The Grapevine Halifax Issue 158 July 2021

THE
GRAPEVINE

HALIFAX EDITION

July ’21
Live Local Love Local
www.thegrapevinemag.co.uk

‘Ode to Spring’
By local artist - Carol Banks at AC Gallery www.acgallery.co.uk

PB
Property

2

Editor’s Note: What’s inside this month

Right now – planning to travel Quirky Gifts at KuRa 8
abroad is a moving feast Focus on local author 10-11
and a bit of a rollercoaster. Focus on local artist 12
Instead of spending on holidays Nostalgia 14
abroad, homeowners have been Plate it up 18
undertaking improvement projects and building Sizzling Summer reads 19-20
an oasis at home. Most of us need the services of a Canal fishing for the soul 24
local specialist – plumber, electrician, carpet fitter, Avoiding scam callers 26
kitchen fitter, joiner and we hope that our Homes Forever fashion 28-29
section within the mag each month help you find Halifax Bid’s Defibrillator Map 34-35
what you’re looking for. Across the building trade, Focus on investments 40-41
wholesalers are reporting issues in their supply Songbirds 42-43
chain for wood, cement, steel and other materials. That sucks! 56-57
There are several factors including Brexit, the
pandemic and the Suez Canal blockage earlier This month’s front cover was supplied courtesy of AC
this year, but surprisingly, the biggest cause of
shortages is demand. Gallery. We spotted the featured artist’s, Carol Banks’

If you’re a homeowner with big dreams, pick up that work on their social media THE
phone now or you’ll be at the back of a long queue. and asked if we could use for GRAPEVINE
If you are skilled tradesperson and are available one of our Spring/Summer
for more work, this magazine is a great place to let covers. Find out more on July ’21
people know about your business. Support your
local shops and trades-folk as much as you can over Live Local Love Local
the coming months as the knock on effect of the www.thegrapevinemag.co.uk
pandemic will have implications for many months
(and possibly years to come). page 12 about Carol and AC

July is one of my fave months of the year and more Gallery. If you know a local
so this year than ever before as the lure of the
19th July approaches (fingers and mask strings artist who would like to
crossed)…….
feature on our front cover – ‘Ode to Spring’
Helen please get in touch. We’re By local artist - Carol Banks at AC Gallery www.acgallery.co.uk

always keen to promote

local talent.

Contact us

[email protected] Why not call in for Advertise from Free advert design
077918 91623 a socially-distanced chat? just £47 ex vat Free feature writing
www.facebook.com/thegrapevinemag Reach 20,000 local Guidance and advice
Find our office at 6 The homes and businesses on maximising your
@thegrapevinemag – follow us Boat House, Wharf Street, Online directory and
on Facebook to find out the Brighouse HD6 1PP (just social media results
latest local news
around from Jeremy’s). included 3
@thegrapevine.magazine Give us a call first to make

@thegrapevinemag sure we’re around.

4 Interested in advertising? Call us on 077918 91623 or email [email protected]

ALL YOUR Pric£Co is a family run business that specialises
TRADE & DIY in bringing our customers big brands at
ESSENTIALS unbeatable prices.
UNDER ONE We only stock the highest quality products and
service is always delivered with a smile!
ROOF! Pop in to our newly opened Trade Centre in
Brighouse and see our huge range of products
for yourself.

STORAGE DIY & CAR CARE LIGHTING HOME CLEANING & GLUES, POWER PAINT PAINT & HAND ELECTRICAL
HARDWARE SECURITY HOUSEHOLD TUBES & TOOLS SPRAYS DECORATING TOOLS APPLIANCES
ACCESSORIES FILLERS

FIND US AT:

Brighouse

Unit 1 George Street, Brighouse Trade Park,
Brighouse, HD6 1PU

Phone WE’RE
OPEN 6 DAYS
01484 713041
A WEEK!
Website

www.priceco.co.uk

Email

[email protected]

Monday to Friday 8am - 5:30pm | Saturday 8am - 12pm

OPEN TO THE TRADE & PUBLIC

Please tell advertisers you heard of them through ‘The Grapevine’ 5

Lifestyle & Leisure

yoLuert’bsuhseinlpess We’re
TthAisKloscEuamlOlymFFer VOCAL about

supporting
LOCAL – get
in touch

THE FREE
GRAPEVINEBRIGHOUSE EDITIONBrloYoowcdIusawssrlwtupc.oetoehmoce7pgkm4lreauM2pntaoe0itrvyl1io‘n1m9ce9amalgabaguz.scinoine.eu-sksceosnnecting

Charity Features
Community News & Events

DistributedBatoili9ff,5B0r0idhgoem, Ceslifatnodn,bHusoinveessEedsgeev,eRryasmtroicnkth, WthorooudghhoouusteB, rFigixhboyuse including

Distributed toTGBHRRIGEAHOPUESEVEDINITIOEN FREE

Why advertise your 20HBoums,in0ees sas0ensd0IwsLYswlTooouCwcurec.arutoah7lcsep3moltgemDFreoamempepbelueesuf‘vn1iintiwbn9otyeirtlmaomiylncalaagatNgl.etcabooezdu.inwurseaiknFste-usc&OsonendvsEnerevcaretgiinsnagitntseg Hospice
business with us:

• Great value for money Distributed Btoai9li,f5f 0B0rihdogme,eCs laifntdonb,uHsinoevseseEsdegvee,rRy amstornicthk,tWhroouogdhhoouutsBer,igFhixobuyse including

FREE

• Read from cover to cover each
• Oanudr emvaegrayzminoensthare trusted, TGHREAPEVINE GTRHAEPEVINEHALIFAX EDITIONIswswuYweloo.ut1chra4ecl8goprmMaepomaeprvul‘ien2nie0ttomy lmaogca.acgola.bzuiunksein-ecsosnensecting
• Hcaovaemnrdapgrdeeehtleiwvneosrmievdeobnaytnhdussketoptaflloarroenas HeLlopCcinaoSghlmibeldomdecinuta, nSl–tibutsmuyhpsoeiCnpvreeopssnisnsD,teHgsisstorghritblaieuoglytoehGbdrlriletegooehs8n,s,t0Hso00imlpohpoecmrahelosllymaned,bLuigshintecslisfefes,eNveorrythmoowntrhamin,clCudoilnegy, Norwood Green, ShelfHALIFAX EDITIONlYoowcIuaswrslwupc.etoehmoe1pgm4lre7auptnFoeietvylbionmc‘e2ama0lgabaguz.scinione.eu-sksceosnnectingFREE
KloeCceoapmlliynmegeunvnyjeioHtoryyyuapnmueteppoxwhnyitststorhaaFndLedaedbtaaerepyuveanYrttyosea–r one

• Interesting articles, features and Shibden, Stump Cross, HDoisrtlreibyuGterdeeton,8H,0i0p0pehrohmoelms ean, dLibguhsticnleifsfsee,sNeovertrhyomwornatmh ,inCcoluldeiyn,gNorwood Green, Shelf
local community news

• Free in house advert design

CALL TODAY to discuss how we can help you....

T: 077918 91623 E: [email protected]

www.thegrapevinemag.co.uk

6 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Testimonial: “I have been inundated with phone calls from
The Grapevine Mag spring edition – you guys have been
keeping me so busy after lockdown unknowingly – thank you.

We’ll be advertising again when we’ve caught up!”
Simon Manning (SAM Decorating)

“When times are good you should advertise,
When times are bad you MUST advertise.”

Our coverage areas

The Grapevine
Magazine
10,000

The Brighouse
Grapevine Magazine

10,000

Please tell advertisers you heard of them through ‘The Grapevine’ 7

Lifestyle & Leisure

KuRa Gifts
Quirky and characterful gifts

Back in 2015, Kathryn and Ruth occasion or budget,” Ruth told
opened up their little gift shop in us, “So our larger shop was very
the heart of Northowram – KuRa overdue and the great news is
Gifts. Now, 6 years down the line we’re just down the road for
and despite a pandemic, KuRa our local customers – with even
Gifts have moved to bigger and better parking for those wanting
better premises just down the to just nip in for something
road in Hipperholme. quickly.”

“Whilst we loved our quirky During the pandemic – Ruth and With a service including free gift
shop in Northowram, we had Kathryn set up their online shop wrapping, free local delivery
outgrown the space,” said with a wider range of products. (over £10), click and collect, a
Kathryn, “We were keen to Both the shop and online offer; postal service and a car park just
spread our wings a little and next to the shop (free for 1 hour)
the new shop in Hipperholme is • Homeware – now’s the time to take a look
perfect for us.” Moving to larger • Gifts inside KuRa Gifts.
premises has meant they have • Accessories
been able to extend their existing • Greetings Cards & Gift Wrap Bless You Tissue House
range of gorgeous products. • Jewellery £13.99
“We like to offer something • Home Fragrance
for everyone – whatever the • Boutique Clothing

Indonesian Bamboo Lanterns £32.99 (small) Veg Dip Set £22.99
£36.99 (large)

Three Heart Olive Set £14.99 Retreat - Two Piece Heart Tealight £19.99

Retreat - Heart Trug £21.99

17 Wakefield Road, Hipperholme, Halifax HX3 8AA 01422 203979
[email protected] | www.kuragifts.co.uk | @kuragifts

8 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Please tell advertisers you heard of them through ‘The Grapevine’ 9

Lifestyle & Leisure

Brighouse pensioner launches
debut novel

A Brighouse pensioner is the proud author of a
novel which is proving popular locally.

Madeleine Wilson has always had a love of writing
and following encouragement from her family – is
delighted to share the recent publication of her first
novel.

“My family encouraged me to continue writing
my stories and, as a result, of being housebound
following an operation on my toe – I took advantage
of that time to pick up my pen and write my first
fictional novel,” Madeleine told us, “I’ve always
enjoyed writing stories from being a young girl and
relishing English at school.”

Published by Austin Macauley Publishers, the book is taken under the wing of Hobo, a local character
opens with a snapshot of memories of Madeleine’s who is renowned for pushing his belongings around
childhood, playing out with her pals in her home in a pram. David is introduced to Hobo following
village of Hipperholme where she grew up. “I an accident when Hobo takes care of him. The pair
grew up in Hipperholme and my memories, at the end up living on a canal boat until, eventually, Hobo
beginning of the book, are memories from my sends David to live with his brother on the South
childhood - and how we used to play together,” she Coast where he gets a good education earning him
told us, “Anyone who was born in the 1940’s will be a place at university.During his medical studies,
able to relate in particular.” David returns to his home village where he becomes
reunited with his childhood friend - Rebecca.
From Wellies and Chapped Legs to Brogues - A quick
synopsis ‘From Wellies and Chapped Legs to Brogues,’ by
Madeleine’s memories lead into the story of the
central character in her fictional read about a Madeleine Wilson, is published by Austin Macauley
10-year-old boy called David. While David’s peers publishers and is available online through amazon.
have a decent up-bringing, the young lad has a mum co.uk and all good booksellers. Also available from
he loves dearly but he’s ashamed of her drinking. Brighouse Books in Brighouse town centre.
His mum has a reputation in the village but David Visit Austinmacauley.com.
is eager for his pals not to find out their association
- but they soon find out. When his mum dies at
Christmastime, a special time for families getting
together and spending precious time with friends
and loved ones David is taken into care, but his
escape from where he is being looked after leads to
him being put into a remand home. Determined not
to stay there, David escapes for a second time and

10 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Vicky
Lees

T: 07306 781224

Dog Grooming Services NEW
Taking the time to pamper your pooch! dog
Professional breed standard grooming! groomer
Trims tailored to your specification! in town

E: [email protected] | www.victorious-grooming.co.uk
Hole Bo om Farm, Thornhills Beck Lane, Cli on, Brighouse, HD6 4JQ

Please tell advertisers you heard of them through ‘The Grapevine’ 11

Lifestyle & Leisure

Focus on Yorkshire artist
Carol Banks

Our front cover this month is from one of Carol was eventually closed
Banks stunning paintings which we felt really in the early 1990’s,
depicted July and the positive path for Summer leaving the gift shop. By
ahead following a difficult year. the early 1990’s, selling
original art and framed
We chatted with Carol to find out more about her prints became their
background and passion for painting…. focus, alongside the
picture framing service.
“I am born and bred in Yorkshire, but have also lived It was also the time that
a number of years in Australia. I am blessed with saw the company begin
having a wonderful husband, two lovely daughters publishing their own
and beautiful grandchildren, all of whom are the exclusive artists.
light of my life. Over the years I produced a few
paintings but, like experienced by most, life kept The business is now
me busy in other directions and it is only since late run by Keith and Carol’s
2018 that I took the decision to focus on developing son Mike, who can
my abilities as an artist. I love painting the natural remember many a day spent helping in the art shop
beauty that surrounds us and particularly love to as a child.
try and capture the play of light on a scene. I mainly
work in oils but also like other mediums such as In late 1999, Mike met up with local artist, and by
cold wax, acrylic, pastel, and encaustic. The process then well known, Peter Brook. Peter had been a
of painting gives me a great deal of joy and I think it regular purchaser of art materials from Keith back
is inevitable that artists get a little attached to every in the day, and a relationship soon blossomed with
piece. It is my hope that some of that joy is passed Mike. It was a relationship that has had a huge
on to someone as yet unknown.” Carol Banks impact on both his business, and Mike himself,
to this very day. AC Gallery continued to go from
About AC Gallery strength to strength and became Peter Brook’s
exclusive publishers and main agents. Such was the
AC Gallery began life as an art shop in the 1950’s success of a small Peter Brook exhibition in 2004,
and is now in the 3rd generation of the same family. that an annual show has been held ever since.
The business has evolved over the decades, from Indeed, in 2011 a dedicated Peter Brook room was
its early days as an arts and crafts supply shop, to opened in our Huddersfield gallery. This houses a
the AC Gallery we have today selling framed prints
and originals alongside display of Peters paintings and prints, for
our expert picture framing customers to peruse all year round.
service.
Mike has since expanded AC Gallery to
Now with seven galleries seven galleries from as far west as Kendal,
across the north, it’s a long north as Leyburn, and incorporating
way from the art shop of Skipton, Harrogate, Knaresborough and
the 1950’s but the core Wigan in between.
values have never changed.
We are a family business More of Carol’s paintings are available
where every customer to view on our website:
and every job matters. www.acgallery.co.uk
As fashions changed the
arts and crafts industry AC GALLERY HUDDERSFIELD
declined and Number 10 11 Byram Street, Huddersfield, HD1 1DA
Tel: 01484 423402

12 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Please tell advertisers you heard of them through ‘The Grapevine’ 13

Lifestyle & Leisure

No holidays this year? – time to
reflect on holidays of the past

The most popular zoom There had been the Sunday
PowerPoint I have been School trips to the Yorkshire
presenting over the last 12 Dales or Shipley Glen, but these
months has been ‘Holidays of could not compete with the
the Past’. The story takes the seaside.
audience from the days when
the word leisure would probably Into the 1950s for a week in
not have existed amongst the a guesthouse, or boarding
early nineteenth century mill house, who can remember
folk of Brighouse and Halifax. turn around Saturday? and if
The workers would have it rained there was no turning
probably used the term free back to shelter in your room,
time and been glad of it. that was not allowed, it had
to be a long stay in a café or
But what would they have done during this free even a vacant bus shelter. Some might have turned
time? There would be no dashing off for a week to camping, a week under canvas with muddy fields
beside the seaside, The best that many workers and and a toilet block which felt like it was miles away
their families would have had and enjoyed would whilst looking for it during the night with a torch.
have been an afternoon on the local patch of ‘green We enjoyed the delights of staying in a caravan at
space’, or the park as it was to be called. Although, Wallis’s holiday camp at Reighton Gap, near Filey.
the annual mill closure did eventually see those The occasional trip passed that way these days
seaside trips starting. brings the memories flooding back to holidays of
over 50 years ago.
Birkenhead Park in Liverpool is considered the first
park expressly built for public use. The architect For many children of that era, they like me would
Joseph Paxton created it in 1847. The People’s Park have known the words to that famous song, ‘Oh, I do
in Halifax was given to the people of Halifax in 1857 like to be beside the seaside’, off by heart. This was
by local carpet manufacturer Sir Francis Crossley. It a song written in 1907 and first recorded two years
was originally designed by the same Joseph Paxton. later and was Blackpool Tower organist Reginald
Dixon’s signature piece.
Let us move on to when mill towns in the North of
England would practically be deserted when all the That other lasting memory was Charles Penrose’s
mills closed. Leaving just a skeleton crew to do all song ‘The Laughing Policeman’, which was the
the maintenance work whilst everyone else was greeting you heard as you entered many of the slot
away. machine arcades. The song was first recorded in
1922 by the music hall performer and entertainer
Going to Blackpool for children would have been Charles Penrose, under the pseudonym Charles Jolly.
sheer magic. Before experiencing the sight of the It has sold over one million copies.
sea, the largest expanse of water would have been
the mill dam, the canal, river or even just the weekly …and finally… those were holidays of a different
tin bath. I am sure young girls back then would not generation. Tickets are now being sold to go into
have thought too much about those wool swimming space. With someone having the chance of joining
costumes. But, getting older would have brought the Amazon billionaire Jeff Bezos and his brother Mark
feeling of embarrassment with mums home-made on a trip into space in his company’s first passenger-
swimming outfit. carrying mission next month. Is this a sign of what is
to come, the wow factor holiday of the future?

14 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Please tell advertisers you heard of them through ‘The Grapevine’ 15

Lifestyle & Leisure

You could be really lucky and never have any • Kennel and cattery fees: if you fall ill yourself
cause to need more than routine veterinary to the extent that you are hospitalised and don’t
visits for your pet. But should something have anyone to take care of your pet, you could
happen, at best you’ll have a hefty bill and at qualify for care by a cattery or kennel.
worst be in a position where the condition or
injury is so serious that you can’t afford to pay • Dental covers: usually only accidents will
and risk losing your pet. be covered but some providers may include
Pet insurance can cover the cost of treatments dental illness.
and ongoing care for injury or any diagnosed
conditions. Depending on your policy, these are • Death by accident or illness: if your pet dies
some of the options. you could get back your original purchase
• Missing pets: cover for when you pet goes cost. Most policies do have an age limit.

astray – either by their own volition or because • Euthanasia, cremation and burial: if the
they’ve been stolen – will help contribute to a worst comes to the worst, having these costs
reward for information or return. refunded could be a relief at a sad time.
• Third-party liability: if your energetic pooch
trips someone up or damages their property,
this element will cover legal costs and the
claimant’s expenses.

General Across
Knowledge 7. Spanish dance in triple time (6)
8. Acid found in vinegar (6)
General Knowledge Crossword 9. Funeral pile (4)
10. Chinese port city on the estuary of the Yangtze (8)
123456 11. Receptacle used by smokers (7)
78 13. Non-metallic element, atomic number 5 (5)
15. Racing vessel (5)
9 10 16. Small falcon that hovers in the air (7)
18. Long-tailed game bird (8)
19. Red eruption of the skin (4)
21. Small, roofed building affording shade and rest (6)
22. Hooded waterproof jacket (6)

11 12 13 20 Down
15 14 1. Australian term for a young kangaroo (4)
18 16 2. State of extreme delight or exaltation (7,6)
21 17 3. Heavenly body also known as Sirius (3,4)
4. Small canoe made watertight with animal skins (5)
s 19 5. Period of the French Revolution marked by extreme

22 ©puzzlepress.co.uk repression and bloodshed (5,2,6)
6. Sleeveless dress resembling an apron (8)
Down 12. Pile of waste matter from coal mining, etc (4,4)
14. Flower associated with alpine regions (7)
17. Craftsman who works with stone (5)
20. Singing jazz where nonsense syllables are substituted

for the words of the song (4)

Spanish dance in triple time (6) 1 Australian term for a young kangaroo (4)
Acid f1ou6nd in vinegar (6I)nterested in advertis2ing?StaCtealolfuesxotrnem07e7d9e1lig8h9t1o6r 2e3xaoltraetimona(i7l ,a6d) [email protected]

Funeral pile (4)

Lifestyle & Leisure

T: 01422 202191 MOT station

Victoria Road, Hipperholme, HX3 8DF MOT repairs

Servicing on all
makes & models

• Tyres
• Exhausts
• Brakes
• Suspension
• Clutches
• Diagnostics
• Batteries

Please tell advertisers you heard of them through ‘The Grapevine’ 17

Plate it Up Lifestyle & Leisure

How to get the registration plate
you always dreamed of.

Personalised number plates example 18
used to solely be the domain for AS - what
the rich and famous, yet as time you are in fact
has evolved and techniques for looking at is
sourcing and configuring clever a registration
car registrations have become that’s almost
easier, so too has the ability certainly been
for you to bespoke your reg, through many
regardless of whether you’re different vehicles
driving around in a Lamborghini and dates back many
or a Lada. decades.

The key thing to understand So while these cool limited- combination of letters and
when it comes to number plates digit plates are in scarce supply, numbers.
is there are a finite quantity in it’s not impossible to pick
circulation, and new number one up, although you may be Here are a few tips that will
plates issued on new cars will looking at paying the sort of help if your intention is that
only ever follow the standard money that would actually land your registration plate should
registration format of the day. you a car in its own right. For stand out as much as your car:
instance, when Chelsea owner
That means that all those cool, Roman Abramovich acquired Search online
quirky, unique number plates the plate VIP1, it set him back There are a range of online
you see around are in limited a cool £285,000. And yes, you number plate resellers who will
supply, and it’s a market that can still pick up old format connect you to sellers looking
is only going to shrink. it also plates for under four figures, to market their specialised
means that every time you although the trend more number plates. While prices
see a plate that doesn’t fit the recently is to spell out a familiar are usually shown and appear
current or previous format – for name or special term using a fixed, there is nothing to stop
you contacting businesses such
as these to negotiate on your
own terms.

Similarly, the DVLA facilitates
car registration searches, both
as sales and in the form of
timed auctions.

Set a budget
It’s easy to be led astray by
a catchy number plate that
ticks all the boxes. Remember
though, what you’re purchasing
here is simply a combination of
a few letters and numbers to
display on the front and back
of your cherished motor. Yes, a

18 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

personalised plate may enhance your image ever
so slightly, but it won’t make you a better driver it
won’t reduce your fuel bill. What’s more, statistics
show it probably will make you more likely to be
pulled over by police!

Be versatile
There are so many numbers that can mimic
letters – 0 for the letter O, for instance, 7 for T,
8 for B and so on. If you commit enough time to
it, you’ll be able to spell out a name, a place, a
hobby, an interest, or even a rude word, if you’re
that way inclined!

Age is important
Remember you cannot let your vehicle appear
younger than it actually is. In other words, if your
car was made in 2012, you won’t be able to bolt
onto it a number plate that begins AS13.

Similarly, in reverse, some number plates may
look great on the shelf, but for the sake of spelling
out a name it could inadvertently negatively
date your car if displaying a year that actually
precedes that of when your car was made.

Please tell advertisers you heard of them through ‘The Grapevine’ 19

Lifestyle & Leisure

Sizzling
Summer Reads

Lose yourself this summer within the
pages of these thrilling fictional offerings.

No Such Thing As Perfect taken. Starting
by Emma Hughes with her long-
The ideal read for anyone who suffering husband,
feels like they can never quite Mads, Belle embarks
get their life on track, No Such on a killing spree the
Thing as Perfect is an intelligent like of which has never
and witty take on seeking love. been seen before or
since.
Finding herself in a bit of a
rut, Laura Morrison seizes Deliciously dark and
the chance to trial Cupid, a enthralling, Norwegian novelist
high-tech new dating
service which will draw on astonishing feat given it is her
everything she’s ever done first foray into historic fact/
online to find her perfect fiction and definitely worth a
match. Along comes the read.
handsome and charming Published by Michael Joseph on
Adam who, on paper, is August 5
the dream man, but as
things start to fall apart A Slow Fire Burning
Laura may have to accept by Paula Hawkins
that the path to true love Paula Hawkins is back with her
never runs smoothly. third thriller - after The Girl on
Published by Century on the Train and Into the Water. A
August 5 Slow Fire Burning is about three
women: Laura, who is seen as
Triflers Need Camilla Bruce a troubled loner; Miriam, who
Not Apply perfectly knows that just because Laura
by Camilla captures is seen leaving the scene of a
Bruce not only the horrific murder it doesn’t mean
Based on the atmosphere she’s a killer; and Carla, who is
true story of and mystique reeling from the brutal murder
Belle Gunness, of early 20th of her nephew.
whose century
murderous Chicago, Bristling with all the twisty
rampage but also the thrills and dark surprises we
began in ruthlessness and fury have come to expect from
Chicago in of her female protagonist – an Hawkins, this latest offering
1900, Triflers is sure to make it on the big
Need Not Apply screen at some point, but for
is a novelistic now it’s worth fully submerging
tour de force yourself in this devilishly
exploring satisfying tale.
one woman’s Published by Penguin on
determination to August 31
pay men back for all they have

20 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure Underbelly by Anna Whitehouse
Journalist and co-founder of Motherpukka
Billy Summers (a website for people who happen to be
by Stephen King parents) Anna Whitehouse makes her first
From legendary foray into fiction with Underbelly. Sharp-
storyteller Stephen witted and highly topical, Whitehouse
King comes a thrilling doesn’t shy away from the problems and
new novel about a preconceptions that modern mothers face
good guy in a bad job.
A killer for hire, Billy as she tells the story
is a criminal with a of two women, Lo and
conscience who will Dylan. Lo is “the epitome
only take a contract if of middle-class privilege”
he deems his target with her perfectly
a truly bad person - polished Instagram posts
and with one more hit and armchair activism,
before he can retire, while Dylan works as
Billy’s morals are a telemarketer from
about to be pushed to her flat on a zero-hour
the limit. contract in order to put
food on the table. The two
This spectacular can’t-put-it-down novel meet at the school gates
is part war story, part love letter to small and form a friendship
town America and the people who live which has devastating
there, with a complex hero looking for one consequences.
last shot at redemption. King at his finest. Published by Orion on
Published by Hodder & Stoughton on August 5
August 3

Relax....

Advertise with us and we
do all the hard work
for you

Text Advertise to or call 077918 91623 THE GRAPEVINE MAGAZINE
[email protected]
www.thegrapevinemag.co.uk Brighouse & Halifax

Please tell advertisers you heard of them through ‘The Grapevine’ 21

Lifestyle & Leisure

‘As you like it’ Salad Ingredients

Introduction Ingredients(serves four)

‘As you like it’ SaladGo big and bold with this bright and flavoursome salad that can be Greens – A large bunch of
Introductionthrown together at the first knock of unannounced guests. rkoa(blseue,srtviceessbalefaordgurll)eeattvuecses, uecnhdiavse
Top Tips MethodGo big and bold with this bright and flavoursome salad that can be orGreaednicsch–io A large bunch of
t•hrTohwisnistothgeetihdeeralastathlaedffirosrt knock o1f .uUnasinnngoeuinthceerdognueelastrsg.e bowl Gccooorkroouraabksliern,eua,dssqdtiuic–gciesnrcbaaoThileanwairo,sdgofsallceeuruartcpotvhsueocsaoresfs,buceaconrhuldesyiavse
seRqxccGoauooarmaouassksitpnh,eeld,sedq,tu–gwvainrenoaoTgiaenwes,twnsoatfesiabcerurelutrecposhspsuoo–amtorasfmftboocaereorrsule,sy
when you want to use up or four individual bowls, layer octwoiRseluqxootrauagimarlselesttpdhttele,eedpns,tedwvpareepnoorgaeaersesstntwneadtoedibrerseltiwetnwsspeouooe–lmttiavmeftooerers,
Rtawwo vreegdetpaebplpeesrs–orA tfweow
Top Tips Methodand fridge, so don’t be afraid hcaonudrfguelsttoefs yroausrtfeadvoinuriotleive
leftovers in both your cupboards the greens, followed by the raowil tvielgl tseuncdherasansdlicsewd eet
red onion, grated carrot,
grains, followed by roasted ceRlaerwy, vteogmeattaobelse,sa–vocAadfoewor
fehnannedlf. uls of your favourite
•toThmisixisanthdemidaetachl .sIaflyaodufolikre v1e.gUestianbgleesitahnedr ofinneallay,rgraewbowl oaDzirsrfcrrpeaeeepydbwnlsyeoans,grosveiyunnifel,crr.iggteotvsno–asihmn,unagcOddaihrgtrnaeloreetesaemetssscdti,ounesnpag,clivaCcosoreafurcdoecaatshd,aor or
PfggorrDoazriiuoirsllrpllrteeepybeddssyoialsn,gisctciuniufhec–rrngditecavsAk–baihensnonctaiOddlehiegrbnaodelrkreieescesmetseacgtisoounegotrnpg,sfsf,Cotosfoafuuofercuaushr,ar
wthheeningyoreudwienatnst, toheuyswe uillpgo voergfoetuarbinledsi.vidual bowls, layer
TPoproptineign––AAddchaoilcitetleof tofu,
letoftgoevtehresr.in both your cupboards the greens, followed by the crfuonucrhslwicietdh bonoielecdupefgugls,offour
togarisltled tpuunmapksitneaskesedosr, four
a•nWd fhridzzgeu,psao zdionng’yt bgereaefnraid 2g.raAidnds,dforellsoswinegdabnydrgoeanstleydtoss slgivrielrled cahlmicoknedns,bcrehaosptpsed
tgoomdidxeassnddrmesasticnhg. iInf yyoouurlike tvheegseatalabdle(sfoar nbdesfitnraelslyu,ltrsauwse peTcoapnpsinogr –toaAsdteddaplinitetlenuts
tbhleenindgerreudsieinngtsw, thhaetyevweirllhgeorbs yvoeugrehtaabnldess).. crunch with one cupful of
tyooguethhaevr.e at your disposal, a cup toasted pumpkin seeds,
•oWf ehitihzezrumpaayozninngayisgeroerenGreek 32.. FAindadlldy,retospsisnaglaadndwgitehntthlye toss slivered almonds, chopped
gbyoysady•aoofloaeoniguYnebdnglcoauinidhtdhguudrheeaoretsbrestcvrvaotrsaaiieuanenwmnndsbdsdadrli.ealinteevieineygtyisidohoitsotthurwehnhiuneaprenerhgrllsraladamyerriitaitnsarsedievdewwp-eyveduoopoeglgptsreruehaaanGrhtiorrhslde,lfrliieeiiarcctnnbehgoocskerrup pthroetesainlaadnd(fotorpbpeisntgr.esults use pecans or toasted pine nuts
aonnchthoevimese.al you are serving. your hands).
••YIof uuscinagn teoituhgehr gsererevnesthsiuscihnas
arabwigkbaolew, lminasthsaegmeidthdeleleoafvtehse 3. Finally, top salad with the
dfiinrsntewr ittahbolelivoer opillattoes-uofptetnh.e protein and topping.
salads individually depending

on the meal you are serving.

• If using tough greens such as

raw kale, massage the leaves

first with olive oil to soften.

22 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Recipe Tip
greIefRnusessincugcihptoaeusghrTawip

okllaeigvlakerevae,Ieleofmesni,luasfmtsisrosissnaautssggcsoewhafttiogttaeuhehsnge.thrhaew
leaves first with
olive oil to soften.

Please tell advertisers you heard of them through ‘The Grapevine’ 23

Lifestyle & Leisure

Canal fishing – good
for the soul

Living in Yorkshire gives us Perch: from clear rural canals to city stretches, the
access to some of the most humble perch is one of our predators. It’s also very
beautiful scenery in the country easy to spot, with its dark vertical strips and reddish
and as we move into Summer fins.
many people are taking
advantage of the better weather Carp: most canals now have carp and they can get
to spend more time outside. very big. You’ll need experience to catch the bigger
One way people can enjoy the ones.
outdoors is by canal fishing. This
is something that can be enjoyed Tench: canal tench are beautiful with olive green
all year round but the longer, bodies, small red eyes and a large tail.
warmer days make sitting by
the water and enjoying being in Dave from Brighouse-based Calder Angling Supplies
nature more appealing to many. told us “It can be fairly cheap and easy to get set
up to try a spot of fishing on the canal, just drop in
The Canal and Rivers Trust or give me a call if you have any questions about
have written several guides for getting out fishing on the canals. There’s lots of
beginners to help get started or great spots locally in Brighouse and surrounding
you can contact Dave at Calder areas to get started.”
Angling Supplies on Bradford
Road, Brighouse to have a chat. More information about Calder Angling Supplies
The Canal and Rivers Trust make are detailed on this month’s front cover
the point that fishing is about being outside and
close to nature as well as finding space to be calm
and quiet. Sometimes you’ll catch a fish and on
the best days you might catch several of different
species but if you don’t you’ve enjoyed quality time
by the water.

Our waterways are full of fish, about 30 species,
even some rare and protected ones. And we’re
not talking about little minnows here, fish
like bream, carp and pike can be huge.

If you’re new to fishing you’re most likely to catch:
Roach: very common, they have a silver body with
grey-brown to orangey-red fins and like to swim in
shoals

Gudgeon: one of the nation’s favourite fish, these
little blue/grey fish fit in the palm of an adult’s hand
Bream: nearly every canal will have bream.
The bigger ones are dark brown or greyish
with flattened sides. Young ones are known as
‘skimmers’ and are silvery. Again, they’re usually
found in large shoals.

24 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

sixth.trinitymat.org

STANDARDS
MATTER.

Secure your place on
results day!

When: Proven track record

12 August 2021 99.7% Pass rate
Outstanding range of
Where: courses
Town centre location
Trinity Sixth Form Academy
Northgate House Direct transport routes
Halifax, HX1 1UN

Doors open - 9:00am

Call us today for more information! 01422 240 033

Please tell advertisers you heard of them through ‘The Grapevine’ 25

Lifestyle & Leisure

Get help avoiding scam callers by signing
up to a Priority Services Register


Scams come in many forms and involves uninvited you can always check the person’s identity by
contact by email, letter, telephone or in person. requesting your password.
False promises are made to con victims out of
money often through doorstep calls to people’s More benefits for customers!

Yorkshire Water
homes under the guise of legitimate business or supply 5 million people in 2.3 million homes – so
trade.

Sadly, during the last year of lockdowns, its reassuring to know if you are on the Priority
scam calls have risen steeply but one way you can Services Register, you can also ask for preferential
take action to protect yourself is to sign up to a treatment if there is a supply stoppage, flood or
Priority Services Register.  Most utility companies other emergency.

Their website has more details
have set them up and Yorkshire Water is leading the on how you or a relative could benefit from
way in aiming to get a lot more people aged over 65 the register.  It’s free to sign up and quick and
to join their register. easy.

Sign up now  or call 0800 138 78 78 

Sign up for the Priority Services Register

Yorkshire Tell your friends and family about our advice and
Water’s Priority Services Register is free to sign- guidance

If you know someone who would benefit
up to and supports customers who are worried from our news and support for the over 50s, then
about scams by enabling you to set up a security simply forward this newsletter or the link below to
password.  This means if Yorkshire Water need to our newsletter sign-up form.


contact you, either by telephone or door-to-door

26 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

Please tell advertisers you heard of them through ‘The Grapevine’ 27

Forever Fashion Lifestyle & Leisure

How and why you ought to resist the lure of fashion. workshops are notorious for
their poor working conditions
“We are living in a material generations it has never been
world, and I am a material easier nor cheaper to live out and paltry pay, with the
girl,” crooned Madonna on our wildest sartorial dreams: 2013 Dhaka garment
her 1984 record about the designer brands are more factory collapse in
earthly delights that come with affordable, there is a wealth Bangladesh – resulting
pursuing wealthy men. And of styles and colours out in over a thousand
while such a sentiment would there in every size imaginable deaths – proving to
perhaps not be celebrated – thank you internet – and so be just the tip of the
today, the literal truth is that you no longer need to schlep microplastic-inflected
we are now living in a material to the high street shops with iceberg.
world thanks to the rise of fast their jumbled rails and badly lit But with clothes being
fashion. changing rooms when clothes, usurped only by food
shoes and accessories can all and water in terms
The UK alone sees on average be delivered right to your door. of necessity, it can
300,000 tonnes of textiles sent be difficult to source
to landfill every year, and with Of course, such convenience garments that are genuinely
more than 60% of fabric fibres and value not only takes its low impact. Even cotton,
being synthetic you can bet toll on the planet, but there is which is a natural fibre, has
those clothes are going to be a human cost as well. Textile other drawbacks such as the
hanging around for a very long 10,000 litres of water it takes
time. These artificial microfibres to produce just one kilogram of
also end up in our water raw material. The solution then,
systems eventually making is to focus on sustainability. For
their way deep into our oceans example, buying fewer items
where they are eaten by fish with a view on quality over
and other marine life. quantity, or donating clothes
you no longer wear. Small steps
Yet despite the irreparable that can make a big difference
damage caused by our desire to to our planet.
look good, fast fashion is hard
to resist. Compared to previous

28 Interested in advertising? Call us on 077918 91623 or email [email protected]

Lifestyle & Leisure

HOW TO RESIST marked for landfill –
FAST FASHION such as cola bottles,
shopping bags and food
Only buy what you packaging – is diverted to
love be transformed into shoes,
Tempting as it may coats and workout wear.
be to buy new
clothes every payday, Consider provenance
you may find more If your new t-shirt
fulfilment in the long- cost less than a cup of
term by saving up and coffee, you can bet that
investing in pieces there are compromises
that will last and being made during the
that you will treasure manufacturing process.
for years to come. Fortunately, you don’t need
Remember, true style is timeless. to spend a fortune to find peace of mind, with
several leading fashion brands becoming more
Invest in vintage transparent about how and where their clothes
The beauty of good quality fabric is that it lasts. are made. Just do a little more homework.
From super-soft cashmere jumpers to impeccably
cut denim jeans and piles of retro tees that get Find eco-fabrics
better with every wash, vintage shops are the Tencel (made from sustainably sourced natural
affordable antidote to throwaway fashion. raw material wood), Econyl (regenerated nylon)
and Piñatex (a leather alternative made from the
Seek ‘circular-minded’ brands leaf waste of pineapples) are just three examples
As there is clearly a market for synthetic fabric of sustainable fabrics that are set to shape the
in fashion, it makes perfect sense that plastic future of fashion.

Don’t turn
your back on

potential customers

Our loyal readers
are your next loyal

customers

Text Advertise to or call 077918 91623

[email protected] THE GRAPEVINE MAGAZINE
www.thegrapevinemag.co.uk
Brighouse & Halifax

Please tell advertisers you heard of them through ‘The Grapevine’ 29

Sun Savvy Health, Beauty & Wellbeing

Your guide to protecting your skin
throughout the warmer months.

Thanks to our somewhat Fortunately, many skin to burn
temperamental climate, us Brits makeup and than if you weren’t wearing any
have a tendency to flock to skincare brands sunscreen at all. So if you’re
beaches and parks at the very now include wearing 50 SPF, it will take
first hint of warm weather. sunscreen in their 50 times longer for your skin
moisturisers and to turn red than if you weren’t
In a flurry of excitement we foundations, making wearing it.
put on our shorts, skirts and it far easier to include
swimsuits, baring our sun- facial protection in your Secondly, make sure your
starved skin to the glorious, day-to-day routine - it sunscreen offers ‘broad-
golden rays often without may seem like a strange spectrum protection’ rather
a thought of the possible concept to wear sun cream than just SPF which only
consequences. And while throughout the year, but measures your skin’s ability
exposure to the sun does ultraviolet rays are always to block UVB rays – these
have positive benefits to both present and penetrate clouds. rays damage the outer layers
physical and mental health, it of your skin and can cause
can also wreak havoc, which Cost sunburn and even blistering.
is why taking a few simple As with most things in life you Broad spectrum products,
precautions will help you make get what you pay for, and it however, also protect your skin
the most of those long summer really is worth investing in from UVA rays which are the
days. some top-notch sun protection. more insidious of the two as
they penetrate your skin at a
Preparation Firstly, it is important to deeper level and are proven to
If you want to be sun savvy, understand what the SPF factor contribute to the development
then preparation is the key. means. Contrary to popular of skin cancer.
Just as you wouldn’t leave a belief, a higher SPF doesn’t
new-born in the sun without mean that a factor 50 offers a
protection, your own skin is also higher level of protection than
more vulnerable after a winter say, a factor 15. This is because
spent locked inside, which is the SPF number tells you how
why wearing a good SPF is much longer it will take for your
vital.

Be individual
Also, be sure to choose a
sunscreen that is tailored to
your individual needs. If you
have sensitive skin or want to
use it on your face, then invest

30 Interested in advertising? Call us on 077918 91623 or email [email protected]

Health, Beauty & Wellbeing

in a product that is sympathetic to those needs. the appearance of ageing and numerous skin
Or if the sun cream is for your children who are cancers. However, if you must tan make sure to
spending the day by the pool, make sure it is do so slowly, sensibly and with a lot of soothing
waterproof and easy to apply. moisturiser afterwards. Your skin will thank you in
the long run.
Be realistic
While sunscreen works wonders, there are
areas it cannot protect, such as your scalp and
your eyes. If you’re not a hat person you may
want to consider a head scarf or bandana, and
when it comes to your eyes, well… who doesn’t
look cool in a pair of sunglasses?

For really scorching summer days you may
want to consider avoiding the sun altogether,
or at least staying in the shade as much as
possible. The sun’s rays are at their hottest (and
therefore most dangerous) at midday, so early
morning or late afternoon sunbathing is far
safer. And always try to avoid sleeping in direct
sunlight, particular if you have a friend who is
nifty at sun cream art!

The truth is, there is no such thing as a safe
suntan. By its definition, it is a positive side-effect
of skin damage and does contribute to both to

ONLINE WELLNESS HUB - PRENATAL 31
POSTNATAL • ACTIVE WOMEN

Are you pregnant or post natal and looking for
ways in which to understand and enjoy your
new body? My online wellness hub offers three
programmes for those that are in the second
& third trimesters, those that are newly post
natal and those who are from 1
year post-delivery onwards.
Based solely online, these
programmes are the most
flexible way to reach your
goals, allowing you to join
in when and where it's
most convenient for you
and your lifestyle.

Contact: Sharon at [email protected]
www.sharonporter.org.uk

Please tell advertisers you heard of them through ‘The Grapevine’

Health, Beauty & Wellbeing

Award Winning Style from The Vinery Hair Salon

32 Interested in advertising? Call us on 077918 91623 or email [email protected]





























Homes & Interiors

fHwwwFTcwFofaiaoFgFrwYifasftwgbtinbwiwYaanoTHsocoorarrssssnnhoohaaaauuopooopeerdeueudrooioiouatatueaaaiiiieahhccrrrtrtaadndnllllggnnmnnmeetddeeiituullllsserrellnaanttnnllttrrbnbssneegiwwiguuooeecctteeybbyttaaididrrclclvvccddtttteetyirtyir,,uuiieeddidiiidriirooaaiieeoteetopspsnnooggaannnnaattooee,,,,bbeeaaooiiiieoeoiiuullllnlnlllnnmmffaalglgggllnttnllaaeooeoollbabassnnssrrllrrennesseeeeffyyggssrroofasafsttasasttususeemmnntt,f,fttciicddiiddookkhhssoosssspcpcoommeelttlddllttcoocbbffddttiieeiippssiieeoottllrreerrttaacsscnnoosseeaaeeeennooririooccoottiibbnnuummrrrraaccee,,ssaa44ccssllssssoooosshhggmmeewwuwwueeeehhiiiiaeeaccnnbbmmoorriissootpptttrreellhh..bbggcciiyyoomiimddttuussnnaaeellssggfftteewwoossnnooeettUUlblbillinnffhhooreerrrdtdtuaauiieerrsshhiiiiooarraaaeewwiiooyyccnneeiinnyysddsoottttccqwwqddppaatlltyyaannyyggttee..raarddssuulllligigttttuutteeaarr,,yyyyoobbooooccndndoolleetthhaarraaddaakkmmaassaassddrrffooeooerruuttooniineeoolleeggttzzkkr,,rttooaattrrnnnnllll,,uunqnqrrhhuuuuyoyoooaaaaieeirrsiiseeiinnttmmrrrrddnnggttnn’’uuvvttoorrssttoorrnnaallkkeerrtteessllddaaaaoonnaauuggllggeettiitthhoouuhhff,,ddaaeerrhhxxttuurryyrreeggpp,,nneebbee,,cc’’ssfflcclssWWaaddtootaaaaaassssiihhoowweeaattoonnhhee..rrhhwwssddttnn..mmiitteemmmmeerr,,oo,,ooaaCCee..IIaaooddIIssgghhiiwwbbooffnnaallnnttccppbboott,,FFvviioowwaa??11aaeeeeeehhrriiuuaalliiddssddllggoorraallrruuiillrrnneehh55rrtteeiiooeett--aannttnnuuggrreellhhddddnnyyddww..lleemmaatteeoossnnyylleettccuueeggeebbffeeooaabbooMMaaooiiuussnnttirirllddhhrrrrnnttrroonnuuhhaaoottppaaeewwtteehhggooiiaaiiootteekk22wweeooiiiibbooddrrrrssaayyoollnnhhuuoossrr--aassddrr00aaaarrhhyynnrriiooeewweerrssssggttggffnnttiimmeeooaaffeessbbnnmmffaaeessww,,ttpppphhiirriiiiddppffuuccttrrvviissppll..iiggsseemmeehhffrrrreeoocceeaaccwweeaassoonnffaaaaoooo..llvvwwooeewwaayyooxxeeqqeellddrrccbbppoorrWWuuiiaasseerr,,uuooiinnttppcciiuuffrrkkeessmmeeeeffllaahhaauu--uuiibllbnnuuyyttllaa,,hhnnttrreerrlloobboossssoouuuunnttrrlliirriiggeecclllluulleellrruueeuummttiioowweeyyeenn..rrll,,ii,,rrccddttiiggllkkll This high-quality garden building is one of four designs, each
cTuhsitsomhiigsha-bqleuainlitytegrmarsdeonf sbizueil,dsintygleisaonndeboufdfgoeutr.dTeGsOig4nsG, aeradcehn
FCthooerpgllTToeahhycriissadHssluueuuXsnnnmmh3iiqqoommuu0wffieeeeTrrrggPchhoaaeoorro|uuddassmee0neenn1dagg4rraaootg2rrooEadd2mmnreed3nnghhe5iaappnn5ssooe4ddraae,,2orrr££5oees11mmm88Woo,,99ivvon99aar55sbbk,,pllseelliii,mmrddWaeeeetsslliaaaokkcckntteeeoo..fpp–ccioo..ev..MMluuidskkeei..ddRtiiduumm, customisRaobolemi,n5tmermx 4smof, s£i2z5e,,2s4t5yl,egarenednbreutdregaetts. .TcGo.Ouk4. Garden
www.creatingspacesoutdoorliving.com
Room, 5m x 4m, £25,245, greenretreats.co.uk.

ossdtswcsoDouafropubsCyicMopytMswtdbaioysDuiyrfsiouotCnnnnhrhhrheetoothhittlooilnreraffrenpspeaebsrboozieeooiozottrrrrooeeeeiiggrreeeuueuucceeuguguuvsdvdsttaananaeeeessnsnssstmmhthrruuaapeterdtdprrricciccogogntenteeiiellssttnnwrwrnnttgggglleeppsstttthlhlaoiaiouufhrfhryyggrriioogmmuuugaauffeellrllrddnniooissaoeeoaeeoooaaottrcctrtsseeaaooyypparrlrrlahtiithsse-eee-uussnnaattoorrrrryryeeeemmrrowowyyhhmmririaaddiiciicbbssrrnnttddooggnnnnffssddssttoouuooppiiooiiiitltl’’eehhddhhtteeeenneessissiibbiaallssggcceehhuuyyhhggnnueeuiinnssaaaaoonnppeenn.ss.dhhdllrrnnoaoaiieehhnnaeeaseesnniittggssnnnnrw,rw,eeYY,,ttnonouttueewwuuaatete’’ppsseeppeebbee,,hhrwrwaaaaii--iioossrroo55oo..hchcttlliioobbccoorryyuuiieeoonnbb,,nttnlluuttofofebeb00oonnoeoeggoottooooeehhssffiittddwuugwgaaddiilleerrhhaa%%ffdpdpooaaddmmiiccuuttookookaattttnnttwwrraaccppyynwni,,iwiiaarraaiihhuuttssffnnoonnnnccddwwkkahahoonnlleeooaannaannetetttiiaaghghppnndgdgiiooeelleeneenuuffiieeff’’llllddppnnll11e,,eoottllssffoohhnnvvlldd--rryyffhhnnyyttuubboollssnn55ccwsswooppsshhbbooaaeeccooaoaorraatteeoooouukkciiciiiirruu––eeuuoooovvuunnrrththnnnnuuruurssvvffrrnnaaiiyytteeiiwwrrununoossntntffwweeggggqqeerrooyyaaioioiibbttccaaeesstnntccnniiccfrfriiououiiuuooiddibbnnrreennllaaaannppeettttttnnee,,ooeeeeeeyyaahhoossuuiiueeuggrrccggnnllddeettccttoonncc..ssllaarrhtthooccdeedsosohh,,’’oorrllhheeyyppaatt,,pupuccYYttooddeemmoouumgmgnneeooaawwooeedadarreeuuiireeruuooccoouummnntteeeessfflluuiirrnnsusubbiitteessccrrllaashshuussmmvvllceiice--iittmmllddrrdsdseelleerrhhuudd..lleeaaddststooaaiilliiaaiiiimmttuueememewwttllnnaaeeiiiioonnaaiimmiibbbbttoolloorrnn‘‘ssooeedd,,ddaarrppggrraaeennddnniiuullcciinnssddeeggrrssseeseettiiaaiikkeehhppss,,ccnnnnaaeeiiii..tttthhaall,,eeeeoorroohhddeeii––ddbbrpprggggllllddttAAnnoommttrruuuuxwwxnnrrwweeoorriiuuooaaoottaaggrrnnttttnnnnxxacaciihhoohhoohhiitttteeiinnuuuuooddttggddttuutteeeeyyeecncntteerreeuuwwnnttwwnnrriieeaaww..rrnneeyylhlhllttttoorrddyyyyddffiitthhddiihyyhoottddeeooooooiiararssiill,,eeeeaaeeuu––bbllttr.r.nnttrrkkeehhaahhiimmrrddrrllrryyttaaeeeeeeyyeell

By Katherine Sorrell
By Katherine Sorrell

Please tell advertisers you heard of them through ‘The Grapevine’ 47

Homes & Interiors
48 Interested in advertising? Call us on 077918 91623 or email [email protected]

Homes & Interiors

Please tell advertisers you heard of them through ‘The Grapevine’ 49

Homes & Interiors
50 Interested in advertising? Call us on 077918 91623 or email [email protected]