The creature can detect the alignment of another creature. Format: Speed fly 60 ft. (Ex, perfect).

This functions as detect magic, but rather than determining

which creatures and objects in the area are magical, the Frightful Presence (Ex or Su)

creature can determine one other creature’s alignment. The creature’s presence unsettles its foes. It can activate

Format: Senses detect alignment. this ability as part of the action of making an attack or as

Engulf (Ex) a move action, but it can activate it only once per round.
It usually has a range of 30 feet. Opponents within the

16651308 As a standard action, the creature can move up to its speed, range must succeed at a Will save or become shaken. The 4254512

moving into or through the space of any creatures that are duration is 5d6 rounds unless the ability says otherwise.

at least one size smaller than itself without penalty. Every Once an opponent has been exposed to a creature’s frightful

creature in the engulfing creature’s path is automatically presence (whether or not the opponent succeeds at its

engulfed, with no attack roll needed. A targeted creature can saving throw), it cannot be affected by the same creature’s

attempt a Reflex saving throw to avoid being engulfed; if it frightful presence for 24 hours. This is an emotion, fear,

attempts this save, it can’t make an attack of opportunity mind-affecting, and sense-dependent effect.

against the engulfing creature due to that creature’s Format: Aura frightful presence (30 ft., Will DC 22).

movement. On a successful save, the target is pushed back or Gaze (Su)
aside (target’s choice) as the engulfing creature continues to

move. An engulfed creature gains the pinned condition, takes Opponents that look at a creature with a gaze ability are

the listed damage at the beginning of each turn it is engulfed, in danger of being charmed, paralyzed, turned to stone, or

is in danger of suffocating if it doesn’t have environmental subjected to another negative effect. Each opponent within

protections, and is trapped within the engulfing creature’s the gaze’s listed range must attempt a saving throw (usually

body until it is no longer pinned. An engulfed creature moves Fortitude or Will) at the beginning of its turn. On a successful

with the engulfing creature; this movement does not provoke save, the effect is negated. An opponent can give itself an

attacks of opportunity against the engulfed creature. A advantage against this ability in one of two ways.

creature can engulf one creature that is one size smaller than Looking Obliquely: An opponent that avoids looking

itself, up to two creatures that are two sizes smaller, or up to directly at the creature’s gaze (either by following the

four creatures that are three sizes smaller. creature’s shadow or by tracking it in a reflective surface)

Format: Offensive Abilities engulf (1d6+8 F, DC 13). or that looks at the creature through a camera or heads‑up

Guidelines: Use the same damage amount as for the display gains a +4 circumstance bonus to the saving

creature’s standard melee attack. throw. However, the creature with the gaze ability gains

Fast Healing (Ex) concealment against that opponent.
Blocking Its Vision: By completely blocking or covering its

The creature regains the listed number of Hit Points at the own visual sensors, an opponent doesn’t need to attempt a

start of its turn. Unless otherwise noted, the creature can save against the gaze. However, the creature with the gaze

never exceed its maximum Hit Points. ability gains total concealment against that opponent.

APPENDIXES 151

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651308
16651308

4254513
4254513

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

A Gaze abilities can affect ethereal opponents but not Limited Plant Benefits (Ex)
opponents without visual sensors. A creature is immune to
Despite being a plant creature, the creature doesn’t gain

the gaze abilities of others of its kind unless otherwise noted. the standard immunities associated with creatures of the

Allies of a creature with a gaze ability can still be affected, plant type. Instead, a creature with this ability gains a

but they are always considered to be looking obliquely at the +2 racial bonus on saving throws against mind-affecting

creature. The creature can also veil its eyes, thus negating its effects, paralysis, poison, polymorph, sleep, and stunning

gaze ability. effects, unless the effect specifies that it is effective

Format: Offensive Abilities paralyzing gaze (60 ft., Will against plants.

DC 14). Format: Defensive Abilities limited plant benefits.

Grab (Ex) Mindless (Ex)

If the creature hits with the indicated attack (usually a claw The creature has no Intelligence score or modifier and is

or bite attack), it deals the normal damage. If the attack roll immune to mind-affecting effects. Any DCs or other statistics

result equals or exceeds the target’s KAC + 4, the creature also that rely on an Intelligence score treat the creature as having

automatically grapples the foe. (If it equals or exceeds the a score of 10 (+0).

target’s KAC + 13, the creature instead pins the target.) The Format: Other Abilities mindless.

creature does not need to have a spare limb free to perform Guidelines: Mindless creatures usually have fewer good

this grapple as long as it can make the listed attack, and it can skills and no master skills. Their skills should be based on

potentially grapple more than one target if it has more than inborn abilities, since they’re incapable of training.

one attack with the grab ability. The creature can maintain Multiarmed (Ex)
the grab either with another successful grab attack or by

performing the grapple combat maneuver normally. The creature has the number of arms listed. This allows it

Format: Melee claw +8 (1d6+4 plus grab). to wield and hold up to that many hands’ worth of weapons

Immunity (Ex or Su) and equipment. While this increases the number of items
it can have at the ready, it doesn’t increase the number of

The creature takes no damage from the listed source. attacks it can make during combat.

16651309 Creatures can be immune to certain types of damage, types Format: Other Abilities multiarmed (4). 4254513
16651309
of afflictions, conditions, spells (based on school, level, or save Multiattack (Ex)
type), and other effects. A creature that is immune to critical

hits doesn’t take double damage or suffer critical hit effects. A In addition to its standard melee or ranged attack, the

creature that is immune to a listed source doesn’t suffer from creature has a multiattack entry. When making a full

its effects or from any secondary effects that it would trigger. attack, the creature can make all the attacks listed in the

Format: Immunities acid, paralysis. multiattack entry at the attack bonuses listed, rather than

Guidelines: A creature usually has one immunity, plus make two attacks. It can make the attacks in any order.

one for every 5 CR. Broad immunities such as immunity to Format: Multiattack bite +10 (1d4+11), 2 claws +10

mind‑affecting effects or all magic should be chosen with (1d4+11).

caution and might count as multiple abilities. Guidelines: Use the appropriate damage column for the

Integrated Weapons (Ex) creature’s array for all attacks in the multiattack, and impose
a –6 penalty on these attacks (rather than the usual –4

The creature’s weapons are manufactured weapons, not penalty for a full attack).

natural weapons, and they are integrated into its frame. A Natural Weapons (Ex)
creature can’t be disarmed of these weapons, though they can

be removed and used if the creature is dead. Natural weapons (and natural attacks), such as acid spit, bite,

Format: Defensive Abilities integrated weapons. claw, or slam, don’t require ammunition and can’t be disarmed

Guidelines: A manufactured weapon is a weapon with an or sundered.

item level that can be purchased by characters, such as those In addition, a player character with this ability as a racial

found on the tables beginning on page 171 of the Starfinder trait is always considered armed. They can deal 1d3 lethal

Core Rulebook. damage (of the listed type, or bludgeoning if no type is

Light Blindness (Ex) specified) with unarmed strikes, and the attack doesn’t have
the archaic special property. They also gain a unique Weapon

The creature is blinded for 1 round when first exposed to Specialization with their natural weapons at 3rd level,

bright light, such as sunlight, and it is dazzled for as long as it allowing them to add 1-1/2 × their character level to their

remains in an area of bright light. damage rolls for their natural weapons (instead of just adding

Format: Weaknesses light blindness. their character level, as usual).

152 ALIEN ARCHIVE 3

16651309 paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

4254514
4254514

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

No Breath (Ex) can regrow lost portions of their bodies and can reattach

The creature doesn’t breathe, and it is immune to effects severed body parts if they are recovered within 1 hour of

that require breathing (such as inhaled poison). This does severing. Severed parts that aren’t reattached wither and APPENDIXES

not give it immunity to cloud or gas attacks that don’t decompose normally.

require breathing. A creature usually must have a Constitution score or

Format: Other Abilities no breath. modifier to have this ability.

Ooze Immunities (Ex) Format: Defensive Abilities regeneration 5 (acid).

Oozes are immune to the following effects, unless the effect Resistance (Ex)

specifies that it works against oozes. The creature ignores some damage of a certain type (acid,

D Critical hits, paralysis, poison, polymorph, sleep, and cold, electricity, fire, or sonic) per attack, but it does not

stunning. have total immunity. See page 264 of the Core Rulebook for

D Gaze abilities, illusions, visual effects, and other attacks more details.

that rely on sight. Format: Resistances acid 10.

D Flanking—oozes are unflankable. Sightless (Ex)
Format: Immunities ooze immunities.

Plant Immunities (Ex) The creature does not use any visual senses and is thus
never subject to any effect that requires the creature to see

Plants are immune to the following effects, unless the effect a target or effect. Sightless creatures normally have some

specifies it works against plants. form of blindsight to compensate for their sightlessness, but

D Mind-affecting effects, paralysis, poison, polymorph, sleep, if not, they are assumed to be able to operate as well as a

and stunning. creature with normal vision unless the creature’s description

Format: Immunities plant immunities. says otherwise.

Plantlike (Ex) Format: Senses sightless.

For effects targeting creatures by type, plantlike creatures Spaceflight (Su)

16651310 count as both their type and plants (whichever type allows The creature can fly through space at standard navigation 4254514

an ability to affect them for abilities that affect only one and astrogation speeds (Core Rulebook 290) using Piloting to

type, and whichever is worse for abilities that affect both navigate. If it uses a skill other than Piloting for skill checks

types). They also receive a +2 racial bonus to saving throws to astrogate, that skill is listed in parentheses.

against mind-affecting effects, paralysis, poison, polymorph, Format: Other Abilities spaceflight (Mysticism).

sleep, and stunning, unless the effect specifies that it works Guidelines: Most creatures with spaceflight also have void

against plants. adaptation (see page 155).

Format: Other Abilities plantlike. Spider Climb (Ex)

Radioactive (Ex, Su) The creature can climb as though affected by the spell

The creature emanates radiation (Starfinder Core Rulebook spider climb.

403) at the listed radiation level to the listed radius. If the Format: Speed spider climb.

radiation level is medium or stronger, the effect suffuses a Stellar Alignment (Su)

larger area at a lower level as normal.

Format: Aura radioactive (medium, 20 ft., DC 17). The creature is aligned to the cycles of solar systems.

Regeneration (Ex) Creatures with stellar alignment usually have stellar
revelations and zenith revelations, either ones from the

The creature regains Hit Points at the start of its turn, as solarian class or ones unique to the creature. When using

with fast healing (see page 151), but it can’t die as long as stellar revelations, the creature is always considered

its regeneration is still functioning (although creatures with attuned. However, it’s not always considered fully attuned,

regeneration still fall unconscious when their Hit Points so it normally can’t always use zenith powers. When you roll

reach 0). Certain attacks, typically those that deal acid or fire initiative for the creature, roll 1d3. Once that many rounds

damage, cause a creature’s regeneration to stop functioning have elapsed, the creature is considered fully attuned and

for 1 round. During this round, the creature doesn’t regain gains access to its zenith powers. After it uses a zenith

Hit Points and can die normally. The creature’s stat block power, it’s no longer fully attuned, and you roll 1d3 again to

describes the types of damage that suppress the regeneration. see how many rounds it will take to recharge.

Regeneration doesn’t restore Hit Points lost from If a creature has stellar alignment (graviton) or stellar

starvation, thirst, or suffocation. Creatures with regeneration alignment (photon), it’s considered to be attuned only in the

APPENDIXES 153

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651310
16651310

4254515
4254515

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

A indicated mode and can become fully attuned only in the movements of antennae and limbs, electrostatic fields,
indicated mode, as described above. and telepathic communication. All Swarm creatures with

Format: Other Abilities stellar alignment (graviton). 30 feet of each other are in constant communication; if one

Swallow Whole (Ex) is aware of a threat, all are. (Such awareness can spread
along a “chain” of Swarm creatures under appropriate

If the creature hits with the indicated attack (usually a bite circumstances, potentially alerting distant Swarm creatures).

attack), it deals the normal damage. If the creature’s attack In addition, once per round when within 30 feet of another

roll hits the target’s KAC + 4, the creature also automatically Swarm creature, a Swarm creature can roll twice and

grapples the foe as part of the attack action. (If it hits the take the better result on a saving throw against a mind-

target’s KAC + 13, it instead pins the target). The creature affecting effect.

doesn’t need to have a free limb to perform this grapple. Format: Defensive Abilities Swarm mind.

Unless otherwise specified, a creature can swallow whole Tracking (Ex)
only targets that are at least one size category smaller than

itself, and it has room for a single target of that size in its The creature can use the Perception skill to perform the

stomach (doubling the maximum number of creatures it can follow tracks task of the Survival skill with the listed

have swallowed for each additional size category by which sense. The sense is usually related to a type of signature

these creatures are smaller). that most creatures leave behind, such as a scent or

On the creature’s next turn after grappling or pinning heat trail. The creature might gain a bonus or penalty to

the target, if the target has not escaped the grapple or pin, its Perception check to follow tracks depending on the

the target automatically takes the attack’s damage at the strength of the quarry’s signature, at the GM’s discretion.

beginning of the creature’s turn. The creature can then make It is possible for stronger signatures to completely mask

a new attack roll with the same attack. If the roll equals or other signatures, making following tracks with a weaker

exceeds the target’s KAC, the grapple or pin is maintained. If signature very difficult.

the roll equals or exceeds the target’s KAC + 4, the target is Format: Other Abilities tracking (scent).

swallowed whole (no damage is dealt). Trample (Ex)
Once swallowed, the target takes the listed swallow

16651311 whole damage automatically at the beginning of its turn As a full action, the creature can move up to its speed and 4254515
16651311
every round. The target is considered grappled as long through the space of any creatures that are at least one size

as it is swallowed. The target can attempt to cut its way smaller than itself. The creature does not need to make an

out (the interior of a creature with swallow whole has the attack roll; each creature whose space it moves through takes

same EAC as its exterior and a KAC equal to that of its damage. A target of a trample can attempt a Reflex save with

exterior – 4) by dealing an amount of damage equal to one- the listed DC to take half damage; if it attempts the save, it

quarter the swallowing creature’s total Hit Points, though can’t make an attack of opportunity against the trampling

any attack that does not deal slashing damage deals only creature due to the creature’s movement. A creature can deal

half its normal damage. If a target cuts its way out of the trample damage to a given target only once per round.

creature, the creature cannot use swallow whole again until Format: Offensive Abilities trample (3d4+14 B, DC 16).

that damage is healed. Guidelines: The amount of damage the trample deals should

Alternatively, a target swallowed whole can attempt to be the same as the creature’s standard melee damage.

climb out. The swallowed creature must succeed at both a Truespeech (Su)
grapple check against the creature’s internal KAC + 8 and

an Athletics check to climb (DC = 10 + 1-1/2 × the creature’s The creature can speak with any other creature that has a

CR). Each of these actions takes a full round. If both checks language. This ability is always active.

are successful, the target climbs back up to the creature’s Format: Languages truespeech.

mouth and can escape, ending up in an open square adjacent Undead Immunities (Ex)

to the creature.

Format: Melee bite +19 (5d4+16 P plus swallow whole); Undead are immune to the following effects, unless the effect

Offensive Abilities swallow whole (5d4+16 A, EAC 30, specifies it works against undead creatures.

KAC 27, 71 HP). D Bleed, death effects, disease, mind-affecting effects,

Guidelines: Use the same damage amount as for the paralysis, poison, sleep, and stunning.

creature’s standard melee attack. D Ability damage, ability drain, energy drain, exhaustion,

Swarm Mind (Ex) fatigue, negative levels, and nonlethal damage.
D Any effect that requires a Fortitude save (unless the effect

Members of the Swarm are bound together into a singular works on objects or is harmless).

hive mind by a blend of exuded pheromones, imperceptible Format: Immunities undead immunities.

154 ALIEN ARCHIVE 3

16651311 paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

4254516
4254516

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

Unflankable (Ex) 2: cephalume, driftdead, ferrofluid ooze, hortus, telia, time

Flanking the creature does not grant any bonuses, and eater (Drift native), varculak marauder

abilities that function only against a creature that is flanked 3: albedo lucandrian, brenneri sage, morlamaw, skreeling APPENDIXES

do not function against it. (skreesire), stridermander, weaponized devil-in-a-box

Format: Defensive Abilities unflankable. (weaponized toy), wolliped

Unliving (Ex) 4: dirindi monster hunter, espraksa performer, flayer leech,
hobkins gremlin malefactor, ijtikri commando, izalguun

The creature has no Constitution score or modifier. Any hunter, raxilite bioengineer, shatori analyst, tsukumogami

DCs or other statistics that rely on a Constitution score (kami), vracinea

treat the creature as having a score of 10 (+0). The creature 5: animated lictor Hellknight plate (animated armor), diatha

is immediately destroyed when it reaches 0 Hit Points. An elder, dromada vigilant, guardian robot, irokiroi, jinsul

unliving creature doesn’t heal damage naturally, but a base commander, lurker in light, sazaron scholar, shimreen

construct can be repaired with the right tools. Spells such as warrior, troll

make whole can heal constructs, and magic effects can heal 6: brenneri ambassador, dessamar theurgist, neutronium

undead. An unliving creature with fast healing (see page 151) golem, paraforan fragment, rogue hover drone, weaponized

still benefits from that ability. Unliving creatures don’t gamedroid (weaponized toy)

breathe, eat, or sleep. They can’t be raised or resurrected, 7: defrex juvenile, hound of Tindalos, philosopher worm,

except through the use of miracle, wish, or a similar effect shakalta star-guardian, skreesire, telia raconteur

that specifically works on unliving creatures. 8: diaspora wyrm, iridia (spectra), izalguun healer, living

Format: Other Abilities unliving. hologram, soulstone hunter (hanakan), thorgothrel

Void Adaptation (Ex or Su) 9: alural war wolliped, equinoxian periastra, morlamaw mayor,
perigiean lucandrian, yithian

Numerous creatures are inured to the void of outer space. A 10: Drift architect (Drift native), kothama, shatori theorist,

creature with void adaptation has the following abilities. stridermander tyrant, vorthuul

D Immunity to cosmic rays. 11: defrex, hortinarch (hortus), spathinae explorer, Swarm

D Immunity to the environmental effects of vacuum. dissolver

16651312 D No breath (see page 153). 12: ferrofluid magneto-cluster (ferrofluid ooze), oshirokiroi 4254516

Format: Defensive Abilities void adaptation. (irokiroi), paraforan, sazaron sage, valkyrie, varculak noble

Vulnerability (Ex or Su) 13: dirindi fabulist, driftdead amalgam, oracle of Oras, tripod,
yithian elder

The creature takes half again as much damage (+50%) 14: kothama ascendant, lightweaver (lurker in light), rogue

when it takes damage of a specific type. Creatures with a combat drone, time dimensional, void troll

vulnerability to an effect that doesn’t deal damage instead 15: equinoxian apastra, flayer leech effigy, mature adult

take a –4 penalty to saves against spells and effects that horacalcum dragon, quantum slime

cause or use the listed vulnerability (such as enchantments). 16: animated lashunta mind mail III (animated armor),

Some creatures might suffer additional effects, as noted in chinjugami (kami), philosopher worm teleologarch, Swarm

their stat blocks. xersk

Format: Weaknesses vulnerable to fire. 17: diaspora wyrm sage, formian queen, tekenki, thing from

Water Breathing (Ex) beyond time (hound of Tindalos)
18: aspecna (spectra), keeper robot

The creature can breathe water. It can’t breathe air unless it 19: tzitzimitl

has the amphibious special ability (see page 150). 25: rendalairn

Format: Other Abilities water breathing. Starships: Tier 2: swarming telelith; Tier 4: giant space

APPENDIX 4: CREATURES BY CR tardigrade; Tier 10: blinking telelith; Tier 15: gwahled

The following section lists creatures in this book by CR and APPENDIX 5: CREATURES BY TYPE

alphabetically. In the case of templates, only the creature Listed below are all the creatures in this book, organized

presented with a full stat block is included. A list of starship alphabetically by type or subtype. Starship stat blocks are

stat blocks (and their respective tiers) is provided at the end. also listed here.

1/2: diatha, dromada, espraksa, hobkins gremlin, ijtikri, Aberration: cephalume, ijtikri, ijtikri commando, skreeling
raxilite researcher (skreesire), skreesire, yithian, yithian elder

1: dessamar imago, hanakan attendant, jinsul warrior, Animal: alural war wolliped, defrex, defrex juvenile, irokiroi,
shimreen worker, spathinae guard oshirokiroi (irokiroi), wolliped

APPENDIXES 155

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651312
16651312

4254517
4254517

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

A Any TerrainConstruct (magical): rendalairn
Construct (magical, technological): animated lashunta mind
animated lashunta mind mail III (animated armor), animated

mail III (animated armor), animated lictor Hellknight plate lictor Hellknight plate (animated armor), brenneri ambassador,

(animated armor), neutronium golem, tekenki, weaponized brenneri sage, cephalume, chinjugami (kami), dessamar imago,

gamedroid (weaponized toy) dessamar theurgist, dirindi fabulist, dirindi monster hunter,

Construct (technological): guardian robot, keeper robot, living driftdead, driftdead amalgam, dromada, dromada vigilant,

hologram, rogue combat drone, rogue hover drone, tripod, equinoxian apastra, equinoxian periastra, espraksa, espraksa

weaponized devil-in-a-box (weaponized toy) performer, ferrofluid ooze, guardian robot, hanakan attendant,

Dragon: mature adult horacalcum dragon hobkins gremlin, hobkins gremlin malefactor, hortinarch

Fey: albedo lucandrian, hobkins gremlin, hobkins gremlin (hortus), hortus, hound of Tindalos, ijtikri, ijtikri commando,

malefactor, gwahled (starship), lightweaver (lurker in light), izalguun healer, izalguun hunter, jinsul base commander,

lurker in light, perigean lucandrian jinsul warrior, kothama, kothama ascendant, living hologram,

Humanoid: brenneri ambassador, brenneri sage, dessamar mature adult horacalcum dragon, neutronium golem, oracle

imago, dessamar theurgist, dirindi fabulist, dirindi of Oras, philosopher worm, philosopher worm teleologarch,

monster hunter, espraksa, espraksa performer, shakalta quantum slime, raxilite bioengineer, raxilite researcher,

star-guardian, shatori analyst, shatori theorist, shimreen rendalairn, rogue combat drone, rogue hover drone, sazaron

warrior, shimreen worker, troll, void troll sage, sazaron scholar, shakalta star-guardian, shatori

Incorporeal: living hologram analyst, shatori theorist, shimreen warrior, shimreen worker,

Magical Beast: blinking telelith, diaspora wyrm, diaspora soulstone hunter (hanakan), spathinae explorer, spathinae

wyrm sage, dromada, dromada vigilante, giant space guard, stridermander, stridermander tyrant, Swarm dissolver,

kothama, kothama ascendant, tardigrade, hanakan Swarm xersk, tekenki, telia, telia raconteur, thing from beyond

attendant, soulstone hunter (hanakan), swarming time (hound of Tindalos), thorgothrel, time dimensional,

telelith tripod, troll, tsukumogami (kami), tzitzimitl, valkyrie, varculak

Monstrous Humanoid: flayer leech effigy, formian queen, marauder, varculak noble, void troll, weaponized devil-in-a-

izalguun healer, izalguun hunter, jinsul base commander, box (weaponized toy), weaponized gamedroid (weaponized

jinsul warrior, morlamaw, morlamaw mayor, philosopher toy), yithian, yithian elder

16651313 worm, philosopher worm teleologarch, sazaron sage, 4254517
16651313
Any Landsazaron scholar, spathinae explorer, spathinae guard,

stridermander, stridermander tyrant, Swarm dissolver, diatha, diatha elder, flayer leech, flayer leech effigy, formian

Swarm xersk, telia, telia raconteur queen, keeper robot

Ooze: ferrofluid magneto-cluster (ferrofluid ooze), ferrofluid The Drift
ooze, quantum slime, thorgothrel

Outsider: aspecna (spectra), Drift architect (Drift native), aspecna (spectra), blinking telelith, Drift architect (Drift

equinoxian apastra, equinoxian periastra, iridia (spectra), native), driftdead, driftdead amalgam, iridia (spectra),

paraforan, paraforan fragment, time dimensional, time paraforan, paraforan fragment, swarming telelith, time eater

eater (Drift native), valkyrie (Drift native)

Outsider (evil): hound of tindalos, thing from beyond time Forests
(hound of Tindalos)

Outsider (native): chinjugami (kami), tsukumogami (kami) defrex, defrex juvenile, vracinea

Plant: hortinarch (hortus), hortus, oracle of Oras, raxilite Hills and Mountains
bioengineer, raxilite researcher, vracinea

Starship: blinking telelith, giant space tardigrade, gwahled, alural war wolliped, defrex, defrex juvenile, wolliped

swarming telelith Lunar
Undead: driftdead, driftdead amalgam, tzitzimitl, varculak

marauder, varculak noble, vorthuul albedo lucandrian, perigean lucandrian

Vermin: diatha, diatha elder, flayer leech Plains

APPENDIX 6: CREATURES BY TERRAIN alural war wolliped, wolliped

The following list groups the creatures in this book into Sky
the environments or terrain type where they are most

commonly encountered. irokiroi, oshirokiroi (irokiroi)

This list is a guide only, and a creature can appear outside Underground
the listed terrain in appropriate circumstances determined

by the GM. formian queen

156 ALIEN ARCHIVE 3

16651313 paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

4254518
4254518

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

Urban Castrovel

ferrofluid magneto cluster (ferrofluid ooze), lightweaver Formian Alien Archive 50, Alien Archive 2 52, page 38

(lurker in light), lurker in light Khizar Pact Worlds 212 APPENDIXES
Ksarik Alien Archive 70
Vacuum Mountain eel Alien Archive 78

blinking telelith, giant space tardigrade, gwahled, paraforan, Nyssholora Alien Archive 2 86

paraforan fragment, swarming telelith, vorthuul Ruthig Alien Archive 2 75

Water Shotalashu Alien Archive 2 114
Tashtari Alien Archive 2 124

diaspora wyrm, diaspora wyrm sage, morlamaw, morlamaw Vracinea page 130

mayor Diaspora page 16

APPENDIX 7: CREATURES BY PACT WORLD Diaspora wyrm

The following list groups creatures from Alien Archive volumes Sarcesian Alien Archive 98

and Starfinder Pact Worlds by the worlds on or near which Surnoch Alien Archive 108

they’re most commonly encountered. If a creature is associated Eox
with a world’s moon, that is listed in parentheses.

This list is a guide only; countless creatures can be found Bone trooper Alien Archive 2 22

on these worlds, especially playable races, including those Borai Pact Worlds 211

presented in the Core Rulebook. In addition, virtually all of Corpsefolk Alien Archive 2 30

these creatures­can be found on worlds throughout the galaxy. Ellicoth Alien Archive 48

Aballon Ghoul Alien Archive 2 60
Glass Serpent Alien Archive 2 64

Anacite Alien Archive 10, Alien Archive 2 10 Necrovite Alien Archive 80

Sharpwing Alien Archive 102
SRO
Pact Worlds 213 Liavara

Tripod 16651314 page 118 Bantrid (Hibb) Pact Worlds 210 4254518

Absalom Station Dirindi (Arkanen, Osoro) page 20
Dreamer Alien Archive 2 44

Nuar Alien Archive 86 Hallajin (Hallas) Alien Archive 60

Space goblin Alien Archive 54 Irokiroi (Osoro) page 56

Akiton Philosopher worm (Nchak) page 78
Sazaron (Arkanen) page 90

Contemplative Alien Archive 28 Trox (Nchak) Alien Archive 2 126

Ikeshti Alien Archive 64
Khefak
Alien Archive 2 78 Triaxus

Shobhad Alien Archive 104 Dragonkin Alien Archive 40

Apostae Ryphorian Alien Archive 96
Wolliped page 134

Drow Alien Archive 42 Verces
Orc Alien Archive 2 90

Void hag Alien Archive 120 Bloodbrother Alien Archive 23

Aucturn Dust manta Alien Archive 2 46
Strix Pact Worlds 214

Bryrvath Alien Archive 24 Verthani Alien Archive 118

Orocoran Alien Archive 90 APPENDIX 8: RULES OPTIONS

Bretheda The following list indexes all of the rules options found in this

Barathu Alien Archive 20 book, including creature companions, equipment, feats, and more.

Haan Alien Archive 58

Kalo (Kalo-Mahoi) Alien Archive 69 Rules Option Page

Maraquoi (Marata) Alien Archive 74 acceptance (drug) 47

Urog (Dykon) Alien Archive 116 angel frame (powered armor) 125

Vortex shark (Kalo-Mahoi) Alien Archive 2 103 brenneri stone (magic item) 9

APPENDIXES 157

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651314
16651314

4254519
4254519

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

A Combat-Trained Mount (feat) 140 pheromone grenade 131
Creature Companion Adept (feat) 140 proog (creature companion) 144

Creature Companion Expert (feat) 140 psychic inhibitor (magic item) 39

Creature Companion Master (feat) 140 riding saddle (personal item) 147

Creature Companion Virtuoso (feat) 140 seismic spine (magitech augmentation) 85

darkwater grenade 17 shimmerstone staff (weapon) 65

decoupler grenade 119 shotalashu (creature companion) 145

defrex hide armor 13 sophic philter (magic item) 79

diatha ammunition 19 superposition belt (technological item) 81

dimensional anchor (spell) 53 tashtari (creature companion) 145

draserka (creature companion) 143 telelith gambit (starship pilot stunt) 111

dromada clutch (hybrid item) 29 telelith matrix (starship expansion) 111

echolocation detection unit (armor upgrade) 57 temporal crystal (magic item) 117

EMP weapon fusion 109 thakasa (creature companion) 146

empathnid (creature companion) 143 thorgothrel armature (cybernetic augmentation) 115

entanglement badges (technological item) 81 tzibeam (starship weapon) 123

environmental field collar (technological item) 147 vandal rocket launcher (starship weapon) 61

eshar (creature companion) 144 void hide (armor) 121

ferrofluid suspension (armor upgrade) 35 vorac (creature companion) 146

flux fig (magic item) 75 water bear (vehicle) 41

hardlight hand wrap (weapon) 67 wolliped (creature companion) 146

lightveiled weapon fusion 71 yasakaja (creature companion) 147

machine telepathy cluster (augmentation) 103
mind swap (spell)
137 APPENDIX 9: PLAYABLE RACES

moon crystal (magic item) 69 Listed below are the creatures in this book that include racial

Mounted Expert (feat) 140 traits that PCs can use to build characters of these races. Also

16651315 nanite patch (technological item) 89 included are some basic ranges to help determine the height, 4254519
16651315
neutronium shell (armor upgrade) 43 weight, and age of a member of that species. While most

pachycephalosaurid (creature companion) 144 characters fall somewhere in the middle of the range for their

paraforan resonator (starship system) 77 species, some exceptional individuals may be larger or smaller.

Periastra Training (feat) 31 For more information on vital statistics, see page 41 of the

pet carrier (armor upgrade) 147 Starfinder Core Rulebook.

VITAL STATISTICS BY RACE

RACE PAGE AVG. HEIGHT OR LENGTH AVG. WEIGHT AGE OF MATURITY MAXIMUM AGE
100 to 200 lbs. 10 years 60+3d10 years
Brenneri 8 4-1/2 to 5-1/2 ft. 200 to 400 lbs. 12 years 70+2d10 years
5 years 50+2d20 years
Cephalume 10 5-1/2 to 6-1/2 ft. 45 to 80 lbs. 5 years 50+2d20 years
30 to 50 lbs. 25 years 100+1d% years
Dessamar imago 14 4-1/2 to 5-1/2 ft. 100 to 180 lbs. 3 years 30+2d20 years
150 to 250 lbs. 20 years 90+2d20 years
Dessamar instar 14 3 to 3-1/2 ft. 125 to 200 lbs. 5 years 30+1d20 years
10 to 40 lbs. 10 years 40+1d20 years
Dirindi 20 4-1/2 to 5 ft. 150 to 250 lbs. 2 years 40+2d20 years
80 to 160 lbs. 15 years 90+2d20 years
Dromada 28 4-1/2 to 5-1/2 ft. 800 to 1,000 lbs. 16 years 85+2d20 years
1,800 to 3,000 lbs. 1 year 70+3d10 years
Espraksa 32 7 to 8 ft. 13 years 100+1d% years
1 to 6 lbs. 3 years 500+5d% years
Hanakan 48 2 to 3 ft. 700 to 1,100 lbs. —
25 years —
Hortus 50 4 to 5 ft. 75 to 125 lbs. 2 years 200+2d% years
125 to 250 lbs. 50 years 50+1d% years
Ijtikri 54 5 to 6 ft. 550 to 800 lbs. 0 years 950+4d% years
50 to 80 lbs. 350+3d% years
Izalguun 58 6 to 8 ft. 100 to 300 lbs.
25 to 400 lbs.
Morlamaw 72 10 to 12 ft.

Raxilite 82 1 to 1–1/2 ft.

Sazaron 90 12 to 18 ft.

Shakalta 92 5-1/2 to 7-1/2 ft.

Shatori 94 6 to 7 ft.

Shimreen 96 6-1/2 to 7-1/2 ft.

Spathinae 100 5 to 6 ft.

Telia 112 4 to 5 ft.

Varculak 126 2-1/2 to 8 ft.

158 ALIEN ARCHIVE 3

16651315 paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

4254520
4254520

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALIEN ARCHIVE 3

PAIZO INC. Director of Sales • Pierce Watters APPENDIXES
Sales Associate • Cosmo Eisele
Creative Directors • James Jacobs, Robert G. McCreary, and Vice President of Marketing & Licensing • Jim Butler
Sarah E. Robinson Marketing Manager • Dan Tharp
Licensing Manager • Glenn Elliott
Director of Game Design • Jason Bulmahn Public Relations Manager • Aaron Shanks
Managing Developers • Adam Daigle and Amanda Hamon Customer Service & Community Manager • Sara Marie
Organized Play Lead Developer • John Compton Operations Manager • Will Chase
Developers • Eleanor Ferron, Jason Keeley, Luis Loza, Ron Lundeen, Organized Play Manager • Tonya Woldridge
Human Resources Generalist • Angi Hodgson
Joe Pasini, Patrick Renie, Michael Sayre, Chris S. Sims, and Data Entry Clerk • B. Scott Keim
Linda Zayas-Palmer Director of Technology • Raimi Kong
Starfinder Design Lead • Owen K.C. Stephens Web Production Manager • Chris Lambertz
Starfinder Society Developer • Thurston Hillman Senior Software Developer • Gary Teter
Senior Designer • Stephen Radney-MacFarland Customer Service Team • Katina Davis, Virginia Jordan,
Designers • Logan Bonner and Mark Seifter
Managing Editor • Judy Bauer Samantha Phelan, and Diego Valdez
Editors • James Case, Leo Glass, Lyz Liddell, Adrian Ng, Warehouse Team • Laura Wilkes Carey,
Lacy Pellazar, and Jason Tondro
Art Director • Sonja Morris Mika Hawkins, Heather Payne, Jeff Strand, and
Senior Graphic Designers • Emily Crowell and Adam Vick Kevin Underwood
Production Artist • Tony Barnett Website Team • Brian Bauman, Robert Brandenburg,
Franchise Manager • Mark Moreland Whitney Chatterjee, Erik Keith, Josh Thornton, and
Project Manager • Gabriel Waluconis Andrew White
Paizo CEO • Lisa Stevens
Chief Creative Officer • Erik Mona
Chief Financial Officer • John Parrish
Chief Operations Officer • Jeffrey Alvarez
Chief Technical Officer • Vic Wertz

Open Game License Version 1.0a

The following text is the property of Wizards of the Coast, Inc. and is Copyright 2000 Wizards of the 9. Updating the License: Wizards or its designated Agents may publish updated versions of this

Coast, Inc. (“Wizards”). All Rights Reserved. License. You may use any authorized version of this License to copy, modify and distribute any Open

1. Definitions: (a) “Contributors” means the copyright and/or trademark owners who have Game Content originally distributed under any version of this License.

contributed Open Game Content; (b) “Derivative Material” means copyrighted material including 10. Copy of this License: You MUST include a copy of this License with every copy of the Open

derivative works and translations (including into other computer languages), potation, modification, Game Content You distribute.

correction, addition, extension, upgrade, improvement, compilation, abridgment or other form in which 11. Use of Contributor Credits: You may not market or advertise the Open Game Content using the

an existing work may be recast, transformed or adapted; (c) “Distribute” means to reproduce, license, name of any Contributor unless You have written permission from the Contributor to do so.

rent, lease, sell, broadcast, publicly display, transmit or otherwise distribute; (d) “Open Game Content” 12. Inability to Comply: If it is impossible for You to comply with any of the terms of this License

means the game mechanic and includes the methods, procedures, processes and routines to the extent with respect to some or all of the Open Game Content due to statute, judicial order, or governmental

such content does not embody the Product Identity and is an enhancement over the prior art and regulation then You may not Use any Open Game Material so affected.

any additional content clearly identified as Open Game Content by the Contributor, and means any 13. Termination: This License will terminate automatically if You fail to comply with all terms

work covered by this License, including translations and derivative works under copyright law, but herein and fail to cure such breach within 30 days of becoming aware of the breach. All sublicenses

16651316 specifically excludes Product Identity. (e) “Product Identity” means product and product line names, 4254520

shall survive the termination of this License.

logos and identifying marks including trade dress; artifacts, creatures, characters, stories, storylines, 14. Reformation: If any provision of this License is held to be unenforceable, such provision shall

plots, thematic elements, dialogue, incidents, language, artwork, symbols, designs, depictions, be reformed only to the extent necessary to make it enforceable.

likenesses, formats, poses, concepts, themes and graphic, photographic and other visual or audio 15. COPYRIGHT NOTICE

representations; names and descriptions of characters, spells, enchantments, personalities, teams, Open Game License v 1.0a © 2000, Wizards of the Coast, Inc.

personas, likenesses and special abilities; places, locations, environments, creatures, equipment, System Reference Document © 2000, Wizards of the Coast, Inc.; Authors: Jonathan Tweet, Monte

magical or supernatural abilities or effects, logos, symbols, or graphic designs; and any other Cook, Skip Williams, based on material by E. Gary Gygax and Dave Arneson.

trademark or registered trademark clearly identified as Product identity by the owner of the Product Starfinder Core Rulebook © 2017, Paizo Inc.; Authors: Logan Bonner, Jason Bulmahn,

Identity, and which specifically excludes the Open Game Content; (f) “Trademark” means the logos, Amanda  Hamon Kunz, Jason Keeley, Robert G. McCreary, Stephen Radney-MacFarland,

names, mark, sign, motto, designs that are used by a Contributor to identify itself or its products or Mark  Seifter, Owen K.C. Stephens, and James L. Sutter, with Alexander Augunas, Judy Bauer,

the associated products contributed to the Open Game License by the Contributor (g) “Use”, “Used” or John Compton, Adam Daigle, Crystal Frasier, Lissa Guillet, Thurston Hillman, Erik Mona,

“Using” means to use, Distribute, copy, edit, format, modify, translate and otherwise create Derivative Mark Moreland, Jessica Price, F. Wesley Schneider, Amber E. Scott, and Josh Vogt.

Material of Open Game Content. (h) “You” or “Your” means the licensee in terms of this agreement. Starfinder Alien Archive 3 © 2019, Paizo Inc.; Authors: Saif Ansari, Kate Baker, John Compton,

2. The License: This License applies to any Open Game Content that contains a notice indicating Adam Daigle, Katina Davis, Eleanor Ferron, Crystal Frasier, Leo Glass, Sasha Lindley Hall,

that the Open Game Content may only be Used under and in terms of this License. You must affix such Amanda Hamon, Thurston Hillman, James Jacobs, Jenny Jarzabski, Virginia Jordan, Jason Keeley,

a notice to any Open Game Content that you Use. No terms may be added to or subtracted from this Natalie Kertzner, Luis Loza, Lyz Liddell, Ron Lundeen, Crystal Malarsky, Robert G. McCreary,

License except as described by the License itself. No other terms or conditions may be applied to any Hilary Moon Murphy, Adrian Ng, Joe Pasini, Lacy Pellazar, Samantha Phelan, Jessica Redekop,

Open Game Content distributed using this License. Simone D. Sallé, Michael Sayre, Owen K.C. Stephens, James L. Sutter, Jason Tondro, Diego Valdez,

3. Offer and Acceptance: By Using the Open Game Content You indicate Your acceptance of the and Linda Zayas-Palmer.

terms of this License.

4. Grant and Consideration: In consideration for agreeing to use this License, the Contributors This book refers to several other Starfinder products using the following abbreviations, yet these
grant You a perpetual, worldwide, royalty-free, non-exclusive license with the exact terms of this additional supplements are not required to make use of this book. Readers interested in references to
License to Use, the Open Game Content. Starfinder hardcovers can find the complete rules of these books available online for free at sfrd.info.
This product is compliant with the Open Game License (OGL) and is suitable for use with Starfinder or the
5. Representation of Authority to Contribute: If You are contributing original material as Open Pathfinder Roleplaying Game.

Game Content, You represent that Your Contributions are Your original creation and/or You have Product Identity: The following items are hereby identified as Product Identity, as defined in the Open
sufficient rights to grant the rights conveyed by this License. Game License version 1.0a, Section 1(e), and are not Open Game Content: All trademarks, registered
trademarks, proper nouns (characters, deities, locations, etc., as well as all adjectives, names, titles, and
6. Notice of License Copyright: You must update the COPYRIGHT NOTICE portion of this License descriptive terms derived from proper nouns), artworks, characters, dialogue, locations, plots, storylines,
to include the exact text of the COPYRIGHT NOTICE of any Open Game Content You are copying, trade dress, the historical period called the Gap, the terms kishalee, sivv, skyfire, Dreamer (the official
modifying or distributing, and You must add the title, the copyright date, and the copyright holder’s Open Game Content term for which is “dreaming barathu”), and the Drift (the official Open Game Content
name to the COPYRIGHT NOTICE of any original Open Game Content you Distribute. term for which is “hyperspace”). (Elements that have previously been designated as Open Game Content,
or are exclusively derived from previous Open Game Content, or that are in the public domain are not
7. Use of Product Identity: You agree not to Use any Product Identity, including as an indication included in this declaration.)
as to compatibility, except as expressly licensed in another, independent Agreement with the owner of Open Game Content: Except for material designated as Product Identity (see above), the game mechanics
each element of that Product Identity. You agree not to indicate compatibility or co-adaptability with of this Paizo game product are Open Game Content, as defined in the Open Game License version 1.0a,
any Trademark or Registered Trademark in conjunction with a work containing Open Game Content Section 1(d). No portion of this work other than the material designated as Open Game Content may be
except as expressly licensed in another, independent Agreement with the owner of such Trademark or reproduced in any form without written permission.
Registered Trademark. The use of any Product Identity in Open Game Content does not constitute a Starfinder Alien Archive 3 © 2019, Paizo Inc. All Rights Reserved. Paizo, the Paizo golem logo, Pathfinder,
challenge to the ownership of that Product Identity. The owner of any Product Identity used in Open the Pathfinder logo, Pathfinder Society, Starfinder, and the Starfinder logo are registered trademarks
Game Content shall retain all rights, title and interest in and to that Product Identity. of Paizo Inc.; Pathfinder Accessories, Pathfinder Adventure Card Game, Pathfinder Adventure Path,
Pathfinder Adventure Card Society, Pathfinder Adventures, Pathfinder Battles, Pathfinder Campaign
8. Identification: If you distribute Open Game Content You must clearly indicate which portions of Setting, Pathfinder Cards, Pathfinder Combat Pad, Pathfinder Flip-Mat, Pathfinder Flip-Tiles, Pathfinder
the work that you are distributing are Open Game Content. Legends, Pathfinder Map Pack, Pathfinder Module, Pathfinder Pawns, Pathfinder Player Companion,
Pathfinder Roleplaying Game, Pathfinder Tales, Starfinder Adventure Path, Starfinder Combat Pad,
Starfinder Flip-Mat, Starfinder Pawns, Starfinder Roleplaying Game, and Starfinder Society are trademarks
of Paizo Inc.

Printed in China.

APPENDIXES 159

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651316
16651316

4254521

4254521

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

ALL
SYSTEMS
ARE
GO!

16651317 4254521

BEGINNER BOX

Launch into an exciting universe of science ABOUT OBAOBZOAUYATABKOEUSTKOISDEAAPIBHOUT RAABIAOSUOT NLADVAAIBESOMIOURTPYQSETUTRIEGIACCTHINVOEMAENNCVEOMRYECHANICOwqabmuiottsaihoiOzpcwlanwaikuhbltndayelareoodymaasrrzrhvuydeawwdpi,eitsyteobhatlsathtiarseiooenlasbcernbroareoelmodimtesntmsr.hoikdhennaiBesiegntawr’trsedeeggtoiauicllonholoatatrienonlaersyffrytnr,ara,asraetnmaabeenecKngdoullailodafSladaneotnfyanthaienssfednbsrnttfsdaokrhceKmdhresuhdoakdefoeeawcateretecteecidlocibtsnpomboinhtlidsnetatgykbseoelwe.gihyiroieeIniccoiastpcwloofsnaewmrg-ihthooiltt.dth-eeflntchyfrgrtrnpleemnpqaiKiavepceaeetluia-Ieoveyvoeesimihuswsaoeccbhxentilecrnoertfnoehpletyesuhsiiynckaitshaic.lassetepae,renskhenarohowtaAk,mtwodedlfhtohyoghldeteastdpnlteiyijseommeniodoiuilapnapr,aesaioclboiaarrtsnkginitasdoscolllilOhiletnvceenroihlwshdeis.seirtalnnieusieaea.csbdsyitthtelobrWtxitSagitndeslomaseiooan’anybietmshoeyphccr.omaruznlfamgaolhnelyaoiCssbfbeeadfeairdpenftoyerendi,mrtcueoeety.loPcbcaleldonitv’aeoeksdasednsrweaoaanhjefhedheewteyttffnopbjdmalodtiqjalaseihuaphceiunewyronrcoanenepuryautsoftarisgwetnfgctavd,esswoal,irebcssth.ototsdoesosyKradareaeoieneSobaoummnatntsocflasselxfeihti,tuesaykwnfnttfntctsaotabpwaodeyeRnleats-ahihydeehasgkdnnhaaeelnnug.iwdwhaacaedoeepoetusoaybyrsigolDpdsnrtotutniiraobucatdmndndisidosmap,ahieRpaadcnioohatnhwgnobohnaodttiasdbdpuofehateasakmnhoorso.ranrewlsfeitgiroahaihepeuteonledleinisrorpinrHlaiienitnstferestlolgariaaa,agcgfiealcsiiietoeonoianniiiflrcgdengssgdrttlnnyelonsebgp.adc.riwteptheecignhushgmteseydntdvcnhsutaeLhigdtowdhtra,oofutictseiehteihtsrlgttfisroefsireiuepf,ne,tleotktiklaictetraaeuheer,veiinmootuIfntrdathiimeercstsorvdnaestllcRcinonheiogfeiapneltei,nodehcemangteiatdlttmrbtoteoexa,rwvsniedsssghmuohpantlsahlstyOryuaripiienithteyiaan.hiaatrdinsnttensathtmtmshatltebeocnhelnrhnwl,dh,whdgsnweghtwihetfirceuooebwnmfdaoydenpeolhid.eteeidhrhetoeeahsuplzaooraoipeirlfvoWsslNaytsaiatrensrmlovedsraeaoensnnmonwfpatehleeirnoptcsltmPleahaiagnenyfrddkittdfglirscirlkhteiepoieewdzltyoweoevkffnhesnai,agdeshaoivntsavtllreewarureNiniatoknsaarnniofouiasehbneonre.bseaypeoaefnnosehdlitgmnsftecratgtaceouuosnydsfwtsaamltdgoipyetiaindovoweahedlitmmtlaethneh,ittfhlrsdbohtarahfemsltlncnaefseithwdpehyaearmasmueeoeren,snmeuyacnshoxhullelloseaarginlhphaavewote’blthaldceecitassthagonmttoesirgesoaondpowa,orhrdehtruosotarauw,govgtlamuswmysitiwrgyiafoertuyybelanarnsteeascyhhvw,ieaihewonarrthciooesooursttcalsotncteseighxawyrhdtsuegpchaseaursmrpttlfdhiasiheniyeettardrctdlnrekcoransaIawnotobelhthataj.idfeaswlshseeohyrdyronsoneewlffpdiis,ynrefihtefihsonrmsyi.s:h“oevrdaoplrrf.appaidisabdsnobeleecieeoferannwaeuAitisouoptlhAnnueddlildminCrecnmtnnItttmooueraegscngalcdaeghslahFhhsadcgtwjedfvnaBxhtdienHeoohsi.thrraeereceeooarfhndUjdsedfcEotoeeyanbkdaaarmyiuneto.wnaayWmot”eoeegeeSGyYOstiirsiaiiaevsshTdEslrltdcnorrmnlnhTnierdaneslihEiweitcrarQwrlp,neHEnXttidlgesneOopsfshogtgseietreOheyeaiohhtTarpiaagkvAogetoeuhipCsEgtiweohrcex.ahrdydsaeofnNuhdHnslunloraeucrUEaieRfQriafiryiStstoieSpn,,nnagnemnonnaaaedtoipnoradaoEllturLhimpaheTfuemldtldThceiocltynetdibnt’vrdwodoiyEreeulitaaBItRxescoDeiHeewia,sersliberNaorgryaanriat,nclco’,hIchl,OfcnewsnNnEiycehsehe,fGolgawseedhapncdhvMualietNTsa.didgddnteaiI,tnnBioeGLnos-eagtaraslprhhcsmapOlelGnrvlgEotlhdarfEimrHduuiEbalniaeainaeheoskIiufaavueksLneEtsntcwerSeSlpygKrpelag,nycsieshrpistoesEeaSteeaEgieTsTaehf-heitetuardteibhadsntEeaoTfbefaEape-ntAs.WdeoslradosouletseansourAcAclh,p,awablmSRhSfsirdtblt.wvoiaheowetraENNiblympeioTMhiSflskaneaenonnefnsmsnOAseuhdDDepuhehhknelnhhtdsttuOihOgtPlt-aoetaqaseaireaetRTah,efeLpiRpdn,wOdettifsocusCotibsnHaIalrA…cpnacsnhodlietDwaNrFwoereduhnenfvbhoEHpNlmshiHeenemniswSltteinmdeidueeathriEoGwTIsmlebthotdaeihdieliEtssnYfnOilAeinOsd,oEucoaejvnvyerwe,.utdea’ehboalrLnUewbDkouteteOgn’RieisObossdrganfCftrebIygmernGsAtdtiUaeteCsiahshFn’oisdTnoaswihMlUtibHnNSeEsaasnOHllhSscoiliityRBsfainetmtinsudwgXEmadeaDthgOeoEMelfiath’nIyEnrEeaYdrcgOsdseSnhCDC.hesrreRsch.oAeaaHcveisBiBf,oT.,KEvtrtueentOthEomeneaAtdvOEAhtsuaOuShbaLTeloTnoeaw,ennmoYgfPyDaLLfeTnTleteoalTfhUtsAbratieolOSPiioaHrAnEeedtiaHlueyssndeIedseiT—gflllpthcUflrAKneanyMn’YynortnoiEoro.AEtfDhAoteitaolsRs’yLorOtunasgfhtyWAnEintWTy.PufiVpsrlUahiFaaGmleoHdnTestMgEyiALOihtRhtofscrrotEwmeY’RhiTaosRaHeEru.orgjIeFfnoaStrYtletnAsSBKInntrhwrOdR,haeEwOioleoEeiPstnulTtsSkInseNThrlheEeNt.E…tPOw.ftoeYgiadraedoTTNatsHrROAantnDivnoaheecnOcwhtDhTcOeNmItakmacheEsbadFPerCyiSAhsitDirsApOpehotedn.oSeisCrirrhtsrEoLnfloeAguaKaeCOtuIHeii…saaoldotsdfFvnBadIrRnmMoWolEfHLwgtelefikULMhtnihrnaNLsrltAiEsooAtSIeYiilOocegSyAEErshnyNCfhEdUtweToML,GOegPHuhaDiONtlTamDIfiiIaiaeINIIfnEnCDfrnUMNESVelcrMoMseCSgedESttE.erAdPqH’aErARBAElDusWT,GuurIfwNKMYEGRe-pChQsaIsoOEtoTIoCEAtIaOrtCuLniHNLrrForrntAuYHCilkOyTaREfIgdUbnONHOfaK,OanGIsEeYhEtUfiDwAag’.YiniBtpONaOEDlnnRReeaTtoLsUDiTTgdrrotIsAEASoOSSnR’lTsiCELaLrtheSfMroAPEhEHLbefTeOhsoIgCNtAONIeaeNKceEnYorDTWedEh…aHTw’OSe,soOInEMyvIiCaLdmNUEQiHNedlOIPtRTiRunEzeoTGIEOESigMeYrgHYOOedOMIIIPrDEDPUNHL…ARERAAHENYTOOVOAEBPNCBVEVUIUEFECJFECORERAIOSLCHESSTBEDCTSOYYOHRYSOANRREAOBINNIORIEIFMNDUYRIGSOPNM’HULDEEOTARTDNTICCLTIOHTFOEIEYHKDELMKEFEAOPCORMTHUAICOENNHYE…CERSJHOYBANICKASATHA© 2019 PAIZO INC.KHEFAK© 2019 PAIZO INC.
fantasy adventure with the Star nder
Beginner Box! Streamlined rules help you KHEFAK© 2019 PAIZO INC. LIVIN©G201H9 POAILZOOINGC. RAM
create and customize your own futuristic hero
to play through challenging adventures and M© A20R19APAQIZOUINOC. I MI-GO© 2019 PAIZO INC.
action-packed battles against dangerous foes!
STLEILNEGKPINSEYTCIHCIPCRBOOJLETCSTAILNEDS RdT4EELAEDPMATINHDIACSAALNLYD COMMUNICATE B4STR CHARACTER SHEETAMBOILDISTY AEON PGAIZUO AINCR. D
The Star nder Beginner Box is the ideal UCSOEMAMNDUNDIECTAETCETTMEALEGPICATdH1I2dC1A01d0L8Ld8Y66 F E DC 1012 © 2019
introduction to the Star nder Roleplaying
Game, and includes two books, player aid d2020 I H GSKILL AEON PGAIZUO AINCR. D
cards, a complete set of dice, six pregenerated ATHLETICS © 2019
characters, blank character sheets, pawns and CULTURE
pawn bases, and a double-sided Flip-Mat. COMBAT REFERENCE GUIDE SACBOILRIETSY AKATA© 2019 PAIZO INC. ANACITE© 2019 PAIZO INC.
INTERACTION
ACTIONS MEDICINE CHARACTER INFORMATIONOBS©ER20V19EPARIZORINOC. BOT
Attack Actions COMBAT ROUND SEQUENCE WHAT CAN I DO ON MY TURN?MYSTICISMCWHICNADIOSTENX ICCNHOWTDANE(SIERpSLSTXLaITDRSIgITOGTEMEUMNERANTGITICTOYEHN TOTAL DEX +RACIAL TRAITS NAME O©R20O19CPOAIZRO IANCN. ASS©E2M019BPALIZYO IONC.OZE AST©ER201O9 IPADIZOLINOC.USE
DECUUexUasftssseereteaSnHRaaMaudaMianpSnSSe(nopdpHpklIgevoeeteeieeleecrrlrldltmioAF(a((HHFeAoHlts(iteeeAtHer'artrerHb(ecaoooHikr(ceaeleHoeikssnts(ere''Hyd'(osHrHHHbeoe'(aaHreoHaseonnr'onseaoedHd'krdnsebHobabd8'soeoanoHb'2soondoHoa')kkdbkHoanbo88knd8aoo12dbn28)okb)od)1k7oob) 7o9ko9k)o7)k7898) )1) H(F3eo2r.r1o.at.eSbmnhoTstoedieraaE’onrfHrkvrcdo3istteereaearieauaerrmnitaytnnnudfoiteotfrvebruroionnewloorarmeseoormfrrdntekritoheanoeesa.u)ritrlukglisinsoilneheittddnsiseitt.onetisaeEoaafitktixntvbseieriaaelvaedsicctrsecsietoyhtvhulfhmooyeeelatnrPdabo(dtetCdtaneoiea2nttreadca,.l0ontksagOoiwdt+eocornestneDgpirt.osiauroEttnno1sn.X.u,opst)Ratpau.hanegWrwoepdenfrea,riXtmaiytatutX.ecorcsannhdotn,soaefutrwpmetsashrinconset2v,gteehirne BASIC ROLL:PERCEPTION(pag es 20–23) ARMOR CLASS (AC) FEETCLASS FEATURES RACE
D20 + MODIFIERSEach turn, you take exactly one action, and you can moveSCIENCE ALIGNMENT THEME PRONOUNS PERATHI© 2019 PAIZO INC.
before or after you take that action.STEALTH
RESTINGMOVE (optional; Heroes’ Handbook 77)SURVIVAL CLASS
¨¨ ¨TAKE AN ACTION (mandatory; Heroes’ Handbook 78) Wofirtehs1t0, yuonuinctaenrrsuppetnedd 1mRineusotelvseTECHNOLOGY
J K ¨ ¨AUUUCtstsasaeeesctaaakanMRHSSSASIakupietcnpnpieeltldeegpclmieoleeio(larHndAr((lHsHtFetAArotFeeoatberritrceooiael(kseeiHct’ss(k(yeHH’’HrHH(ae(oeHHrnaareeoeodnnsrere’bddoossHobbe’e’ooaosHsHk’ono’aaHkHkdn8nabad881dnon)b12bdod)oo)kbbooook7koo97k7k)9878))91)) PePHWoPHoHdqoofaofiaauiiitsnnitnyinnalhlPdtyotedltsobs-eutabtuoiopor(neofsrouRqrotoeohkselukeuralag(san8lmnb8rafolod4ii4iglotylnuevi)o)rhto.,ndeeiHtuehad)’Psds,irnaetoyoldrdatfPieowonnyasdoutdtnltoaoislnr;ul(wsoe8(HtprHHfgsneethiaey)tolr,oirloontoausuaelelHrllrosss’it’tsTheme Knowledge CURRENT XP LEVEL ISEOP©HP20E—19RPAAAINZTOIDINVCR.EOID RUTHIG© 2019 PAIZO INC. R©Y2P01H9 POAIZROIINAC.N
NEXT LEVEL BARATHU© 2019 PAIZO INC.
HIT POIINNTITSIADTEIVRFEEESNOSE SPEEDTOTAL KESKO© DM201AY9 IPSA—ITZOISCINHC.IRREN NAVASI©—2H019UPAMIZOAINNC. ENVOY OBOZAY©A2—019VPEAIZSOKINCS. OLDIER
ATTACKS ++++ LV+++E+++PO+INTSDAMAGE* MISC BO©N2E019TPRAIOZO OINCP. ER CON©T20E1M9 PAPIZOLIANCT. IVE CYBER©N201E9TPIACIZO ZINOC. MBIE S©A2R019CPEAISZOIIANCN.
DAMAGE*
CURRENT SECU©R20I19TPYAIZGO IUNCA. RD SECU©R20I19TPYAIZGO IUNCA. RD QUIG—Y©S20O19KPAIIZOMINEC.CHANIC RTEACI©HA2N—01O9LPAMAIZSOAHINNCU.CNETRA
TOTAL CURRENT CYBER©N201E9TPIACIZO ZINOC. MBIE D©R2A01G9 POAIZNO IKNCI.N
ANDROID© 2019 PAIZO INC.
TOTAL TOTAL DROW© 2019 PAIZO INC. SECU©R20I19TPYAIZGO IUNCA. RD

STARFINDER BEGINNER BOX: GAME MASTER'S GUIDE (pag es 26–45) FAROWSRERAMFITVLLOIILTENRAUSXGRUADSMTPVEAHGEOSVRRAREOAVWDEESS WDCEIOSXN DEX ¨ ¨FEATS ARMOR MISC ANDROID© 2019 PAIZO INC. SEC©UR201I9TPYAIZORINOC.BOT SH© A201R9 PPAWIZO IINNC. G
EL©EC20T19RPAOIZOVIONC.RE
ARMOLiRghPtROFICHIEeNaCvIyES ANDROID© 2019 PAIZO INC. ANDROID© 2019 PAIZO INC. SKIT©T2E01R9 PMAIZAO INNC.DER
EL©EC20T19RPAOIZOVIONC.RE E©V2I0L19EPANIZOVINOC.Y
COMMON ROLLS AMBIOLDITY CLASS MISC ANDROID© 2019 PAIZO INC.
dA2B0I+LAIbTiYlitCy HMEodCifKier EVI©L20M19EPACIZHO IANCN. IC
HSPO©AN2C0C1E9HPGAOIZOOHIBNECAL. IDN SZP©AA2PC01EE9 RPGAAIZOOTIBONCL.RIN HUMAN© 2019 PAIZO INC.
dI2N0IT+ITAotTaIlVInEitiCatHivEeCBKonus (DEX + Misc.) (pag es 52–55) WEAWPROEMANANEPFGLUOEESDNEIAAOTTNTTAACCKK (pages 78–7D9SE)TXRSKILLS SZP©AA2PC01EE9 RPGAAIZOOTIBONCL.RIN E©VI20L19MPAIYZOSINTCI. C
MMdMe2El0eELe+LEWTEEoeEtaDaAplAoMTnMTeDlAAeaeCmGAKaEtgtReacO+kLSBTLoRnus (STR + Class Attack Bonus) es 46–51)TOTAL AMBIOLDITY CLASS
TOTAL CLASS HUMAN© 2019 PAIZO INC. SZP©AA2PC01EE9 RPGAAIZOOTIBONCL.RIN SZP©AA2PC01EE9 RPGAAIZOOTIBONCL.RIN
RRdaRA2nA0gNeN+GdTGWEoEtDeaDalDpRAoaAnTnMgTDeAaAdmCGAaKtEgteaRcOk BLoLnus (DEX + Class Attack Bonus) STR WEAPON+ TOTAL
HFpcueoFeorpronmorae2melbst0soo'ie)Hutrsheapawlmnw1ind)oeabfaulyoelolwsrdeomakahryea.nitdtsdsiuom—rcnatiehsnsoitgsehneseid.sadAataatthtmaacictrackikgatsisel,cw,atasaoleynhelsaeittsdp!usearAataghllesna2san10tdX1u(a.trXmha–leXa1dgX2e(t,0ohefecvoetdmnh2eei0fs INT WEAPON FUSION+ L©A20S1H9 PUAIZNO INTCA. L©A20S1H9 PUAIZNO INTCA.
SAVING THROW CHA + EVIL HUMAN© 2019 PAIZO INC. T©EC20H19NPAOIZOMINCA. NCER FORMIAN© 2019 PAIZO INC. SPACE PPAIZIORINAC.TE
HfaFaedloiwr2lrso0a.e+yaFsslTo'loHrstsamaualncvSocdairnevbeiegonidngostkfTh,oh.rarroomnwwdasBta,ioonannuasont(nuAarbtsauiallirvtay1ilnM(tg2oh0dtehifird(eotr2hw+0eCsl,cdasos2esm0eBeopscnaouugsmpe+eXM1s)Xisaucol.pw)f ta2hy0es) INT + © EV©I2L01S9 OPAILZODINICE. R © 2019
SKILL CHECK WIS GRENADE (page+
WIS 64)+ TOTAL 2O019PPEAIZRO AINCT. IVE
INT + ATTACK
DEX W+ EVIL L©A20S1H9 PUAIZNO ITNCA.
WIS EABPaOsiNc PROFICIENCIES (pag+ RANGE PRSOPPECEIRATLY
INT AdvancMEeedlQeMeelee LSomeng5aal7lr)Amrsms Grenades+ CREITFIFCEACLTHIT
CLASS LEVEL SPACE SHIRREN© 2019 PAIZO INC.
© 2019
MISC PPAIZIORINAC.TE GANG PTAIOZOUINCG. H PADIZOR INAC.GON
© 2019
++ SPACE
++ TOTAL © 2019 PPAIZIORINAC.TE SWAR©M2019CPOAIZRO IRNCO. VOX GANG PTAIOZOUINCG. H
++ ATTACK © 2019
++
MEASURING DISTANCEfffeaogeaeaumeiMntcvnrtdoeet(d.a1hmanEns,sedpvybsuixeeenairtxtrltirelynttfasrhhemg.msse,iTnaedqatihgcp.nniuseos,idTatnsnoracegsedondo)dduc.utdeoiehnrsitn,aietteni)ganregcrnomcaaonclcniuueanchgnsdleoeti(masnstdrqhgobaeiuesfsamatgtsw5areoeennveeccreaexoaeerpmtnsqarodouael5nln,inyrste ++ RANGE PRSOPPECEIRATLYPZO71C1RE0ITF-BIFCEeACgLTinHnIeTr Box-Pawns.indd 5 ©VE20R19TPHAIZAO INNC.I ROBOT
30 FEET ++ © 2019
++
++ SHIRREN© 2019 PAIZO INC. SHIRREN© 2019 PAIZO INC.
++ GA©R20A19GPAGIZOAINKC.AL
++ TOTAL DAMAGE GANG PTAIOZOUINCG. H SHIRREN© 2019 PAIZO INC.
ATTACK © 2019 GRAY© 2019 PAIZO INC.

AC VS RANGE SEPFFEECCIATL SRAEVFELDEXC SHIRREN© 2019 PAIZO INC. © 2019KSAPAIZORI INC.K
10 HESPER© 2019 PAIZO INC.

* Add your STR to melee weapon damage. PZO7110-Beginner Box-Pawns.indd 3 VESK© 2019 PAIZO INC. 10/17/18 5:58 PM VESK© 2019 PAIZO INC.

(–4 to attack if not proficient)
AREUIOPNMETHNET ARNEVDESRPSEELLS VESK© 2019 PAIZO INC.
10/17/18 5:57 PM
YSOKI© 2019 PAIZO INC. C©R2E01S9TP-AIEZOAINTC.ER

PZO7110-Beginner Box-Pawns.indd 1 YSOKI© 2019 PAIZO INC.

YSOKI© 2019 PAIZO INC.

d20 + Total iSnkfilolrBmonautsio(AnboilintysMkoildlicfihere+ckClsa,ssseoer TpraaigneedXSXki.ll GAME MASTER'S GUIDE Extra Move (Heroes’ Handbook 82) (Heroes’ Handbook 72). 10/17/18 5:56 PM
For more Defend (Heroes’ Handbook 82) Star nder Beginner Box
Bonus + Misc.) PlayerAids.indd 1 10/17/18 6:16 PM
5 FEET 10 FEET
30 FEET

PZO7110 GM Guide 000 Cover.indd 1

9/19/18 3:46 PM

AVAILABLE NOW!

Paizo, Paizo Inc., the Paizo golem logo, Starfinder, and the Starfinder logo are registered trademarks of Paizo Inc.; paizo.com/starfinder
Starfinder Roleplaying Game and Starfinder Flip-Mat are trademarks of Paizo Inc. © 2019, Paizo Inc.
16651317
paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651317

4254522
4254522

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020

16651318 4254522

paizo.com #22530033, Jessie Berry <[email protected]>, Apr 19, 2020
16651318
16651318

FEATURE CREATURES

The galaxy hosts a staggering array of aliens
both bloodcurdling and benevolent. The pages
of Starfinder Alien Archive 3 are packed with
creatures designed for use with the Starfinder
Roleplaying Game! From starmetal dragons and
the spiral-winged irokirois to living holograms and
body-snatching flayer leeches, the creatures in
this codex will challenge adventurers no matter
what strange worlds they’re exploring. What’s
more, player rules for a variety of species let
players not just fight aliens, but be them! Inside
this book, you’ll find the following:

D Over 100 bizarre life-
forms both classic and
new, from bioluminescent
cephalumes and quantum-
entangled oozes to natives of
hyperspace and living asteroids.

D More than a dozen races with full
player rules, letting you play everything
from a life-hungry undead creature to a
sapient swarm of tiny insects.

D New alien technology to help give your
character an edge, including
armor, weapons, magic items,
and more.

D New rules for gaining a
creature companion that
can accompany you as a
pet, a mount, or even a
fearsome combatant!

paizo.com/starfinder

Printed in China. PZO7111