TELLING IT AS IT IS INSIDE
Long road to
ON TUESDAY FEBRUARY 9, 2021
2page recovery for
No. 7717 PP 2644/12/2012 (031195) www.thesundaily.my travel, tourism
industries
page A year to
4 achieve herd
immunity
ALL LIT UP ... Fireworks were lit
to mark the annual lighting ceremony
of the iconic 130-year-old Kek Lok Si
Temple in Air Itam, Penang on Sunday
night. The ceremony, which was held
without public attendance due to the
movement control order, was live-
streamed on Facebook.
– BERNAMAPIX
More leeway
sought mooCrheinfaemseilgyumildesmabsesroscaialltoiownewdaantts
reunion dinner or to travel together
█ BY NICOLAS ANIL household members in the previous ruling. 10km apart, it would be an inconvenience.
Kenneth Chew, who is Federation of There must be clearer SOP on this,” he told
[email protected] theSun.
ETALING JAYA: Chinese associations Malaysia Chinese Guilds Association “We are almost a year into this situation. I
have welcomed the government secretary-general, said while the new am happy we can celebrate with our families,
decision to allow family reunion regulations are appreciated, they are still but I think more leeway should be given.”
dinners for Chinese New Year, but vague. For last year’s Hari Raya Aidilfitri and
feel more leeway can be given to the Deepavali celebrations, up to 20 people were
community. He said even though 15 immediate family allowed for visitation at one time.
members are allowed to gather, the rule that Chew is hoping that a similar Rap star in
The new standard operating procedure allows no more than two persons from the decision would be made for the Turn to the making
(SOP) announced on Sunday means up to 15 same household to travel together in a car celebrations this Friday and Saturday.
immediate family members living within a makes reunion a challenge. —
10km radius are allowed to gather for reunion “The norm for Chinese New Year is
dinner, as opposed to only immediate “If only two persons from a household are page 2
allowed each time, we must make a few trips
to one venue. Even though we live less than that the first day is usually spent with
2 theSUN ON TUESDAY | FEBRUARY 9, 2021
NEWS WITHOUT BORDERS
BRIEFS NO CHARGE FOR Long road to recovery
BPR APPLICATIONS
KUALA LUMPUR: The Inland
Revenue Board (IRB) has confirmed
that applications for Bantuan
Prihatin Rakyat (BPR) is free and no o Travel, tourism stakeholders brace for arduous crawl MCO brought the industry to its knees again,
charges would be imposed on to bring financial figures back to the black and with the recent extension, average hotel
applicants. In a statement occupancy is expected to be below 20% for the
yesterday, IRB said it received entire first quarter.”
complaints regarding the existence
of some quarters who have been Yap added that if survival plans are banking
charging a service fee to fill up BPR █ BY SHIVANI SUPRAMANI solely on the domestic market, hoteliers will
application forms. “IRB has never [email protected] increasing cargo fleets. need to adapt and compromise on room rates
appointed any party to provide the PETALING JAYA: Stakeholders in the travel and “This could be a result of higher demand for to remain attractive to the domestic market.
service of filling BPR forms. Each tourism industries remain cautiously optimistic
application received online or of bouncing back later in the year despite being cargo freight. The increase in cargo “Hotels will need to take extra initiatives to
manually will be reviewed brought to their knees by the Covid-19 transportation has been tremendous, but you assure guests that it is safe, with various SOP
according to the prescribed pandemic. must bear in mind that facilities at the airports and added precautionary measures during this
procedures and no special have to be upgraded to handle greater cargo period,” he said.
treatment will be given.” For Senior former aviator Jen (R) Tan Sri volume. That is additional investment which
enquiries or feedback on BPR Abdullah Ahmad predicts a recovery for airlines airlines cannot afford now.” “At the same time, many are already
applications, the IRB is reachable by the end of the year, but this depends heavily diversifying its operations to include more of
via its Hotline at 1-800-88-2747 or on the domestic sector. MAH is also banking on domestic tourism to other components such as food, space rental
HASiL Live Chat and its official achieve recovery by the fourth quarter. However, and even merchandising, while meetings and
portal at Malaysian Association of Hotels (MAH) chief Yap cautioned that domestic tourism has proven convention are expected to play a major role.
https://maklumbalaspelanggan.ha executive officer Yap Lip Seng also expects to be highly volatile, fluctuating along with
sil.gov.my/MaklumBalas/ms-my/. domestic earnings to be the main revenue movement control orders (MCO). “Having said that, these are highly
– Bernama generator to keep hotels afloat over the next few dependent on the overall management of the
years. “Domestic tourism was the segment that pandemic, the situation is fluctuating not only
EXAM BOARD: SPM helped hotels survive 2020,” he said. because of the implementation or extension of
FORMAT UNCHANGED They were commenting on a report that a the MCO but also the loss of confidence over
rebound in air passenger traffic is unlikely this “Through the months of June to September, the management of the pandemic that is
PUTRAJAYA: The Malaysian year. Singapore-based director of Alton Aviation hotel occupancy slowly picked up from below making it literally impossible for businesses to
Examination Board (MEB) Consultancy, Joshua Ng, said long-haul travel 20% prior to the reopening of interstate travel in plan or even prepare for the future or anything
yesterday clarified that there are no may not properly resume until 2023 or 2024. early June, with a peak of 42% on the Merdeka beyond two weeks.”
changes to this year’s Sijil Pelajaran Day weekend last year.
Malaysia (SPM) examination Abdullah Ahmad said recovery is possible if Yap pointed out that it is highly unlikely for
format. In a statement, MEB said a focus is directed at the domestic sectors, starting “Occupancy dropped again when the the hotel industry to bounce back by the first
newspaper report related to with flights within the country once the national number of Covid cases spiked in early October half of 2021.
purported changes in the format of vaccination plan is completed. as various stages of MCO and restrictions were
the SPM examination is not true announced. The government eventually “Without international arrivals, or even any
and the board has never made any “The airline industry may not be able to reopened domestic tourism on Dec 7, allowing forward blueprints on reopening borders to
confirmation on the matter. It said make a comeback by the end of this year,” he the industry to gain from the year-end holidays targeted groups, the hotel industry will not
that the report, which was told theSun, but pointed out that many airlines and hotel occupancy peaked at 43% over the recover anytime soon. The World Tourism
published in a Malay-language have turned their focus on enhancing and Christmas and New Year weekends. Organisation had estimated two to four years
daily, has caused a lot of confusion for tourism recovery. Malaysia is quickly sliding
among the public, especially to “However, average room rates were lower into the further end,” he said.
SPM 2020 candidates. “If there are across the country, by 30% to 70%. The second
any changes to the format of the
SPM examination and assessment MCMC monitoring broadband issues
system, MEB will inform the public
officially.” On Feb 7, the daily KUALA LUMPUR: The Malaysian learning sessions due to poor internet access improve broadband coverage, and the process
published a report entitled Wajah Communications and Multimedia and having only one device to share. is expected to be completed this month.
Baru SPM (new SPM format) on its Commission (MCMC) frequently addresses
front page, with accompanying internet connectivity issues via field activities. “MCMC has taken the family to the On reports about orang asli pupils in Baling,
articles on pages 2 and 3. Community Internet Centre in Felda Chuping, Kedah having trouble participating in home-
- Bernama Among the issues was a problem faced by which is equipped with necessary devices and study sessions, MCMC said investigations
four siblings in Kampung Rambai, Padang other services for the community.” revealed that the issue was not due to
Siding in Arau, Perlis, who were unable to broadband coverage but the lack of devices.
participate in home-based teaching and MCMC has also directed service providers – Bernama
to optimise their networks in the area to
Ai showing some ‘Have SOP similar to
of his creative works. that of other festivals’
– BERNAMAPIX
our own families, and the
second day visiting our
spouses’ families. We don’t From
know if this (SOP) will
change, but we are hoping front
page
so (to allow visit to spouse’s
family).”
Buying new clothes is also a tradition,
but the Chinese community has missed out
this year as boutiques in shopping malls are
not allowed to open.
“If night market traders are allowed to
sell clothes, I would think it would be easier
for crowd control in malls than at night
markets,” he said.
Chew also lamented the fact that his
association, which oversees Chinese small
and medium enterprises, was not invited for
the National Unity Ministry meeting to
discuss guidelines for the upcoming
celebrations.
He said a survey would have sufficed to
find out the sentiments of the stakeholders.
Gowri Thangaya, who is secretary-
general of the Malaysian Consultative
Council of Buddhism, Christianity,
Hinduism, Sikhism and Taoism, is also
hoping that visitors would be allowed, with
strict a SOP in place.
Coffee art for a good cause “It is only fair. When we succeeded for
the Hari Raya and Deepavali celebrations,
why not for Chinese New Year? By allowing
KLUANG: Coffee is a lot more than just a drink, management of the asociation. PKH coffee shop in Jalan Mersing, SJK(C) only a certain number of visitors at a time
as it can also be used to produce stunning art. Each creation takes one to two hours to Chong Hwa 2, Kluang Railway Station and a and having intervals for sanitisation, I’m
popular chicken rice stall at the Kampung Paya sure it can be done,” she said.
Kluang Hopehome Welfare Association complete, depending on the complexity of the Market. Gowri said her association members
treasurer Ai Zhi Yong, who is also co-owner of a drawing and the desired tone of the coffee. certainly welcome the new guidelines for
cafe, uses coffee powder to produce festive- “Since the outbreak of Covid-19 and the reunion dinners.
themed drawings. Last October, Ai produced 10 paintings implementation of restrictions, the cafe and “It is better than nothing. In Malaysia,
depicting iconic buildings to raise funds, and association have been affected, so we need to festivals are times families can get together
Ai has produced 10 Chinese New Year each was priced between RM250 and RM300. find other sources of income for the survival of and cherish each other’s company. We have
drawings that feature messages relating to those in need,” he said, adding that the cafe also come a long way since the first MCO and
Covid-19 standard operating procedures. Three of the paintings were sold at RM680, received food packages donated by the public understand the importance of adhering to
including one bought by a people’s daily, that are distributed to the poor and the the rules.”
He said the drawings will not only adorn the representative here, he said. homeless in the community. – Bernama
cafe walls, but will also be sold to raise funds to
cover expenses for the less-fortunate under the Among the 10 paintings he produced were
those of the Dewan Jubli Intan Sultan Ibrahim,
3theSUN ON TUESDAY | FEBRUARY 9, 2021
CELEBRITYCAUSES undergoing Sintrtueynssiwveasyoing–sapCitOrreaUdiRntTionEgSoYpineORnFisOJhOhikJaOensaShJT,oRInaUdfYtieaSr. 15theSUN ON WEDNESDAY | APRIL 15, 2020
LIFESTYLE
iTnhneecraplel oafce
Stars who don't
wwhoeeitrlJhlonchaejoelslrSisnktagrnnutodoywshhlefeeeadlplltginpeitgeiwnoapsle
settle for less
S bhCoeodlupyldbimogoaasrgdteey?noiunrgistamsw“optYaadiIdkpeeompmstbslifntu’acnoiashuospoorstCywaoeetcsusatwdDhoeprluaSalhmasowwiat█neaeftern2tnheuTalihcohantonlSlodne4iheelnceilehronroBictdlnnhdsdnaailisen.ttaeahwnlhnYnhyugeuehrhca,sfrsestiaeoeoggoschtItofceiaiwSsosboth’‘tsellsadi,uwtmusHwtrerveelsn’o.s.dfluisneaeeecerrsaesarvocSuIeEotelpasnasrsadNnseamlhptRnpc-ypedlnsybrgsDshnliswereao‘iulteehnteeeaeltoisafoawRheninrkdoley?sHehcdnnnhgseseAsditslpoaobiryfoglsdtosirJeknoniajmulmemoueessaSplodevehrom.iheordndjtieAsousoaaav’pstbmasdthnT’lhlr(mnespiiasaevaettenOec(,HmeosegplenyiaDwreOfen.rwuhIIhdai-wysscAynlhigoebhHrsaeyehJae.feduB.x’aefeanarrdto)eorn(eiSoph.aiAn.slyaoaKetwirthlthmwaaJhnarLJ,cinsoyoonoutenaJeAgioiaedljofsnrgnbaeoordnNcoeeopAntkessmceSseSineiduvleiianst.natsytnnneihesioturcacaotienggswuescDmnrrdeidutterioyviai,TgribisintisoenennswdhuoofVeaacypi)icw-snwcstnahr,)ooyre2hoiuicahehdeongvat0pqeiuetsh(narYaiaseegvil1rutrwecwenndn“ne,eoerteaTrnHr7nnhemeIetoyoeysdurhgyd“dAV’HrdiaposaytWmomwrtoaIertgesoAo,soglttochpewoutpuphtcd’ikinvsereo“shuhoirnaseW&waorimt.fyainnmIskmamyh]rle.riepoensstsgtnmniosaedin“ieiohcctdtbhIhexvnprdetsl,nilttgcceteonbdSIdatfrl.uenhutuegwaetreeeoolea’oeoeokidahfunutskoyepduBvttradortlaamiaaburtcswamlih“u’ioyeoandncruedysoacsoncaiutIlnltltlihywIrsiooi.aoieyweelauoaiigotanih,nnlpttnstismoplgsnneiesufnItwogndyhtyrnerlIeunowdgtfeiedptienahtpadoglgtw,yaneryrocsuge’ygbfompgenisearrteehede,hootenpesttmntsgglhohopHlftmadeyeyRtouoRheirhheelotlureemtagbMrhfeboeatdsnodepbrhlorrepasoeeonfaakeaaohtrm’ytlvteateoaggniyiertodwoeieanatheimiulitueslefryhewnnteehkiesnaainebai,kiflieshorlhrnilyvcemboaennvdchennrtIiieoglnieatsilsims,tsnupelfetepsretgyouyeuhsgadyaihgewyfrripdnhealekwspretamgsnoloiliwaaneliynteid,octtarwnghnermanalin,nchnpodirdshuirdaeaanitylkoronereacntnmapyamgtesiJitmrSoeotaaaieilnrlennpkrnaaotdsese.ktilenpo.tllbaiadt”tlsaywiybet.nheunndihpoph.leuiiloumn.sriafnetrnnbbcsinitaopnseehhaggslwIa1esienidswetdTatthsoaiegwatdnnuefttoussgl.hhilneao9nesoeteieonawtdeltd,andfegtetwgdoIsup,ssottereehmepsueoentultkdtilrhariwtgo.?eablnahhrwisteanynepstoIttfinnricysofeidceesiroeI.pueteniomnhyisesraermioopoeaumt[e,oheoeq’,rspofsltIasp’ntgsrsagteglsusntsltasmtnnnaw.wo.aewuo”miptrelolonirt’yresitstltclngyIssanrngnithdrtaeoshihsoiIhiitho)ooletoilkohntlnhnowheeeebydsaeeu.evvhiarehecausrdemvsisafrtuggsetwroiAboedsnntailaivnttaregcsescasthhlhawulrtlutaYos.odseddytpoeig?hrynyfd,?dghhhoseoaesognliettucoto.eoeauasorteett,eheeevceawaah.tpiIohuepedrthulnIelliohdlteIatiawfdrklncddoseeeemne’tsno’tp’l.arr”trste,reieaaadofah,hehwgentedtlrsoryrlypipovaieleeigoaibarnsinvltlnevfaIenitenihsercem“gekrhDnlewksuyioladerIrnentyewgseoyaoeptanhuhhcattehbmgyiudlhpeeoormohetyparcrempsrmeareunwev“ucoenhoaxrosfefeyrbbrWxe“eaaoounwlaincgouppee““erleiteoypWnTtielssvtnonouuitlShteTlesnparoavh“uchleepiponddperroctedea.durdsrtomhIyhoeubunniyresbesariecoawWnnfmfnsts.fensriereealontteeocfaulsssfiwfeatattdmogy,ssaimnSnetiarriihuhietetdirlsasnwydlxvstangmeesnontngmtasirlantihitaoslmis.elrvoidlyaslirthsleyoevsnyoedtsltleistRiion.i”bogtoytynortotseeeiwtnfstayrsshlotewvyneehelhwmeeburimshoIrzpsigcienarep.bigpa”stgnveinen“bsdarptnariamAaelhynodfginhadmenooae.rceeWisyeil”tkanrglorgeneeadnaeentongetmnwthoyafnisegletamoieebtliuwnrsarsnwinmxottrohwpahswwhttmasywtxtfianouedr.sa,aptse“rna’.oeertsaehotgdweontotehsetepepipfeimnrBrnntILoaehosenht?hr,ihgsrodvtei.ttiahrnenSnirein.enteqhyceeweaptidntromihfai.honipmainlaeItofnheesdrencsibnclcsuantttrrptweginotgnthmi.ewnayiueWemaohgo’ehctetaeeeeinghgnreesgit.aefailhasoeLlrgdartsooubs,sinieelces,vngniepfyItasotheeucnanaiaeltabsegwyeyeahnietucretntwithtwdtlraecsaaseboliindtcthtgosswnseawshhcitai,ntsbeopstoin!ecedtaahlhfnnruohh,ihiuttkwvhhucsitaeotbcgeenaoearrysasnt.eyaiipuciyogoeesvaehrnsosnaoifcyfpotirlsogopratowfomT.utrimtteo,are”,taoaunaesgautonieeeideedhuhfnopeufpoyhqvpnsarihsruoqeebgwountrc.veeiybtoaflogoesryeytyueerutssgxscuheusir’aeostvpj’hioleosreynuuommrepsraebiohhaehreaefnbmcrwrhtsieemanroeyuelvivapurtsasnecmyeesaestohdinlarnnaoupty,uniaaiersntececommIgilnpmwhtaatniaeshavhbboncedwcgbanpraethuhe?ecaudronalnliiliinyoihowuiriftigpecunveloxasreoedvnnnsehnosltnitthiiadouem.h.andleonht”sweotnhitumrowfwgtdeoutyen.drue?nsaotisdaoigirrhonataestefneheioitrlaktailaibrnanolhlyceirlsceygerneoltonsntotweo,ggeeihoptnhhdghfnhdgluauoeugaefewaeontueleorfrer,bfrhupeosesPepirsbhatnniisbrlpimnnuebtpooelo“phcbiscaragoogPdeetnnswtfreespmehnelf“heaheoapt.sfynlEpeuvnMtairoeoieebfAipseranaseolmicatoecsfgieunladdemnTdsnsurtohiinoystpopleyleiInttvgennmroKntitchhlmNifneoipruToeismedpnrpen,rhnhotsaelv,vatbtppiricen.ieenhhewfwTsEhnfseiyoelorggaogiespesratiiogRLarelSpprfciye-rmahcdegtonWrogsiidwnerifetnouhriegnwoaegfcniaeretrbcuoeastm.oeaertetwvd,bdgoodingfhdidsaprtrnisnaeanssmorsctitaahwvnacidoreuo,iefvnepmohbr,aeohniiloelpsihttepdmeblttaotidaliwfafeeidwmqaile,lgldhtaaonauiineiirnssooyodhutyvoyroetnvycelnmacrytrurneieyiihchtgsaohgingtcey,.ncaetacfnnnotnsnhmniiAhcbhaemiina“ihelnimhcishrehpyhnn,sngctasnocbecdhiilTbreasenionoodosg,nnaetgene,ch,aattciesdhsertotohioashsr.posddgftmbswrtassrhnair,htcssfbbneiiankoighioehlsiesidaffannltpylotneePoestbimfeonaaiesetehhpanuoecnsen.hrraphyagffunrrmaguiprcwanoecdiutosottioieaonwrimetenccoocysnibruhlpRtiiaiatpmsesnbtnhirercmtcfpaahohtahaebrieduaerlaeeluoeoetaofynraevdboldawibisereuthsitdoseebcrrdiisssghsashfptetletustsharnteueeerhb8icsesehcknitwthymghsaaseaealiitnrote.atsghnoomcetscn4eiilrveiieeholnso.esat–niitamnvnnledutlasppagreotdcmhiloorodo.tefagdecnsroeofslttwAftVtahriUfaobolielfaastthdstviaoaiahoeaerintynbcitrmnipibFypsnapyfybuonomeinnvtnrmorhndnervistakyisPeqghtsdhoaeaeirnmtonmdeidttwesbeaeecthtiesvaehnnfeceehulycedanypurddyeittnewosnedeeltnnmveebasnonhielydttersaLhSygshpattnreraiio,tnltiiheewegnpeetcasdsocrigwttlhaej,aiergeethnanpo,fletomhchiair“tria-sehuotnitasrtelassfrfanaadsgagnaraaUplhuhderyiimsnscmetratdltihtlcarnsdmdcun.allfadeoselmereoendidil-tya(yrogiaftenrsaeraysidanAisneoinbmrimd,seiildmbrnneeetwnnlnboallw,t’bmReroyesnleibn,lybepegmoegiwearUudoihntaotsarnnoldg1tsetns)hoeddgtdh,itye2tmdreaytyee’aymsrshnl.nd8eaee1jonytal
Celeb Speak aofbomoalflenrordaeytahyeom“alEedlnhvencaidaecinlsttialulppithaztroepebtisndlonlelioecgsrartiv,teesntowi.dh”scd–eoauathsstlucAlu.aeolpOFdstpttePnehabpo-neiReeonpsewrleltuoetlhdauarnreixynsocgn,aiotu-tetoctimhgeewcaehsremsmcrsftehosuhficronteeoogrivtpesaeynt,rroavtdbhtvieutuiianssrrdl,ieionaenngnd
A weekly column, published every Monday, featuring popular thheeraaSplhinyegatnuedasicnohgtehsyeorpgeeaxo,epsrloceiussenesdl.f
and on-trend local celebrities talking about their career,
personal life, and what drives them, as well as current theSUN OEN NMOTNDEARY |TAPARIILN27M, 20E20N1T5
and future projects. The celebrities featured come from a
wide range of disciplines and include actors and directors, CEALgEBSlPiElrAKlapboowuter tbawhewsetaeefwthlfhtbrniiohoareeeso“racveonSetouttetrltwaniwgWee“IDbphvw“bedmncbhDsvateBsnaameethalosheee,a“leyngdaieefaklyIanuLgtynaio,lypwenksaout.nsltjaisnmteustbpoaouiwuvsataioutn“trttrtsybunweuirisiht,eytoBdeeeanpitgvetytahescrt.slesemaeu’elrgrobuepgfonerhyouoakp,rweafxitlnrrSnetweaesenttohoxuiabemuaitththndanbtoaisacccniwtrchtavdamtnnrhpryfaeooet“matemuteeypioiatiuleeebspcniemeEasnnfwtnlesmaitssooecmimn.lvoe“ereigemmgcvagubidtgoatefonuetessBn;mcahatrreauiiecshne,trspmsc,eiaatrtmrceoiueibohelaehmeInalticalteinfebolrimnoo,uwysdlhtbeubvanttoeoeobeubnegewiodeymdenpgoeteueifnlunsumatcjunooiteesoahvmsy?tubsusnsoi.leeoaualithotttntnytltfsi,ta?meiseluwyrYmsrrsdusifunaafi“SarncuioesotonoenaivvamtAswonansblfgsbtlgoonnhhrdygnbuieertriaetuigt,cnutltifaeditrfeheauegpsobmahrdiotedttntdneirgoniutyeoeegaadrealoeharthlrbeyrea.breehthigeo’atnmelmlmupuaaltaclsegsroemeowtimngoaoleofoeftttaatpsnootgorhwolgteonwcvehhduitaaceheuptadaiinsotytvopangoaeaaudotgterfobosrohempIohahlnanaoer,eeIkeoog.eahkhyhdyerusipgttpnegoagnrkarnmytretanemerotewdhsteogswolseeeeteatapeehlhgylyheaduchliiosrmighbtdha.iutsdotwwrmonnatanceatoiiem’olrheikalgoe,stvmwosectesbolirlieoniiig“IsnahlwrigahgmtlvavuslewemnebnionasloorroalIa.regaThhybtsedyc..steyieoatnneattsmggurhctemuntIttyineohliphwWa.’ahmywatothosr’yoyIinositdnsluattrtertimt,nsccsainotlerht..lgohnhis”a,nmtfowleusaelomeksofvoawenyakeeeIcryaoeefiemb.sf?ste”aunwetopnietthonrrey.resnihaothhhstonedgrtdieroeaoryttvobdeneuIeaehfhataiannuoesragintgvrflw,onletpnhtlgo,tiicieo,sdhsvhturceheraeyeeeeewdtedsednratoseosd,
musicians, chefs, models and comedians. Celebrities orbeydBeuemcaepuptoyrweqejuurdeineicgnewJaeognmasienCnshteboenaguhtyoppeasgetoants
previously featured include Tiara Jacquelina, Carmen Soo, J THIISNOBKIINTEWERATVNUUHEWLTERYIIAFYRYUO.LNE█tfephrbutrdswbtsrpodhaBaorchbaoraniaehWeemaqlatsoe“emYtsbenem,asahdmierppgBItTisuemAnnoaetedunhhpppseeeJeerlEedmpehoeatuausweatjHeACetsyrarepesairaterbveatiyNesres.cretgssSihgdrtnSesaehsasoeocftrbydiueneereeeckhpaScuenhueonassvtOrtiewavlutcidnesnts?srnratssayynteroidtry’Cilfwau,pNteettteynealntneogtei,miamooaHthrtwnrnpybpvcneocestorgiLpitptsbeenhooroelaagianaepcoiEatweIlaobronp,erM-nrnnsugoyfesrrIejtO,tgonabrywkuCgneo,oekalstooetwaeascirsweea,NsamtgashsonnthtnwsahpeitdttilohtntaieenhuGfnthhetcsee,vhrnw’aoobhlhrmatetttbtnaaosrgeedeteiestettthyhseetfyonoinarhletefssanihrteeeolaahtaabiesrunpthratiitepmoabgansetugsfdnttenhiiaeeatguhamiMorehvtrrehtoallvttgjamnchosteahleognyutecetytohtaiewsdovvarba,peafdtsp.atsrasopalefbiesblhlgtisomcnostelenrmihiu2cheeeovfdvweiaalchoi0hetdasnoeemowrdneeAseee1nmueawaertlnnkgdroer9oaismcvltsta,gomio,tsgiyted.luhleunilojdohrpafmtuodelroqegayft.citedbinobme,n,uahnsrIbeiwceohnteoitwib–e.eajanyncaetaosscunJaadahuh?bgispengeerqioestnuendteoynenes,utymssdtseytphiyjwoCd“tupawoethWIt“oidgltnpewhknehmhfTtetogtrharntrehnpifbiahinaaneeffolatsoomlatnoaTogaetuimeknonedleoecmcnrtutywrttrithI“omotkeeewteecngtog,gIBbIe.lkjemurimrsrorguehIresbceiaumIatysreekgt’nten,’dastmoveaobahnyonamaelinhvtsismytngeeu’lstruurenddxnssholotewoetkeae,dyglebpsatoybmtrowed.lacohepooaaIoltlsafemteubesaiwbitThdadfgweaatrnnpnmrrtoatjaeenolwkhtaountgiyai,weugebehIunrnliettsdeerrteipiyo’e;istonshheponwbjremehhontmkocnlibdjItsaouttnrsiadg,iiuxoalvlotemwohuiaeflciitilsengwcuiawrnrniehaopptoeethcttcuemrggeetgeote.ptnhjirnoegadttr,qeovosaaeaoo,anrhnnpie?lrrsspshrdcennnnriiutsrmiuigoisette.remnnnonfeItreasattohdteiereiaeyIaott,e’wfergtotrrsdn’Iotytanehitddaeiemendo.hseimrobIeni?hkkwkmsee..e’s”ftlgiievyg.eetfdgn”atshutaoeIooele,hre,tt.ioyotrsxaTrryeifotIpoeenIuwekecwotsovnthne-Iigtrnsdbeu,tytoanliefjeontsuateototteIodhen,yyluiwdefbgtioet
Maya Karin, Shalini Balasundram and Haneesya Hanee. Wpoashtplboenregdmuonvtiiel May 2021Oofrrcien2RetnMoWdhlA8saeIrAirp,GaoWalrilunoehlsnIylegecNn2leaabtt0vrsodAew7eei2fe,dorLri1IsucglPLnltrisiYaafdhiaprrfnnetaanorsaboidivcmdrtknnyeehedgotebtoetudyohmntunehpwtliieeconPad.seiittctpmtouuooonrlnanenteuisgtlhnohMtscihanhiasnegy WtMP1ottp“oia5ihmdittIntrtsgw,co.’aaaaheumwnassotecmltdnapwiiOhaepnhpiadomtnorcrscnapnnntaaseh“oCineniWsehtuakthegmrsge“uHtzgpoetrwhistihnis“haalaaIcuitfnern,tphesdstneRooiiacpthtscitptdhwmhetnnvtgianenrergwaeimepeooebstIeonumdnnhal’eIrfsbhgeHotarsnetewiinla?feoitsdtaiyatreyrcivwcfseiohntytaneticratesstetfthhe?mghntonoeutdhllaaea,ttncmheriethieetusrrnsgboal,ahunItIcadeihaedmsteqetlnnsniedeacrke.vKtlwnss”he.ctsyduhnIIkahtpneyrshd.eoRoaa.eowleangoc2eianslnirutartpnlnaHotlentav0hhfgtinasptg’glfmpofhklwseshos2faaereoebniglaao,holertaeoent0fecanwoglietayfroetrtddtetnrioitpnen,sote’esyofhosqTsiranrtiadyndndetFooahnmshhItauoebVnhtoih’eueefnuaitbnatnfaovieeotBaout.wbtottaeea’nsyerigolwtlayosenntsIlyrryllubcteyoa,muwteihfsualtt’iosn wilfalliannwdgstotoiWsp“aosdntwpaatjpattisrfocpeBfuethtljanhfhosuoeorhuwhhhishoeeaedgeectttegrrrthdyiebecneahgaha“houtem“gfat“swmoorgletseytdTuhItaeuaeNrrliaorewtsaencsdehetehmdnlhmgoytsjidyloeance,tmmiuateeneoaobthcmvnrtltlhsitrpestlndluvopoieeb.sn”vagese?mmyneatateagegravue,yeppwhlarotygntsesspvnleesahrupupcsnoetyeusieyraarsnsaheuttyeebto,oaetsasghguhhyieowarlvbnvyul,psreetpiefrmafrais,twatputcleiaeueeaawdrisaeuwnlsssescrnsutwasxnontthurfhuwbehed,hootfouoantaefmcdo.eidpajsbetiipmirsopmmteyrtecollrvroojhfleleiecgjsnimieeoeentueonsaiea.etnboihsctnrnevstlntihlrbo.entatheotoeiehadiepntase,ancevibunsgrenesetdg,
FPhirucctieascqrodsPituspuariaotsrro.opa,ennmslwsaceahnohivusahctnniaohrtgseuitnhse ttnbohouetnhswieentoehprserlsodlel’oswssncilghilneoedrpemicsnulaogmss.tuehHraeoitnlolbyfomwmxo-iodoos-fdtJfiuocilsefy
Celebrity Causes has led 2LaE0Pehdcart2MsWeaheihaaW0ccgpnpveii.HhasrMTcreeyttohiiueharhdtzausldtrnaaeorb.eiihpeeckrepenfsbieaolrrssrthsoeoam.ogcb,prfenmfkr)Ieoysna,nyz,amnrws,atttIcttihTehearhhmaelelnenheioldervsaeieif2ewanrSeoCnRit0snnhafSoibh.ef0ldttocaDolisiui9(hnadacwrusprpryewrFnotcernfehlelftanfrlaoCdmaoeooaeyticirhaynenaeemvnoRraneetafntleigdoiseelaumndsegelCdntlndtrng.haabbiJoooeOowoExrtyeromnER–wnnhfj’iieeirkiBDevluiennfhotionvlsssoaahArwp.tibfomaoi,lnroaoFet,eyslnhtsrfrnP,o,te-
This column comes out every Wednesday, and
features a local personality speaking about a social Wahlberg.
cause, either as an ambassador for a social/ – AFP
charity organisation, or as an activist. The column
serves to create awareness of the cause, and to
inspire readers to make a change themselves.
Causes/organisations that have
been highlighted include
a school for refugee
children, teaching people
how to live a zero-waste
lifestyle, and helping
underprivileged
students stay in
school.
crC–EeoChNfniOenTsoitUEnanRRgngTTtwAbEjoISheNuYloiMrenOwvEeeFeNysRaTotOrhfeaCg. tKrolEifweTFiinsUgaEaLnd
Contact theSun's Sales & Marketing team to book your advertising space.
03-7784 6688 [email protected]
4 theSUN ON TUESDAY | FEBRUARY 9, 2021
NEWS WITHOUT BORDERS
‘A year to achieve herd immunity’
o 80% of population have to be vaccinated to In addition to Pfizer-BioNTech, so the elderly, and people with chronic placed and the results will be
attain target, says scientist far there are several types of Covid-19 diseases.” obtained in a short time.”
vaccines that have been identified by
KUALA LUMPUR: The country is end of February with frontline staff the ministry through the National It also coincides with the He said MGI also serves as a
expected to need a year to achieve being among early recipients. Pharmaceutical Regulatory Agency, aspirations of the National sequencing point for the Covid-19
herd immunity through the National namely the vaccine produced by Astra Immunisation Plan by the Special virus genome to obtain the latest
Covid-19 Immunisation Plan, one of “After February, the immunisation Zeneca-Oxford, Sinovac Biotech, and Committee on Covid-19 Vaccine genetic information and mutation of
the largest vaccination programmes programme will become one of the Gamaleya Research Institute. Supply Access Guarantee, namely the virus in Malaysia.
in Malaysia. largest vaccination exercises in “Protect yourself, Protect All”.
Malaysia. The administration of the He said it is very important for the Recently, he said, there were more
Scientist Dr Ummirul Mukmimin vaccines will be carried out in three country to achieve herd immunity Ummirul, who was a panellist of than 30 genome viruses uploaded to
Kahar from the Malaysian Genome phases and will run until February because it not only protects those the Malaysia Petang Ini programme the Covid-19 virus genome database.
Institute, National Institutes of 2022,” he told Bernama in a special who have been vaccinated, but also aired on Bernama TV said the
Biotechnology Malaysia said that to interview via Zoom yesterday. people around them. Malaysian Genome Institute (MGI) The government always ensures
achieve herd immunity, 80% of the was developing a biosensor strip that only the best vaccines that are
population need to be vaccinated Ummirul said the vaccinations “Herd immunity means that virus- using Crispr technology to detect safe, of good quality and effective will
with the Covid-19 vaccine. will be conducted at 600 vaccination borne infections will not be able to Covid-19. be given to the people and there is no
centres nationwide under the infect a group of people when most compromise on the level of safety and
Malaysia is expected to receive the supervision of the Health Ministry, members of the community have the “This is one of the initiatives of the effectiveness of the vaccine used.
vaccine from Pfizer-BioNTech by the hospitals, and universities. immunity to fight the virus. agency under the Ministry of Science,
Technology and Innovation in the Meanwhile, he said the current
“This is important to protect those fight against Covid-19. It is a kind of study showed that the effectiveness of
at risk (people who are susceptible to kit, using strips (paper strips) on the Covid-19 vaccines produced was
infectious diseases) such as children, which a smear or liquid sample is 70 to 95%, including against new
mutated variants.
Customers queuing to buy the hotel’s budget meals. – BERNAMAPIX Anwar wants Federal
Court to hear queries
5-star Malacca hotel offers RM2 meals
PUTRAJAYA: Datuk Seri Anwar Ibrahim has
MALACCA: After Penang and Terengganu, a budget meals is expected to give some joy to “There are also other side dishes such as filed an application in the High Court to refer
five-star hotel here is offering budget meals at people whose incomes are adversely affected ‘ayam madu,’ ‘ayam percik,’ cakes and cookies, several questions of law to the Federal Court
only RM2, as part of its efforts to stay afloat as by the pandemic and enable them to get but they are sold separately. pertaining to his judicial review over the
the tourism sector is still closed due to the meals cheaply. government’s decision in advising the King to
implementation of the movement control “We offer a different menu daily so that declare an Emergency proclamation.
order (MCO). “We started selling budget meals on Friday customers can enjoy a variety of dishes and
and the response has been very encouraging never get tired of the same fare every day,” he The questions posed include whether the
Hatten Hotel head chef Badrol Hisham with about 500 people visiting the stalls daily,” said, adding that the sale is from noon until decision to give advice and/or the advice given
Mohd Ali said the move was made as there he told Bernama yesterday. 8pm daily. by the Cabinet led by the prime minister to the
were no customers staying at the hotel and its King to suspend Parliament, is subject to the
restaurant was still closed. Badrol Hisham said the meals comprised He said budget meals will be sold for a ouster clauses in Article 150 of the Federal
white rice served either with a piece of chicken month, and the hotel will decide on the next Constitution.
“Apart from generating revenue, the sale of or fish as well as some vegetables. course of action based on the MCO status.
The second question is whether the decision
Unemployment doubles among heads of B40 urban households to give the advice and/or the advice given by the
Cabinet led by the prime minister to the King to
KUALA LUMPUR: Unemployment among about half of the households surveyed increased to 13.4% and 50% respectively. suspend Parliament is reviewable by the courts.
heads of low-income urban families in Kuala continued to deteriorate. “The poverty rate among these families
Lumpur low-cost flats doubled during last Anwar also wants the court to decide on
year’s conditional movement control order, Based on Part Three of the Families on the remains high at 42%, although government whether Section 39(2) of the Malaysia Act 1963,
said United Nations Children’s Fund Edge report, joblessness among heads of assistance during the period helped to Section 15(d) of the Constitutional
(Unicef ). households had doubled from 7% in mitigate the severity of their deprivation,” (Amendment) Act 1981, Article 150 (6) and (8)
September 2020 to 15% in December, and one Unicef said in a statement. of the Federal Constitution are inconsistent
A survey by Unicef and United Nations in three adults remained unemployed. and/or in contravention to Articles 4, 5, 8 and
Population Fund undertaken in December Unicef said poverty incidence among 121(1) of the Federal Constitution.
found that the socio-economic conditions of “Unemployment among female heads of female heads of households increased from
households and persons with disabilities also 47% in September 2020 to 61% in December. He is also seeking the court to determine
whether the inherent jurisdiction of the courts
including the powers of review in relation to
procedure, can be completely inhibited/ousted
by the legislature.
In a statement, Anwar’s lawyer Ramkarpal
Singh said due to the urgency of the matter,
particularly since Parliament is now suspended,
he has also filed a certificate of urgency for it to
be heard as soon as possible.
“I am of the view the questions raised above
ought to be decided by the Federal Court.”
Anwar, who is Port Dickson MP, filed for
leave to commence a judicial review in the High
Court on Jan 25 naming the prime minister and
the government as respondents. – Bernama
Attract tech-intensive
FDI: Former sec-gen
KUALA LUMPUR: Malaysia should now focus
on attracting technology-intensive foreign
investments into the country to make up for the
loss of competitiveness in labour-intensive
industries, said former treasury secretary-
general Tan Sri Mohd Sheriff Kassim.
He said this could be done by investing
heavily on “soft infrastructure” to enlarge the
technology-base and talent pool.
Another way would be by promoting
research and development activities and
strengthening enabling facilities like venture
capital financing to provide launching pads for
local startups, he said in a statement.
“The larger the local support base for
technology, the easier to attract big
multinational corporations to locate here
instead of Singapore,” he said.
Last week, the United Nations Conference
on Trade and Development reported that direct
foreign investment (FDI) into Malaysia plunged
by more than two-thirds to just US$2.5 billion
last year due to the pandemic. – Bernama
5theSUN ON TUESDAY | FEBRUARY 9, 2021
NEWS WITHOUT BORDERS
Praying for urgent
financial assistance
o Houses of worship committee members forced
to use own money to maintain operations
█ BY ELLY FAZANIZA MHS and the Malaysia Indian Transformation Adham (left) at a ceremony in Putrajaya yesterday to receive personal protective equipment
[email protected] Unit, which is under the National Unity contributed by Eu Smart Solution Holdings Sdn Bhd. – BERNAMAPIX
PETALING JAYA: Houses of worship are Ministry, signed an agreement last November.
running low on funds, so much so that Zero-waste syringes to be used
committee members have to dig into their own “Part of the RM4.2 million is being disbursed for vaccination programme
pockets to keep these places going. by MHS. We are doing a nationwide roadshow
and the first stop is Perak,” she said. PUTRAJAYA: The Health Ministry (MOH) is Last Saturday, Adham had said that MOH
President of the Federation of Taoist procuring “low dead-volume” syringes, that are needed 12 million low dead-volume syringes to
Association Malaysia Daozhang Tan Hoe Chiow The amount is being disbursed to 1,934 needed to administer the Pfizer-BioNTech inject 20% of the country’s population, or six
said collections started slowing down since last temples to cover their utilities and items needed vaccine injections, from local and foreign million recipients, in the first phase of the
March. The Covid-19 pandemic has led to the for prayers, she said. companies. vaccination programme.
shortfall in collections by temples.
As for salaries, the temples have not stopped Health Minister Datuk Seri Dr Adham Baba He said the syringes would be supplied to all
“We depend solely on public donations. paying wages and are trying to raise funds from said this type of syringe is appropriate for the vaccination sites that have been identified
Sadly, most Taoist temples are deprived of this the public. vaccine because it can avoid wastage and the throughout the country.
source of revenue,” he told theSun. number of doses to be given can be maximised,
“For temples that do not have a bank especially in the first phase of the National “For the vaccine, we need to have a complete
“We hope the government will consider account, disbursement will be in cash given Covid-19 Immunisation Programme, which will set of equipment and I am confident with all the
giving a one-off financial aid of RM5,000. This directly to them,” she said, adding that all begin on Feb 26. preparations being done.”
amount can cover an association’s (temple’s) monetary aid will be disbursed in May.
operations (for a month), depending on its size “The vaccine should be administered Adham said 6,542,418 Reverse
and management.” She estimated that a temple needs about carefully because we need to avoid wastage, Transcription-Polymerase Chain Reaction and
RM30,000 a month to operate. and this syringe also meets the specifications Antigen Rapid Test Kit screening tests were
It is estimated there are 6,000 temples and requested by the Pfizer company,” he told conducted from Jan 24, 2020 until last Saturday.
Taoism associations nationwide, and many of The Young Buddhist Association of Malaysia reporters after receiving a contribution of
them are in dire need of help. has appealed for an emergency fund for them to 1,000,000 units of personal protective “The tests helped MOH in detecting positive
continue their operations. equipment from Eu Smart Solution Holdings. cases quickly and enabled rapid contact tracing.
Apart from a place for prayers, he said there
are some members who run kindergartens, “Due to the pandemic, it is understandable Low dead-volume syringes generally refer to “I request those who have had close contact
classes on Taoism and a retirement home, like that prayers at places of worship are not allowed zero-waste syringes, thus ensuring the recipient with positive cases to provide complete
the one in the Hulu Langat district that has 40 during Chinese New Year. of the injection receives the entire dose of the information to the District Health Office to
residents. vaccine he needs. enable action to be carried out on the
“Many rely on devotees and private donors transmission of Covid-19,” he added.
Meanwhile, Malaysia Hindu Sangam (MHS) to fund their daily operations. – Bernama
said it was better off after they received a one-off
RM4.2 million aid from the government. “Many are now facing financial challenges
because of the prolonged movement control
Its assistant secretary-general, Gowri P.S. order.
Thangaya, said this was made possible after
“The restricted New Year is painful on
finances for places of worship, making it more
challenging to serve the faithful,” it said in a
statement.
Total
con rmed cases
UPDATE 245,552 Travel bubble to help boost business events
As of noon yesterday KUALA LUMPUR: The Reciprocal Green Lane- the government decides on, we hope that
Travel Corridor Arrangement between Malaysia travellers from Indonesia will abide by them, be
Total active cases Total recoveries Death toll and Indonesia is expected to support and speed it pre-requisite quarantine days, vaccinations,
up the opening of business events in Malaysia. swab tests or other requirements deemed
51,977 192,679 896 necessary,” he said.
Malaysian Association of Convention and
Including Exhibition Organisers and Suppliers president Teo also urged the government to expedite
Francis Teo said the opening of borders the roll-out of the vaccination programme in
New cases UPDATETotal in ICU New recoveries New fatalities between Malaysia and Indonesia would Malaysia so that the country will be able to catch
facilitate the movement of business travellers up with other countries that have already begun
3,100 282 2,340 24 between the two countries. their vaccination programmes.
4 PERLIS Breakdown by state Prime Minister Tan Sri Muhyiddin Yassin “Our members include 29 convention centre
37 KEDAH secured the travel bubble agreement during his operators located in major cities in the country.
209 PENANG KELANTAN 30 two-day visit to Indonesia, which concluded We have proposed to work with the government
TERENGGANU 30 last Friday. by designating these participating venues as
temporary mass vaccination centres during the
Teo said for the travel bubble to work, details vaccination delivery.
of the initiative would need to be clearly
identified once it is implemented, when “The association is willing and prepared to
the pandemic situation in both countries work with the government to ensure the success
improves. of this vaccination drive.
He suggested for airports to look into “We hope that through this collaboration, we
providing permanent special lanes and can facilitate the government’s goal of providing
counters dedicated to these travellers to vaccinations to 70% of the population, which is
facilitate their movement upon arrival. equivalent to 23 million Malaysians,” he said.
– Bernama
“Whatever standard operating procedures
AsRofneoonligious dept contributes RM4m to needy
yesterday
PUTRAJAYA: The Department of Islamic implemented aid programmes for the needy,
Development Malaysia (Jakim)-Yayasan Wakaf including flood victims, and about RM15
Malaysia (YWM) Covid-19 Musa’adah Fund has million was spent last month.
channelled RM4 million to help those in need “We are going nationwide. Our plan is to
72 PERAK PAHANG 28 0 LABUAN affected by the pandemic. serve all parliamentary constituencies,” he said.
Minister in the Prime Minister’s Department Zulkifli also presented a contribution,
(Religious Affairs) Datuk Seri Dr Zulkifli totalling RM24,400, to 122 students of Universiti
1,196 SELANGOR N.SEMBILAN 104 Mohamad Al-Bakri said the fund had received Kebangsaan Malaysia from B40 families
SARAWAK 84 contributions of about RM6 million from affected by Covid-19, and another RM2,000 to a
295 K. LUMPUR companies and individuals since it was man from Sarawak undergoing treatment at
8 PUTRAJAYA SABAH 169 launched in March last year. Kuala Lumpur Hospital.
344 MALACCA
490 JOHOR “We hold discussions every two weeks, we A total of RM15,000 was donated to the
target and coordinate (assistance) in the best Federal Territory Islamic Religious Department
possible way,” he said after flagging-off a (funeral management team), to fund screening
post-flood relief mission convoy in Dungun, costs for its 60 members.
Terengganu yesterday. Zulkifli said donations can be made to
Zulkifli said other agencies under the Jakim-YWM’s CIMB Islamic Bank account:
purview of his department have also 86-0221818-6. – Bernama
6 theSUN ON TUESDAY | FEBRUARY 9, 2021 BRIEFS MAN DENIES RAPING
NEWS WITHOUT BORDERS STEPDAUGHTER
Ex-Tabung Haji chief’s brother IPOH: A night market trader
granted discharge was charged in the sessions
court yesterday on three
KUALA LUMPUR: The sessions o Sessions court agrees to request to make Perak in Kuala Lumpur on Dec 8, counts of raping his
court yesterday granted a discharge accuseda prosecutionwitnesswithrulingthat 2010, and at Affin Bank, Pusat 13-year-old stepdaughter last
not amounting to an acquittal to does not amount to an acquittal Bandar Puchong in Selangor on June year. The 48-year-old man
Datuk Abdul Latif Abdul Rahim for 13, 2017, and April 10, 2018. pleaded not guilty to all
abetting his brother, former Tabung charges, that were read out to
Haji chairman Datuk Seri Abdul The money laundering offences him before judge N. Priscilla
Azeez, in accepting bribes involving were allegedly committed in the Hemamalini. On the first and
highway construction projects and “The court then granted the proceedings and lawyer Hisyam Teh Klang Valley area between March 8, second counts, the man was
road upgrades in Perak and Kedah. application,” he said when contacted Poh Teik had produced a medical 2010, and Aug 30, 2018. charged with raping the victim
Deputy public prosecutor Adam yesterday. certificate on behalf of the accused, on a Saturday in June and July
Mohamed said judge Azura Alwi valid from Feb 5 to11. Abdul Latif, 63, is accused of last year at 2.30pm and 2pm
made the decision after the The trial of Abdul Azeez and his abetting Abdul Azeez in obtaining a respectively, at a house in
prosecution applied for Abdul Latif brother was supposed to continue Lawyer Datuk Seri Jahaberdeen RM4 million bribe from Mohammad Kampung Banjar, Ayer Tawar,
to be given a discharge not before Azura yesterday. Mohamed Yunoos, who is Redzuan Mohanan Abdullah as Manjung. He was also charged
amounting to an acquittal by making representing Abdul Latif, said he had gratification to help Syarikat Menuju with raping the victim on Dec
him a prosecution witness. Meanwhile, Adam said the trial, applied for his client to be Asas Sdn Bhd secure road projects 26, 2020 at the same location.
“The Attorney-General’s which was scheduled to be held until discharged and acquitted of the two through limited tender from the The charges carry a jail term of
Chamber (AGC) considered the tomorrow, was vacated after the charges. Works Ministry. up to 30 years and whipping.
application by the defence to drop prosecution informed the court that The court allowed bail at
the charges against Abdul Latif after High Court Judge Datuk Abdul Azeez, 54, who is also The project involved the Pantai RM10,000 in one surety for all
two representations were submitted Muhammad Jamil Hussin had Baling MP, is charged with three Baru Coastal Expressway Project, charges and set March 11 for
to the AGC three months ago. allowed Abdul Azeez’s application to counts of accepting bribes totalling upgrading works of Federal Road mention. – Bernama
“Therefore, we requested that the adjourn the trial on Feb 23, pending RM5.2 million in connection with FT005 (Teluk Intan to Kampung
accused (Abdul Latif) be granted a his application to quash the three road projects in Perak and Kedah as Lekir, Perak) valued at HELD FOR FIRING
discharge not amounting to an corruption charges and 10 money well as 10 counts of money RM644,480,000. WARNING SHOTS
acquittal from the charges. laundering charges he is facing. laundering.
He is accused of committing both BUKIT MERTAJAM: Police
According to Adam, Abdul Azeez He is accused of committing the offences at Affin Bank, Pusat Bandar arrested a man who fired two
did not attend yesterday’s offences at CIMB Bank, Jalan Tun Puchong in Selangor on June 13, warning shots into the air
2017, and April 10, 2018. – Bernama using a rifle, as he was enraged
over a neighbour’s alleged
RM900,000 SPOT CHECK ... Police and staff of the Malaysian Construction Industry Development Board and Penang Health affair with his wife in Sungai
drugs seized Department inspecting a construction site in Kepala Batas yesterday, where workers were found to be in violation of Semambu. Central Seberang
standard operating procedures, resulting in the site being ordered to close. – BERNAMAPIX Perai district police chief ACP
PETALING JAYA: Just four months Shafee Abd Samad said at 1am
after actively distributing drugs in the on Sunday, the victim was at
Klang Valley, a syndicate was busted home when he heard knocks
by police with the arrest of four men on his door. “He opened the
and the seizure of more than door and found his neighbour
RM900,000 worth of narcotics last outside. The suspect pointed
week. an air rifle at the victim and
forced the victim to admit he
Selangor acting police chief DCP had a sexual relationship with
Datuk Arjunaidi Mohamed said his wife, before firing warning
yesterday the suspects, aged between shots when the victim denied
44 and 60, included two foreigners the allegation.” – Bernama
with Malaysian permanent residence
status. Detained over
obstruction of
He said the suspects were held civil servants
after police conducted three raids in
Puchong, Jalan Kuchai Lama in Kuala TAWAU: Police have arrested a
Lumpur and Cheras on Feb 3. man who was attempting to
escape after provoking and
Arjunaidi said police seized more obstructing civil servants from
than 13kg of methamphetamine discharging their duties during a
worth over RM600,000 that were Covid-19 operation in Taman
concealed in packets of Chinese tea. Semarak last Saturday.
They also recovered from the Sabah police commissioner
suspects 4.4kg of heroin worth Datuk Hazani Ghazali said the
RM48,000 and almost 14,000 ecstasy 37-year-old was alleged to have
pills valued at RM250,000. followed the Covid-19 standard
operating procedures (SOP)
Arjunaidi said the foreign suspects compliance monitoring team’s
were responsible for smuggling the vehicle while recording a video
drugs from overseas. The syndicate using his mobile phone.
had distributed it in the Klang Valley
since November. “The suspect had uttered harsh
and provocative words towards
“The seized narcotics could the team, which comprised
supply about 49,500 drug users. The personnel from the People’s
suspects are under a remand order Volunteer Corps (Rela) and Civil
for further investigations.” Defence Force, and raised his
voice and refused to cooperate
IRB seeks RM68m tax arrears from Jho Low’s ally when asked to show his identity
document,” he told Bernama.
KUALA LUMPUR: The government, management has been set for without being surrendered. RM270,602.18, RM2,209,094.99,
through the Inland Revenue Board, March 16. The plaintiff further stated that RM3,547,991.14 and RM153,847.30 Hazani said the suspect had
(IRB), has filed a suit against Eric Tan credit surplus of RM782.02 due to the was imposed and added to the almost hit a Rela personnel while
Kim Loong, who is alleged to be an In the statement of claim, the defendant was utilised and deducted overall income tax for the years of trying to escape. He was then
ally of fugitive businessman Low Taek government alleged that for the years as part payment of income tax for the assessment 2010 until 2013 that still arrested and taken to the Tawau
Jho, or Jho Low, demanding that Tan of assessment 2010, 2011, 2012 and year of assessment 2010, leaving an remain unpaid,” the plaintiff said in district police headquarters.
pays income tax totalling RM68 2013, the defendant was due to pay outstanding balance of its statement of claim.
million. income tax of RM2,706,803.84, RM2,706,021.82 for that tax The case is being investigated
RM22,090,949.92, RM35,479,911.48 assessment year. The plaintiff claimed that to date, under Section 188 of the Penal
The government, as the plaintiff, and RM1,538,473.04 based on the “As the defendant failed to pay the defendant had yet to pay to the Code, Regulation 25(1)(n) of the
filed the writ of summons via IRB on Notice of Assessment for the said income tax of RM2,706,021.82, plaintiff the amounts and penalties National Registration Regulations
Jan 15 at the High Court here and years, dated Sept 30, 2020. RM22,090,949.92, RM35,479,911.48 due, which came up to 1990, Section 8(1)(e) of the Sabah
named Tan, 43, as the defendant, and RM1,538,473.04 within 30 days RM67,996.891.87. Minor Offences Ordinance and
over income tax arrears for the years The plaintiff claimed that notices of the delivery of the said Notices of Section 90 of the Police Act 1967.
of assessment from 2010 to 2013. of assessment were sent by registered Assessment to him as provided under As such, the plaintiff is demanding
post to the defendant on Nov 24, Section 103 of the Income Tax Act that the defendant pay The video of the man chasing
According to the court’s case list, 2020 to his last known address in 1967, an increase in tax of 10% RM67,996.891.87, 5% interest from after the SOP compliance
the case came up for e-Review before Taman Pusat Kepong, which was respectively amounting to the date of judgment until the monitoring team’s vehicle while
High Court deputy registrar Farah known by the plaintiff at the time, but realisation date, costs and other relief making a video recording and
Shuhada Ramli yesterday and case were never returned to the plaintiff deemed fit by the court. – Bernama uttering provocative words had
gone viral on social media.
BRIEFS CAMBODIA RELEASES 7theSUN ON TUESDAY | FEBRUARY 9, 2021
FIVE ACTIVISTS * NEWS WITHOUT BORDERS
PHNOM PENH: Cambodian Calls to join protests in
authorities yesterday released five Myanmar grow louder
environmental activists after they
were detained for three days for oHealth workers urge govt staff to protests, in 1988 and 2007 in banners in the colour of Suu Kyi’s
protesting against illegal logging support civil disobedience campaign particular. National League for Democracy.
inside a wildlife sanctuary. The five,
including Goldman Environmental YANGON: Myanmar police turned a Reuters has been unable to A convoy of military trucks was “Release Our Leaders, Respect
Prize 2016 winner Ouch Leng, were water cannon on protesters contact the junta for comment on arriving in Yangon late on Sunday, Our Votes, Reject Military Coup,”
detained by rangers on Friday for yesterday as tens of thousands of the protests but state media raising fears that could change. one sign said.
being inside the Prey Lang Wildlife people joined a third day of signalled possible action against
Sanctuary without permission. The nationwide demonstrations against them in the first comment from any Earlier, police in the capital Many signs were light-hearted
Kratie provincial court released the the military’s removal of elected government channel, saying the Naypyidaw fired brief bursts from a while firmly opposed to the military
five, who signed an agreement not leader Aung San Suu Kyi a week ago. public wanted rid of “wrongdoers”. water cannon at a group of the intervention in politics.
to enter restricted areas without protesters, video showed.
permission. A case has been filed Calls to join protests and to back “We, the whole people who value The protests are the biggest since
against Ouch Leng’s Cambodian a campaign of civil disobedience justice, freedom, equality, peace Thousands also marched also in the “Saffron Revolution” in 2007,
Human Rights Task Force for not have grown louder and more and safety, not only refuse to accept the southeastern city of Dawei and which led over subsequent years to
being registered with the interior organised since last Monday’s coup. the lawless wrongdoers but also in the Kachin state capital in the far the military’s gradual withdrawal
ministry. – Reuters request that they be prevented and north, the massive crowds reflecting from politics after decades of direct
“We health workers are leading removed through cooperation,” the a rejection of military rule by diverse rule, a process brought to a jarring
BOLIVIA PROBES this campaign to urge all MRTV television station said. ethnic groups, even those who have halt by the Feb 1 coup.
DEATHS OF CONDORS government staff to join,” Aye Misan, been critical of Suu Kyi and accused
LA PAZ: Bolivian authorities on a nurse at a government hospital, Though not attributed to any her government of neglecting In a development likely to worry
Sunday announced an said at a protest in Yangon. authority or group, it was later read minorities. the military, some government
investigation into the apparent out on a military-owned network. workers have been seen joining
poisoning of 35 Andean condors, “Our message to the public is that In Yangon, a group of doctors and some teachers in
one of the most devastating such we aim to completely abolish this Gatherings have been good saffron-robed monks, who have a rallying to the call for a campaign of
cases for the endangered species. military regime and we have to fight natured and largely peaceful, unlike history of rallying community action civil disobedience and strikes.
“It is an irreparable injury to our for our destiny.” bloody crackdowns on previous in the overwhelmingly Buddhist
nature and the species,“ the country, marched in the vanguard of “We request government staff not
environment and water ministry protests with workers and students. to attend work,” activist Min Ko
said. Deputy environment minister Naing, a veteran of the 1988
Magin Herrera confirmed 35 dead They flew multi-coloured demonstrations that brought Suu
condors had been found in the Buddhist flags alongside red Kyi to prominence, said. – Reuters
rural community of Laderas Norte.
The Andean condor has a 3.5m
wingspan, making it one of the
largest flying birds. Globally, there
are 6,700 condors but numbers are
declining. The International Union
for the Conservation of Nature
classifies the condor as “near
threatened” on its watch list. – AFP
JAPAN SUBMARINE, Police using a
PRIVATE VESSEL CRASH water
cannon on
TOKYO: A Japanese submarine and protesters in
a private ship were involved in a Naypyitaw
crash off the Pacific coast yesterday yesterday. –
and three of the submarine’s crew REUTERSPIX
suffered minor injuries and it was
slightly damaged but still able to
sail. The submarine and the ship
crashed off Kochi prefecture in
southern Japan, chief cabinet
secretary Katsunobu Kato said.
Kato, quoting the Coast Guard, said
there was no damage to the
private ship. The Self-Defence
Force said three submarine crew
members suffered minor injuries
and the vessel’s mast was
damaged but not enough to
hinder its ability to sail. – Reuters
Clubhouse app gives Chinese China arrests Aussie journalist
rare access to uncensored topics for ‘supplying state secrets’
BEIJING: Chinese internet users listening to a conversation, tweeted CANBERRA: An Australian journalist China’s foreign ministry concerns” about her “welfare and
are flocking to a rare uncensored on Sunday. who disappeared from Chinese state confirmed the arrest yesterday, and conditions of detention”.
app to breach the “Great Firewall” television’s airwaves six months ago said her case is being “processed”.
and discuss taboo topics, including Taobao and other e-commerce and was detained by Beijing “We expect basic standards of
the mass detention of Uighurs, sites had membership invitations authorities has been formally Spokesman Wang Wenbin called justice, procedural fairness and
Hong Kong protests and the for sale with prices ranging from 10 arrested for “supplying state secrets for Australia to “respect China’s humane treatment to be met, in
concept of Taiwan independence. to 100 yuan (RM6.10 to RM61), overseas”. judicial sovereignty and stop accordance with international
allowing some to bypass interfering in China’s handling of the norms,” she said.
China deploys a vast and restrictions placed on invitations. Australian foreign minister Marise case”.
sophisticated surveillance state to Payne said yesterday that China had Cheng had written a number of
scrub the internet of dissent and Clubhouse is currently only revealed it formally arrested Cheng Cheng faces severe punishment if Facebook posts critical of Chinese
prevent citizens from accessing available on Apple devices, Lei on Feb 5, after taking her into found to have broken China’s President Xi Jinping and Beijing’s
international social networking something only wealthier Chinese custody last August without national security laws. approach to the coronavirus
sites like Facebook and Twitter. consumers can afford. explanation. outbreak.
Her niece Louisa Wen told
But Clubhouse appears to have It rocketed in popularity after The mother-of-two stands Australian broadcaster ABC that the One post poked fun at Xi’s visit in
side-stepped the censors – for now. billionaire Elon Musk participated accused of “illegally supplying state family did not “understand anything March to Wuhan, the Covid-19
in a conversation on the app earlier secrets overseas”, Payne said in a about the case”. ground zero: “The big story today,
The American invite-only audio this month. statement, without providing details. Dear Leader’s visit, triggered titters in
app allows users to listen and Cheng’s 11-year-old daughter and the newsroom – waving to a big TV
participate in loosely moderated Sinica Podcast host Kaiser Kuo Cheng had been a familiar face on nine-year-old son “don’t fully screen showing the coronavirus
live conversations in digital “rooms”. noted how Han Chinese – the CGTN’s English-language channel, understand the situation”, she said, hospital in Wuhan apparently equals
dominant ethnic group in China – conducting interviews with noted adding it had been “quite tough on a visit.”
And in recent days, Chinese and people from the Uighur CEOs from around the world. the kids wondering what’s going on”.
internet users have filled those community were interacting in Months after Cheng’s detention,
rooms discussing highly censored Clubhouse. Born in Hunan province, Cheng is Two Australian journalists, Bill Chinese authorities also detained
subjects – such as Beijing’s now an Australian national who Birtles and Michael Smith, fled China Bloomberg News employee Haze
sweeping incarceration of Uighurs “Very emotional, tearful emigrated to the country as a child, shortly after being interrogated about Fan, also on allegations of
in the far western Xinjiang region. profession of ‘Han guilt’ by a before returning to China and joining Cheng. endangering national security.
participant now – response by a the state broadcaster in 2012.
“A young woman from mainland Uyghur man assuring this woman Payne said the Australian The foreign ministry said
China just said on Clubhouse: this that we are friends, and this atrocity China does not allow citizens to government had visited Cheng six yesterday her case was also “under
is my first time getting on the real makes the need for friendship even hold dual nationality. times since she was detained – most investigation”. – AFP
internet,” Isabelle Niu, a journalist more important,” he tweeted. – AFP recently on Jan 27 – and had “serious
8 theSUN ON TUESDAY | FEBRUARY 9, 2021
NEWS WITHOUT BORDERS
South Africa halts Netanyahu denies
AstraZeneca jab rollout corruption charges
o Researchers work to update vaccine global vaccine rollout that covers some 145 TEL AVIV: Israel’s Benjamin Netanyahu
to deal with new coronavirus variant countries – mostly lower- and lower-middle denied graft charges against him in a brief
income economies. court appearance yesterday, weeks before a
GENEVA: South Africa suspended the start of “It’s a temporary issue that we have to hold fourth national election inside two years.
its AstraZeneca inoculation programme over on AstraZeneca until we figure out these Out of the initial 337.2 million Covax doses,
concerns the shot does not work on a new issues,” health minister Zweli Mkhize told 240 million are AstraZeneca shots, which do Netanyahu, the first Israeli premier to be
variant, with WHO experts due to meet early reporters on Sunday. not require the supercold storage needed for indicted in office, had been compelled to
today to discuss the vaccine already facing the Pfizer and Moderna vaccines. appear to deliver an in-person response to
questions about its efficacy for over-65s. The 1.5 million AstraZeneca vaccines the charges, after last month formally
obtained by South Africa, which will expire in There were already concerns about the submitting his innocent plea in writing.
A trial showed the vaccine provides only April, will be kept until scientists give clear efficacy of the AstraZeneca shot among
“minimal” protection against mild to moderate indications on their use, he said. over-65s, with a number of European nations Lead judge Rivka Feldman Friedman
Covid-19 caused by the variant first detected in not authorising it yet for that demographic. opened the hearing by reading the charges.
South Africa, a setback to the global fight AstraZeneca, which developed the shot with
against the pandemic as many poorer nations the University of Oxford, told AFP: “We do The coronavirus pandemic has claimed “I confirm the written answer submitted
are relying on the logistical advantages offered believe our vaccine will still protect against more than 2.3 million lives globally out of in my name,” Israel’s longest-serving
by the AstraZeneca shot. severe disease.” nearly 106 million known infections, and premier said, shortly before exiting the
despite the AstraZeneca setback, vaccine courtroom and rejoining his motorcade.
Africa’s hardest-hit nation was due to start its A company spokesman said researchers rollouts in other countries are gathering pace.
campaign in the coming days with a million were already working to update the vaccine to Yesterday marks the final hearing before
AstraZeneca doses but the government deal with the South African variant, which has Hungarian authorities said on Sunday they the prosecution begins presenting evidence.
decided to hold off in light of the results from been spreading rapidly around the world. have approved Russia’s Sputnik V shot, while
the trial conducted by the University of Cambodia became the latest nation to receive The charges against Netanyahu are
Witatersrand in Johannesburg. A World Health Organisation panel is due to delivery of the Chinese Sinopharm vaccine, divided into three separate cases.
meet today in Geneva to examine the shot, taking on 600,000 doses of the jab.
which is a major component of the initial Covax Case 4,000 – in which he is accused of
Efforts are under way in the United States, bribery, fraud and breach of trust – centres
the hardest-hit nation, to accelerate its mass on the allegation that he negotiated with
vaccination programme, which has been Shaul Elovitch of telco giant Bezeq to secure
plagued by supply and logistics issues. – AFP positive coverage on his Walla! news site in
exchange for policies benefiting Bezeq.
Case 2,000 concerns allegations
Netanyahu sought a deal with the owner of
Yediot Aharonot newspaper that would have
seen it give him more favourable coverage.
Case 1,000 involves allegations
Netanyahu and his family received gifts
from wealthy individuals, in exchange for
financial or personal favours. – AFP
BRIEFS DUTCH SUSPEND Indian glacier disaster leaves 18 dead, 203 missing
FOREIGN ADOPTIONS
NEW DELHI: Rescuers searched for more than “As of now, around 203 people are missing,” that some of the snow started melting and may
AMSTERDAM: The Netherlands is 200 people missing in the Indian Himalayas state chief minister Trivendra Singh Rawat said, have led to an avalanche.
freezing international adoptions after yesterday, including some trapped in a tunnel, and the number was changing as more
a government commission found after part of a glacier broke away, sending a information about people caught up the deluge Rescue squads were focused on drilling their
some children had been stolen or torrent of water, rock and dust down a emerged from the remote area. way through a 2.5km long tunnel at the
bought from their birth parents in mountain valley. Tapovan Vishnugad hydropower project site
cases going back to the 1960s. The Videos on social media showed water that NTPC was building 5km downstream
commission was set up under Sunday’s violent surge below Nanda Devi, surging through a small dam site, washing away where 30 workers were believed trapped.
pressure from increasing numbers of India’s second-highest peak, swept away the construction equipment and bringing down
grown up adopted children who small Rishiganga hydro electric project and small bridges. “We are trying to break open the tunnel, it’s
began to research their roots and damaged a bigger one further down the a long one, about 2.5km,” state police chief
often found that their birth Dhauliganga river being built by state firm “Everything was swept away, people, cattle Ashok Kumar said, adding rescuers had gone
documents had been forged or lost, NTPC. and trees,” Sangram Singh Rawat, a 150m into the tunnel but debris and slush were
or that their adoption had been former village council member of Raini, the site slowing progress.
illegal. Rights minister Sander Dekker Eighteen bodies have been recovered from closest to the Rishiganga project, told local
said yesterday “too much remains out the mountainsides, officials said. media. There had been no voice contact yet with
of our sight” in some foreign anyone in the tunnel, another official said.
countries. “By suspending adoptions Most of the missing were people working on It was not immediately clear what caused
we are protecting children and their the two projects, part of the many the the glacier burst on a bright Sunday morning. Heavy equipment has been employed and a
biological parents,“ he said. – Reuters government has been building deep in the dog squad flown to the site to locate survivors.
mountains of Uttarakhand state. Experts said it had snowed heavily last week
U.S. TO RE-ENGAGE WITH in the Nanda Devi area and it was possible On Sunday, 12 people were rescued from
HUMAN RIGHTS FORUM another much smaller tunnel. – Reuters
GENEVA: The United States will Rescue personnel working to ‘break open’ a tunnel at the Tapovan Vishnugad hydropower project site yesterday. – REUTERSPIX
participate as an observer in the U.N.
Human Rights Council, which it quit in
June 2018 under the Trump
administration, while seeking reforms,
a U.S. envoy said yesterday. Mark
Cassayre, charge d’affaires at the U.S.
mission to the U.N. in Geneva, told a
council organisational meeting: “I am
pleased to inform you that secretary
(Antony) Blinken will announce that
the U.S. will re-engage with the U.N.
Human Rights Council as an observer.
The most effective way to reform and
improve the Council is to engage with
it in a principled fashion.” The Trump
administration quit the forum after
accusing it of having a “chronic
anti-Israel bias”. – Reuters
‘ATTEMPTED COUP
FOILED IN HAITI’
PORT-AU-PRINCE: Haitian authorities
said on Sunday they had foiled an
attempt to murder President Jovenel
Moise and overthrow the
government. Authorities said at least
23 people have been arrested,
including a top judge and a police
official. “I thank my head of security.
The goal of these people was to make
an attempt on my life,“ Moise said.
“That plan was aborted,“ he said.
Prime Minister Joseph Jouthe said
plotters had contacted police officials
at the presidential palace who were
planning to arrest Moise and then
install a “transition” president. – AFP
TELLING IT AS IT IS
LIFESTYLE . YOUTH . FASHION . ENTERTAINMENT
Rsitsainr g TUESDAY | February 9, 2021
Multi-talented rapper Sya is taking
the local hip-hop scene by storm Amber Chia chooses
>>> Page 3 comfort over grandeur
>>> Page 4&5
PICTURE COURTESY OF Eunice Yap creates
UNIVERSAL MUSIC MALAYSIA little pieces of art
>>> Page 6
ENTERTAINMENT2 theSun LYFE ON TUESDAY | FEBRUARY9,2021
█ BY YUNUS YUSSOP Band
members
POWER pop-punk band (from left)
Pablo! of Bintulu released Amirul,
a new single Mereka Dan Morni,
Kita on Jan 16. Hazzaid,
It was the band’s first Zulkifli, and
collaboration with Shamsul Eugene.
Annuar Mohd Baharom or Sam of
the music group Bunkface.
The new single is among eight
songs featured in the Pablo! debut
album, scheduled for release in the
second quarter of this year
The other seven songs are
Dalam, Dilema, Okay, Remember
This Day, Ayuh Bangkit, Are You
Crazy?, and Terima Kasih.
Pablo! – one of the many
promising local bands – was
formed during the first movement
control order (MCO).
In August last year, five friends A cut in the music industry
came together to start the band,
comprising Hazzaid Abdul Muin
(vocals-guitar), Zulkifli Ismail (lead
guitar), Amirul Afdhalurrahhim
Jauzi (rhythm guitar), Morni Ismail
(bass guitar), and Eugene Ampas
Anthony (drums). music is also changing.
Six of their demo songs released o Pablo! wants to help develop the music industry in Sarawak Pablo! shares the same
under Hello Mr Pablo! were
produced from scratch during the sentiments but notes there are
MCO period and have been The band other options such as streaming
streamed online via Spotify and practises a live performances online albeit
YouTube since December. new song. admitting the vibe may not be the
same as live events.
The name Pablo! has no
meaning specific to the band “Rock genre is still relevant but
members. It sounds catchy, is the fan-base isn’t that big, so to
simple and easy to remember, and, revive the glory days of rock music,
above all, matches the genre of the bands must put in extra efforts to
band. attract new generation listeners,”
Although each band member is Morni said.
unique in his own way, decisions
on the group’s direction are made The selection of the power pop-
through discussions and punk genre is a strategy to keep
consensus. the rock genre alive by writing
Morni takes care of events, gigs, catchy choruses with easy-to-relate
and publicity coordination; Zai is lyrics.
responsible for composing and
tone, assisted by Zul and Eugene; The group’s songs are mostly
while Amirul handles influenced by local pop-punk
merchandise design, sales, and bands such as Iman League,
strategy. Bunkface, and others with similar
playing styles.
Weekend project the overwhelming response, bands can collectively come up proactive in promoting their songs
As the band members have their noting that the music genre was with plans to hold gigs and related to help boost the music industry in As for international bands,
own professions in the major fresh and appealing. events although for now this has to Sarawak,” Morni said. Pablo!’s music genre is akin to the
industrial sector in Bintulu, Pablo! be put on the back burner due to Blink 182, Greenday, NOFX,
is a weekend project for now. “The local music scene has Covid-19. Pablo! also called for greater Alkaline Trio, and others of the
been quite positive in recent years Be confident collaboration among gig-event same ilk.
The talented group has taken with many new and senior bands On the potential of the local music organisers and bands to ensure
part in Battle of the Bands returning to the studio to record industry, Pablo! believes Sarawak local artistes are allowed to The group plans an album
competition, gigs, and religious new material. To survive in the bands must be confident to come perform live in promoting their release tour in Sarawak if
activities apart from busking industry, all the players must up with their own products and songs. conditions permit. The members
around Sarawak and doing live support each other. And in promote their songs. Covid-19 havoc hope the songs and their lyrics can
shows in Kuala Lumpur. Bintulu, the connection among the The music industry has been hard be accepted and enjoyed by
musicians is superb,” Morni “There are now many platforms hit by Covid-19 with revenue from listeners, especially from the young
Due to their work observed. to get known in – for instance, live performances being the generation.
commitments, the quintet social media, local radios and even biggest casualty. In light of the
practises every Friday at a home Good networking and newspapers. Bands must be pandemic, the way people listen to Their dream is to further the
studio. connection actually benefit the band’s brand throughout the
music industry as a whole because country and help develop the
On Hello Mr Pablo! and the six music industry in Sarawak.
demo songs, they were happy with
The members also hope to
come up with music videos but this
has to wait until after the Covid-19
pandemic. – The Borneo Post
Parton is Dolly Parton isn’t slowing down
up for a DOLLY Parton may have twice She revealed that she has Former president Barack in her first ad during an
Grammy turned down Donald Trump’s heard from Biden about the Obama gave the medal to several American football
Award in Presidential Medal of Freedom, award too. “Now I feel like if I music legends including Stevie championship game.
March. but the ageless queen of country take it, I’ll be doing politics, so Wonder and Bob Dylan, but in In the spot by website hosting
has multiple irons in the fire I’m not sure,” she said. November he said it was “a company Squarespace, Parton
including an ad appearance mistake” not to award Parton. reimagines her feminist anthem
during Sunday’s Super Bowl. As for the possible as 5 to 9, a nod to the side hustle
presidential medal, “I don’t work “I think I assumed that she’d culture so many people have
The pop culture icon who for those awards,” the self- already got one and that was embraced in the new
penned megahits like I Will effacing Parton said. incorrect,” Obama told the CBS millennium.
Always Love You and Late Show. “I’m surprised, she “This was a wonderful way to
workingwoman call to arms 9 to “It’d be nice but I’m not sure deserves one.” bring back that song, add new
5 now says she remains unsure that I even deserve it,” she added. Longtime philanthropist words and talk about what these
whether she would accept the “But it’s a nice compliment for Parton, at 75, has remained new people are doing,” she said.
highest civilian honour from the people to think that I might relentlessly busy. The Tennessee native who
nation’s new President Joe Biden deserve it.” grew up poor is a longtime
because it would appear too She is up for a Grammy philanthropist, an ally to the
political. Trump gave the Presidential Award – her 50th nomination – marginalised.
Medal of Freedom to one in March and wrote music for the Last year she gave US$1
“I couldn’t accept it (from musician, Elvis Presley. Late in 2018 Netflix coming-of-age million (RM4 million) to
Trump) because my husband his term he controversially movie Dumplin’. She is the Vanderbilt University which
was ill and then they asked me bestowed the award on two subject of a popular podcast, and helped develop Moderna’s
again about it and I wouldn’t members of Congress loyal to is hawking a new perfume. coronavirus vaccine. And her
travel because of the Covid,” the president through his two literacy programme has donated
Parton, who donated to the impeachments. Parton just cut a digital-age some 100 million books to needy
development of one of the main version of her classic 9 to 5, the kids worldwide. – ETX Studio
coronavirus vaccines, explained New England Patriots coach track from her 1980 blockbuster
in an interview with NBC. Bill Belichick turned down the film of the same name, to feature
medal last month following the
US Capitol riot on Jan 6.
YOUTH 3theSun LYFE ON TUESDAY | FEBRUARY 9, 2021
Next Gen Her against the world ceiling, the audience has been very
open to what we have to say.
oRising rap artiste Sya has taken the local hip-hop scene by storm
with her debut single PrettyGirlBop Within Malaysia, religion and
race play a part as well. People need
█ BY JASON LIM in how I write and make music. to realise that if they impose these
For me, I love travelling and I biases against women, they should
IN MAY last year, do the same for male rappers as
multitalented would love to “live” in the moment well.
rapper Sya – part as well. From the people I meet to What makes a good rap artiste?
spoken word personal experiences, everything Being real, being honest and just
artiste, part travel writer, and anything, I try to feel it as much having a good understanding of
part R&B diva – became the as I can, because writing it out yourself and things around you. The
first female artiste signed to makes me feel more human and essence of a rapper is not only in Sya considers
Def Jam Southeast Asia. Six connected. With songwriting, it just what he or she writes, but also how herself a feminist
months later, she released her adds more power to the words you he or she conveys or delivers those who believes in
debut single PrettyGirlBop, are saying. messages. equality for both
produced by SonaOne and Your debut single PrettyGirlBop genders,
featuring Singaporean rapper with Yung Raja is an empowering It is not enough to have dope regardless of race
Yung Raja. one, about reconstructing stigma lyrics but to be able to carry the or religion. –
But before entering the and reclaiming identity as energy, let it be songs about toxic PICTURE
milieu, Sya had long been women. Tell us more about it. men or women empowering COURTESY OF
quietly writing spoken I have always considered themselves. If you’re going to rap UNIVERSAL
word poems and songs PrettyGirlBop my little sweet about soup, make it a good one to MUSIC
within her bedroom serendipity because it came at a get people hungry. MALAYSIA
walls, which she time of my life when I felt fully Have you ever doubted yourself
never revealed to confident as a woman and it was on how far you could go as an
anyone except her made unexpectedly as well. artiste?
close friend, Pola. All the time! I have a huge imposter
It was not until This pandemic definitely syndrome which is a form of self-
Pola recognised challenged me on all aspects – gaslighting. You deny your
the potential in financial, emotional, spiritual and achievements no matter how huge
those written more. So when PrettyGirlBop was or good they are because you think
verses that Sya made, it was at a time I finally felt you are just “lucky”, and you fear
decided to give that I slowly found my footing and that at some point,
rapping a shot voice in this world. Together with all someone would catch you
and posted her my personal experiences, of course. and call you out on it.
first freestyle You mentioned that the song was
video, KIKA, in also inspired by women like your After much reflection
January 2019 and late mother. What was she like? and making a
quickly grabbed the She was the reason I was inspired to conscious effort to
attention of Joe Flizzow, stay strong, especially through appreciate and
SonaOne and NJWA. difficult times during this love myself better,
“Growing up, I listened to more pandemic. After her passing, I was that part of me has
pop than hip-hop, and I was heavily on my own a lot, but I had huge become less and
into Michael Jackson and Britney support from my friends who less. Now, I have
Spears,” she said. guided me through my struggles learned to trust
and uplifted me. She and I had a lot that there is a
of things in common, from fashion reason I am here,
to especially music. She had very surrounded by
good taste in music. She knew supportive
exactly what suited me. She has people whose
certainly influenced how I make opinions
music today. matter
Do you think there is a certain to me.
barrier that holds back the local
Juggling “Then later, I started listening to hip-hop scene from realising its
between her Beyonce, Missy Elliot and other full potential?
day job as a similar artistes, but what really As cliche as it sounds, being a
travel writer got me into hip-hop was Kanye woman in the rap industry, is
and her music West’s Gold Digger, that has initially some form of a barrier.
career, the 23- \TRIVIA left an imprint on me.” But now, with a strong female
year-old figure such as local rapper
described it as a Local artistes you would love to How would you describe Zamaera breaking the glass
love-hate collaborate with: Yuna, Lil Asian your writing and music
relationship but Thiccie and Zamaera. style?
enjoys being Least favourite music genre: I never really liked to box
busy Country. myself in when it comes to
nonetheless. – Who are your style icons?: Rihanna music genres, but I definitely
PICTURE and Kendall Jenner. lean more towards R&B, hip-
COURTESY OF Three things you cannot live with- hop and sometimes, pop
COLIN SYDNEY out: God, my cats and my friends. influences. As I get older and
PHOTOGRPAHY exposed to different cultures
and influences, it also plays a part
LIFESTYLE4 theSun LYFE ON TUESDAY | FEBRUARY 9, 2021
A cosy have
o Model and actress elements co
Amber Chia chooses house will l
comfort over grandeur certain trend
when it comes to house will lo
decorating her three- need anothe
storey residence
“I do not
█ BY BISSME S. house consta
clothes!” she
MALAYSIAN supermodel
Amber Chia believes that if you The most
over-decorate your house, it the living ro
might turn out looking too drapes and a
grand, and you might feel like a bird wall, which w
trapped in a golden cage.
“Your home should be comfortable and “I was 21
practical,” said Chia, who was kind enough said Chia, w
to let theSun have a look at her three-storey Perak but rai
house in Kuala Lumpur.
“I spend a lot of time at home when I am “The por
not working. As such, it is important to feel among my g
warm and cosy. I want my house not to be even inspire
overcrowded with stuff. I love to have themselves i
plenty of empty spaces that give a certain
sense of freedom.” On her fa
She said she is glad that visitors to her red, followe
home also feel at ease and relaxed. colours, esp
Chia said when she first started home.
decorating her home, her dining table had
fancy-looking wooden chairs. For her b
“The chairs looked beautiful, but they with a simp
were not comfortable for you to sit on for a item in her b
long time. I spend a lot of time at my dining
table, enjoying meals while chatting with “I believe
friends and family, so it’s important to have because I s
comfortable dining chairs.” comfortable
She then changed her stylish wooden sleep well.”
chairs to ones with comfortable cushions.
In term of decor style, Chia describes Her bedr
her home as a mixture of modern, allows sunlig
contemporary and classic.
The model, who has appeared in more “Accordin
than 300 magazine covers and many good luck to
runway shows, said:” When you have these your bedroo
Chia conv
in her house
“I have a l
A huge walk
things neat a
Her garde
bench. The
Golden Retr
adopted 16
space for Kel
to spend tim
She move
Lama in 2008
“It is unli
have gotten u
this area.
LIFESTYLE 5theSun LYFE ON TUESDAY | FEBRUARY 9, 2021
Home sales
rebounded
with the
start of
summer.
US housing boomed in
2020 despite pandemic
THE US housing market
en Chia’s living boomed in 2020 even as the opportunity.
ombined in your interior, your room has red coronavirus pandemic caused The Pew Research Center
look timeless. If you follow a curtains. one of the worst economic
d, then a few years later, your contractions of modern times, in July reported that about one
ook out of fashion and you will The dining as Americans took advantage in five Americans moved due
er major redecorating. area. of low borrowing rates to buy to the pandemic or know
want to change the look of my The garden is a homes. someone who had, and 18% of
antly like the way I change my cosy area for those who moved said the
e quipped. relaxation. The surge in home sales, reason was financial.
t striking feature in her home is Chia goes for and home construction,
oom, where she has big red simplicity and underscores the unequal But there was also evidence
a huge portrait of herself on the sophistication experience of the pandemic that people took advantage of
was taken 19 years ago. for her across the United States. Even the changing situation to try
1 when the portrait was taken,” bedroom. – as tens of millions of people out new digs. Pew reported
who was born in Teluk Intan, ALL PICTURES lost their jobs due to the that 13% of people moved to a
ised in Tawau, Sabah. BY MOHD pandemic disruptions, others second home or vacation
rtrait is always a talking point AMIRUL were actually able to afford residence, while nine percent
guests. A few of my guests were SYAFIQ/ major property purchases. headed to a new place that
ed to put a huge portrait of THESUN they either bought or rented.
in their own living rooms.” It is a stark contrast to the
avourite colour, Chia said it is 2008 global financial crisis, Though some sectors of the
ed by black and white. These when mortgages were at the economy are struggling to
pecially white, dominate her center of the downturn and recover from the business
bedroom, she goes for white the American housing market restrictions that began last
ple look. The most expensive collapsed. March to stop Covid-19 from
bedroom is her mattress. spreading, home sales
e in investing in a good mattress Existing home sales last rebounded sharply as summer
spend a lot of time here. A year hit the highest level since arrived, and remained strong
e bed is important for me to 2006, the National Association even as the pace slowed.
room has huge windows that of Realtors (NAR) reported,
ght into the room. with sales rising to 5.64 “The housing market has
ng to Chinese fengshui, it is million. That was about 5.6% been a bright spot of the
o allow the sun to shine into higher than in 2019, before the economic recovery thus far,”
om,” she said. virus harrowed the world’s said Joel Kan, associate vice
verted one of the seven rooms largest economy. president of the Mortgage
e into a walk-in closet. Bankers Association.
lot of clothes for my modelling. “What’s even better is that Tapering off
k-in closet is necessary to keep this momentum is likely to Homebuilders have struggled
and in order.” carry into the new year, with to keep up with demand, and
en is small and simple, with a more buyers expected to enter construction of new homes
garden area is mostly for her the market,” NAR Chief grew seven percent last year
riever named Kely, that she Economist Lawrence Yun compared to 2019.
years ago. “The garden has said.
ly to roam easily and allows me Low rates, cheap loans Existing home inventory in
me with her too.” The housing market was fairly December dropped to 1.07
ed into the house in Jalan Klang solid before the pandemic hit, million units, 16.4% lower
08 and is very happy to stay put. but the Federal Reserve’s than November and down
likely I will move from here. I decision to slash its 23% from the year-ago period,
used to the house and living in benchmark lending rate to NAR said. Unsold inventory is
zero as the coronavirus crisis also at a 1.9-month supply, an
began, has fueled the surge in all-time low.
purchases that began after a
short pause. Strong demand and short
supply sent the median sale
The drastic move by the price upwards to US$309,800
Federal Reserve was a sign of (RM1.24 million), 12.9% above
the severity of the damage December 2019, and Kan
andwas intended to keep the warned that if the situation
economy afloat in these doesn’t change, this could
uncertain times. affect many first-time home
buyers who make up a third of
The last time the central demand out of the market.
bank cut rates to zero was
during the global financial Ian Shepherdson of
crisis, when the housing Pantheon Macroeconomics
market was in the eye of the predicted the housing market
storm and a wave of subprime was in for a “modest
mortgage defaults caused correction” and that prices
millions of foreclosures. would continue to rise.
With mortgage rates hitting “We expect a renewed,
historically low levels last year, sustained increase in housing
according to government- activity in the spring, when the
sponsored lender Freddie Covid pandemic should be
Mac, buyers seized the receding, but sales are
unlikely to rise further before
then,” he said. – ETX Studio
FEATURE6 theSun LYFE ON TUESDAY | FEBRUARY 9, 2021
█ BY S. TAMARAI CHELVI Creative (from left)
earrings for the Christine, Lilian
THE Lunar New Year is just around Year of the Ox and Lisa.
the corner and it is time to
celebrate by choosing the right o Three sisters share their passion for crafting unique (right) This
outfit and matching it with a pair handmade accessories pair from the
of eye-catching earrings. Spring series
is inspired by concept that our designs have to be pretty
Local online brand ArtsiE the Chinese and versatile.“
(@artsie_handcrafts on Instagram) has a money Celebrating CNY
collection of Chinese New Year-themed pouch. The sisters, who live in three different
earrings that might just be the perfect (left) CNY places and who have not met each other for
complement to your outfit. themed more than a year, hope to welcome the Year
earrings from of the Ox together.
The brand was founded by the Yuen the Kam
sisters Lilian, Lisa and Christine, who series. –
started handcrafting their unique pieces COURTESY
since September 2019 and later turned OF
their passion into a business. ARTSIE_HAN
DCRAFTS
“CNY brings joy and everyone should
dress their best and we hope ArtsiE (right)
earrings can complement their outfits,” Mandarin
said Lilian, the eldest of the three. and gold
ingot Fook
“Our designs are inspired by popular
Chinese food items like Mandarin oranges, studs.
decorative items and auspicious words,
which is a must-have during this festive (above) Triangle
occasion.” Mandarin Studs.
“This year, we created six new loving family. We learned to sew, create don’t really know when inspiration will
handmade series – Fluff and Shine, embroidery and learnt beadwork skills strike. But we are most inspired and
Auspicious Bloom, The Loving Jewels, The since we were young from our grandma, creative when we break away from our
‘Kam’ (Mandarin orange), Spring, and Qixi mum and aunts, as well as some related daily routine to spend time together,” said
(Chinese Valentine). technical skills from our dad,” said Lilian. Lisa.
“The ‘Kam,’ The Loving Jewels and Qixi “Although each of us is a crafter, we “Most importantly, we stick to our
were a big hit, as it was almost sold out on
the day it was launched,” she added.
Although the inspiration for their
earring designs comes from the simplest
things, the Yuen sisters make a conscious
effort to choose the right traditional items
that represent good luck and prosperity.
“The Mandarin orange is a must-have
because it has a similar pronunciation as
the word ‘gold,’ which brings prosperity,
while the Koi fish and lotus are deemed
auspicious and is believed to bring
happiness and success,” said Lisa, the
second of the three siblings.
Each pair of earrings range from RM35
to RM68, depending on the material and
complexity of each design.
The sisters said they often use high-
quality polymer clay from local or overseas
suppliers, depending on availability, as
some types of clay are rare and not
available locally. Some of their high-
quality hardware are imported from Japan,
for its durability.
Apart from clay earrings, the sisters also
make Japanese Tensha earrings,
incorporating Tensha beads, which has an
intricate design.
“We pair these pretty beads with studs
and tassels for one-of-a-kind earrings,”
said Christine, the youngest sister.
Sister Act
“We are lucky siblings born into a craft-
Look your best this CNY
█ BY S. TAMARAI CHELVI distant family and friends. Staying safe and keeping with the spirit of CNY.
EUNICE Yap, owner and designer at healthy is a priority this year.” Signature style
KoaraJewels.com, said despite the current Yap loves to push the boundaries of
movement control order, there is no Recently, Yap launched three special creativity with her designs.
reason not to glam up for the upcoming series – CNY Greetings, Fortune Cat and
Chinese New Year celebration. Yellow Citrine crystal, and the Ruyi knot “Mismatch earrings are rare in a normal
series to usher in the Lunar New Year. fashion jewellery store. I believe the beauty
“We can still dress up and look beautiful of a mismatched pair of earrings will only
with earrings for the virtual screen. Despite Her designs mainly consists of enhance any hairstyle and outfit while
social distancing, CNY traditions will still handmade Japanese Tensha beads, that creating an eye-catching look. It
continue, just in a different way,” said Yap. comes with beautiful flower patterns, gets a second glance. I believe
Swarovski crystal beads, crystal pearls, and women wear a piece of
“Whether it is MCO or CMCO, I would thematic metal pendants or charms, jewellrey not only to look good
still dress up and wear my jewellery to mixed and matched with handmade but also to feel good and enjoy
celebrate CNY in the new normal style, feminine ribbons, tassels and flower balls. the second glances or
and have a small reunion dinner with close compliments as well.”
family members and virtual greetings with Yap said she also uses natural citrine
crystal and rose quartz, that are popular
stones that attract positive energy, in
Mismatch Mismatch Red Carp Mismatch Yap’s “Mismatch Spring Butterfly Pink
Pink Butterfly earrings. – COURTESY OF Blue Wave Crystal Tassel Earrings” and “Mismatch
earrings. EUNICE YAP Fish earrings. Kiku Tensha with Sweet Pink Tassel” has
Renewal Deer sold out due to its simple yet unique style
Mismatch and versatility.
earrings.
“Although ‘mismatch’ earrings are
popular, my style is often inclined towards
feminism, simple elegance and soft
colours,” she said, adding that
KoaraJewels’s tagline is “Beautiful
Everyday”.
“I believe every piece has a story to
share. Every bead and metal art piece is
carefully sourced for quality and value.”
EDUCATION 7theSun LYFE ON TUESDAY | FEBRUARY 9, 2021
Winning entry
o Management and Science University student’s
mental health article aces international competition
MANAGEMENT and Science and Dean’s List award seven times for Rossheni is employability. graduates with a well-rounded education
University’s (MSU) former emerging tops in academics and co- one of MSU With 98.7% of its graduates successfully sought by employers.
student Rossheni Kaur Balwant curricular activities. School of
Singh has been declared the Pharmacy’s securing employment within six months of Various skill-enhancement programmes
winner of the World Mental Health Day She also proposed a proactive measure star students. graduating, MSU is ranked first in graduate aimed at improving competitiveness are
Article Writing Competition, organised by for pharmacists to attain basic skill sets in employability by the Higher Education also offered to students. The Graduate
the International Pharmaceutical Students’ promoting mental health and offering Ministry. Employability Skills and Personal
Federation (IPSF) Asia Pacific Regional psychological support. Enrichment Competencies programmes
Office (APRO). Blending technical vocational education serves to improve soft skills.
Rossheni added that pharmacists can and training with traditional academic
Rossheni, who holds a Bachelor of capitalise on valuable resources, including curricula, MSU enhances competencies For information on pharmacy courses or
Pharmacy (Hons) from MSU School of Basic Psychosocial Skills: A Guide for Covid- through industry internship, community other programmes offered at MSU, call 03-
Pharmacy (SPH) and held the post of 19 Responders and Doing What Matters in and creative entrepreneurship, as well as 5521-6868, email [email protected], or
secretary of the MSU Pharmacy Club in Times of Stress: An Illustrated Guide. global exposure, empowering MSU visit www.msu.edu.my.
2018/2019, received a Certificate of
Excellence for her article, The role of They can also obtain certification in
pharmacists in building resilient Mental Health First Aid, she added.
communities to improve mental health and
wellbeing during Covid-19. Her third proposal was for pharmacists
to undertake professional mental health
In her article, Rossheni proposed mental training programmes to build supportive
health and wellness programmes as well as environments, which is required for the
literacy improvement to encourage nurturing of resilient communities.
pharmaceutical contribution towards
building resilient communities. As pharmacists already play a role in
psychiatric services (government hospitals,
She wrote that pharmacists are community pharmacies), such training
equipped with knowledge, communication programmes would enhance their
and counseling skills, and can utilise tools contribution towards the workforce in their
such as Australia’s “R U OK” and the capacity to improve mental healthcare
Malaysian Mental Health Booklet as basic through professional distribution and
guides to initiate conversations related to access.
mental health.
Rossheni’s winning article is due to
Mental wellbeing is considered a state of appear in the IPSF APRO World Mental
health. In 2020, mental wellbeing was Health Day 2020 official booklet.
placed second behind the effects of
cardiovascular diseases on human health She is among half a million pharmacy
and economic potential, owing to the students to be affiliated to IPSF worldwide,
Covid-19 pandemic. through regional extensions of APRO, the
African Regional Office, Eastern
Hence, community resilience and Mediterranean Regional Office, European
supportive environments are important, Regional Office, and the Pan American
not only for health and wellness, but also to Regional Office.
achieve the United Nations Sustainable
Development Goal. The first and second runners-up in the
competition were Chui Jun Hao from
As one of the university’s star students, AIMST University and Lai Jun Hua from
she received the President’s List award once Universiti Sains Malaysia.
As a top university in Malaysia, MSU
prioritises student development to enhance
MEDIA & MARKETING8 theSun LYFE ON TUESDAY | FEBRUARY9,2021
Glorious spring time
BERJAYA Times Square Kuala Lumpur is now
buzzing with festive celebrations until Feb 26. Opulence Red Packets. Soak in the festive spirit at Berjaya Times Square Kuala Lumpur.
Swing by and be awed by the remarkable
Chinese New Year decorations of “Glorious Heineken Malaysia wins
Spring Time” at the mall’s Ground Floor Central 3 Putra Brand Awards
where you can soak in the festive spirit of spring
under the dazzling display of Properity Red
Lanterns and be inspired by the serenity of the
Imperial Garden.
Shoppers can also redeem exclusively
designed Opulence Red Packets at Berjaya Times
Square Kuala Lumpur until Feb 21. Just spend a
minimum of RM50 in no more than four same-
day receipts. However, each shopper can only
redeem one set of angpow packets per day.
Golden Bridge
at 1 Utama.
Tiger Roland:
Street We would
Food like to
Virtual thank our
Festival. consumers for their
continuous support of
o Tiger Beer uncages Platinum Award, Heineken our brands. The past
and Guinness continue winning streak with Gold year was indeed tough,
and Silver respectively but it also showed us
that it is more important
A magnificent celebration of HEINEKEN Malaysia Berhad at the Putra Brand Awards 2020 are than ever to regularly
Spring (Heineken Malaysia) raised excellent recognitions for our connect and engage
their glasses to another world-class brands and their dedication with our consumers.
THIS Lunar New Year, Beijing’s Palace have been recreated at outstanding achievement at in better serving our consumers. It is Chabot:
Summer Palace serves as an the mall’s concourse LG Oval. the Putra Brand Awards by bringing also an honour for Tiger Beer to be the These wins
imperial backdrop for the Each complex has been part home three more accolades in 2020. second beer brand to achieve Platinum at Putra
Chinese New Year decorations at rebuilt to capture different Tiger Beer clinched the most prestigious status after Heineken won it in 2019. In Brand
1 Utama to offer enlightened symbolic meanings, painted in Platinum Award, while Heineken an increasingly virtual landscape, we Awards 2020 are excel-
serenity and good fortune for auspicious red and decorated achieved Gold, and Guinness won seek to create meaningful experiences lent recognitions for our
shoppers. with gold lanterns. Silver. The latest win brings Heineken for our consumers through innovative, world-class brands and
Malaysia’s total awards tally at the Putra digital-led campaigns. By listening to their dedication in better
Once the regal retreat of A Mystical Moon Gate with Brand Awards to 33 since 2010. our consumers on a more continuous serving our consumers.
royals, several iconic structures Bamboo is featured at its second basis, our brands can take steps to align
and gardens from the Summer concourse Centre Court. Tiger Beer won its first Platinum even more closely to what they want, Guinness Christmas Gift Sets. These
Award in recognition of the brand’s increasing our relevance, and delivering exclusive, limited-edition gift sets were
7-Eleven Malaysia ushers in CNY impressive efforts in connecting with results for both sides.” available on Drinkies.my as special
with amazing deals consumers during a challenging year. Christmas gifts for family and friends.
Tiger Beer supported Malaysian street In 2020, Heineken launched various Consumers were also encouraged to
7-ELEVEN Malaysia ushers in the such as Lay’s Assorted 48-52g, food by first donating RM1.5 million to exciting campaigns such as the join the Guinness Gift Exchange, where
Chinese New Year with the Hershey’s Nuggets Cookies ‘n’ street food vendors, coffee shops and Heineken Starclub NYE Live they stand to receive a prize for sharing
greatest deals and promotions! Creme 28g, Yeo’s Assorted 350ml food courts during the movement countdown party. The epic virtual party with Guinness the most disappointing
and Coca-Cola Assorted 500ml, control order (MCO) through its Save welcomed more than 200,000 gift they received in 2020.
Elevate the festive mood with among others. Our Street Food campaign; before Malaysians with live music
7-Eleven’s Oxpicious New Year launching the Tiger Street Food Virtual performances headlined by Dutch DJ Beyond engaging consumers during
promotions and bring home What’s more, enjoy random Festival – the world’s first fully- duo W&W, fireworks, and the longest these difficult times, Heineken
your favourite snacks and daily cashback up to RM888 to your immersive, 3D, online street food virtual “cheers” to usher in the new year. Malaysia’s flagship brands – Heineken,
essentials. Be sure to grab Touch ‘n Go eWallet when you festival experience. The brand delivered Heineken also launched the all-new Tiger Beer, Guinness, and Apple Fox
Chinese New Year must-haves spend RM12 and above in a street food experience onto screens to Heineken 0.0 cans for consumers to Cider – committed RM1 million and
such as Loke Kee Arrowhead single receipt via Touch ‘n Go ensure that consumers could enjoy enjoy the refreshing great taste of beer launched the “Raise Our Bars” platform
Chips 100g, Mister Potato eWallet “Pay” function at all 7- delicious street food and ice-cold beers anytime, anywhere. Through this to support bars and pubs. This initiative
assorted 150g, Thumbs Eleven stores nationwide. Each in the safety and comfort of their own campaign, consumers got the chance to enabled consumers to purchase
Groundnut 120g, and more. user is entitled to a maximum of homes. Tiger Beer also welcomed the invite Heineken 0.0 to their virtual vouchers for beer, stout or cider from
three random cashback year with its “Double the Huat” meetings and enjoy free cans of their favourite bars, and receive a
On top of that, enjoy ONG- throughout the promotional campaign in celebration of both Heineken 0.0 delivered right to their second, free of charge, from Heineken
some “Buy 2 Save More” deals on period, from now till March 7. Chinese New Year and its 88th doorsteps. Malaysia in return for their support. The
your favourite snacks and drinks anniversary. campaign also helped bars and pubs to
As Malaysia’s favourite and the recover from financial difficulties.
Roland Bala, managing director of World’s No. 1 Stout, Guinness stayed true
Heineken Malaysia said, “We would like to its consumer inspired approach in its
to thank our consumers for their activities last year. The brand created a
continuous support of our brands. The home edition for its Flavour by Fire
past year was indeed tough, but it also campaign by engaging celebrity chefs
showed us that it is more important Sherson Lian, Johnny Fua and Sapna
than ever to regularly connect and Anand to create new recipes using
engage with our consumers. A huge leftover ingredients suggested by
thank you as well to our people for consumers. This inspired consumers to
showing their passion for quality, their get creative with existing ingredients
commitment to innovation, and their from their kitchen and to create
agility to navigate the storm as one memorable cooking experiences with
strong team.” their loved ones as they stayed at home.
Guinness then ended the year on a more
Pablo Chabot, marketing director of joyful note through the introduction of
Heineken Malaysia added, “These wins
9theSUN ON TUESDAY | FEBRUARY 9, 2021
SPEAK UP
‘The social dilemma’ in our midst
FREESPACE of Trump who “incited his supporters to march interests based on the “clicks” or “taps” we have unregulated, especially given their pervasive
to Capitol Hill” where Congress was sitting to made. consequences.
Where young views rule certify Joe Biden as the 46th President of the
United States. It can be seen from the events Whether this recommendation system is Given the damaging effects of social media,
█ BY NUR ADILAH RAMLI that social media is not just a tool. necessarily a bad thing is up for discussion. how can we protect ourselves and loved ones
from being controlled and manipulated by
SOCIAL media has been a staple in the It has morphed into a behaviour-modifying The way I see it, it is a bad thing if we let social media?
lives of many that it is virtually tool, affecting not only young children and social media control our decision-making by
impossible to divorce our lives from teenagers but also adults. giving them hours of our time daily and As Tristan Harris said in The Social
social media given its wide-spreading effectively allowing them to modify our Dilemma, “it (social media) is confusing
use in our day-to-day activities. To shed light on the deleterious effects of behaviour and affect our decision. because it is simultaneous utopia and
social media, I recommend watching The dystopia”.
This is true for me, and may also be the case Social Dilemma (2020), a Netflix documentary- Though we could, to a certain extent,
with other social media users, that it is high drama which features a handful of tech insiders determine the kind of information that we On an individual level, what we can do is
time we looked at how these tools are who offer insights into the mechanics of social devour, social media corporations which are limit our screen time. I share the belief of many
impacting our lives and the measures we can media and the effects on its users. selling our attention to advertisers cannot that social media is fundamentally a force for
employ to control our use of social media. simply walk away from the fact that their good, and I have personally experienced a lot
In the documentary, Tristan Harris, a inventions are adversely impacting their users, of wonderful things through the platforms.
I once believed that social media was only a former design ethicist at Google who later co- through the dissemination of poorly-regulated
tool and as with any tool, depended on how it founded Centre for Humane Technology, says content. However, I cannot deny that social media is
was used. that “we have moved from having a tools-based highly addictive and manipulative, and that the
technology environment to an addiction- and Dangerous content available on social negative effects may outweigh the positives.
I likened social media to a knife designed to manipulation-based technology environment”. media may affect its users, especially young
cut an object. If the knife is used for other children who are more vulnerable to such In the documentary, Jaron Lanier, a
purposes which are detrimental, then the This is a huge concern as social networks content and may follow or replicate what they computer scientist, the founding father of
blame is not on the knife but on the person who are designed to keep us engaged on the screen. see on their screen. This is not an exaggeration. Virtual Reality and the author of Ten Arguments
misuses it. for Deleting Your Social Media Accounts Right
It is not only about the hours we lose to the On Jan 21, an Italian girl aged 10, who was Now suggests that we get out of the
I now realise how simplistic an argument it platforms; it is more the control we lose to them found with a belt tied around her throat, was manipulative social media ecosystem.
was, for social media in actuality is making it as we are being fed with content that we do not pronounced brain dead by a hospital in
substantially easier for users to disseminate require or look for, that could affect our Palermo, after allegedly taking part in the Of course, this depends on which path one
harmful content, incite violence, to name a few. worldview and decision-making. “Blackout Challenge” on the video-sharing is willing to traverse.
social network, TikTok.
Mark Zuckerberg in his Facebook post on I recently purchased a pair of shoes from a To parents, please supervise your children’s
Jan 7, stated that Facebook and Instagram have brand I had never heard of, until I saw its The challenge “encourages participants to online activities, especially in this age where
indefinitely banned former US president advertisement on my Facebook feed. choke themselves until they pass out for several information – and disinformation – is easily
Donald Trump for using their platforms “to seconds, which is meant to result in a high”. accessible in a few “clicks” or “taps”.
incite a violent insurrection against a Now, consider the number of times you
democratically-elected government”. bought items that you never searched for but Following the untimely death, the Italian While we demand social media
were recommended to you on your Facebook Data Protection Authority provisionally corporations create a safe environment for our
The following day, Twitter, as stated in its feed. “banned TikTok from further processing the children, we must not leave our children in the
blog, permanently suspended Trump’s Twitter data relating to any user whose age could not hands of the corporations.
account “due to the risk of further incitement of What happened to you and me was not a be established with full certainty so as to
violence”. coincidence as there are algorithms at play that ensure compliance with the age-related We should also continue to push legislators
predict our interests, based on our online requirements”. to craft policies surrounding social media, and
The moves by Facebook, Instagram, Twitter activities. to push regulators to penalise social media
and a few other social media corporations were In response to the order by the Italian corporations that fail to protect their users.
in response to the assault on Capitol Hill on Jan In the same documentary, Jeff Seibert, a authority, TikTok is blocking access to all
6 by Trump’s supporters, who rallied in support serial tech entrepreneur who is formerly an Italian users from today, and requesting them Though it may be difficult to beat the system
executive at Twitter, says that our online to re-enter their date of birth for verification, so intricately designed to keep us hooked on
activities are being watched, tracked and removing users aged below 13. the screen, let the negative consequences as
measured. reported on news and as can be seen around us
The action taken by the Italian authority is be a clarion call for us to exercise caution in
It should come as no surprise then that imperative and highlights that social media using social media.
social media could provide recommendations corporations must not be left unchecked and
that we may not look for but are related to our Comment: [email protected]
COMMENT by Noor Dzuhaidah Osman and Natasya Abdullah LETTERS
Depression not something to joke about [email protected]
IN light of the current controversy regarding feel lonely. everybody was getting everything off their Make screening at private
a group of panel members that ridiculed Even the disease itself could be worrying, chest since those kinds of sessions are taboo hospitals affordable
depression and suicide during an online in some cultures here.
discussion, we would like to draw the more so to those who contract the virus. WHY are tests for Covid-19 screening pricey, and cost
public’s attention to the inappropriate Depression is not just about mental Nevertheless, it was a “feel good” session an arm and a leg at private hospitals?
stigma associated with the condition, with counsellors from the NHS or the local
importance of recognising the early health being affected, but also physical council giving tips on coping with the There are two tests – one is the Antigen Rapid Test
symptoms of depression and encouraging health. People need to understand that the condition. kit (RTK-Ag) and the reverse transcription polymerase
those to seek treatment as soon as possible. condition is highly treatable. chain reaction (RT-PCR), better known as swab tests.
Facing stress is normal, but what is more
Depression is real and should not be There is comprehensive management of important is knowing where to turn to if The RTK-Ag tests identify the antibodies formed in
underestimated. Whenever anyone faces a depression available that includes things get out of hand. response to the presence of the Covid-19 virus. The
test, challenge or pressure, it is normal to medication and psychotherapies, where test delivers quicker results than the RT-PCR.
have a particular fight-or-flight response most of the time a person with depression There was a sense of support due to
reaction. can recover and live a healthy life. everybody’s encouragement, making the The RT-PCR swab tests identify the gene of the
environment feel normal. In short, nobody coronavirus and take a longer time to identify but are
We may feel stressed, anxious, or sad and Therefore, it is wrong to label them as thinks and treats you as a crazy person! more accurate than the RTK-Ag.
depressed, meaning we’ve lost our sense of crazy or insane.
enjoyment in what we usually do. You are normal like everybody else but Our public healthcare system, which provides free
The last thing they want to hear is people you need to have a coping mechanism. testing for all citizens, mostly uses swab tests but the
However, for most of us we bounce back, labelling them as such, causing them to lose only catch is that testing is conducted on those
adapt and fight our way through until we feel their sense of individuality and pride, If their case is more serious which showing symptoms and who are close contacts of
calmer and can function normally. especially when they are in a professional involves suicidal thoughts, abusive confirmed patients. The rest are at the mercy of the
group comprising a higher social status at behaviour, uncontrollable anger, drinking private healthcare system.
There are times when a person reaches a work or in the district town. and also drug addiction, they might need to
breaking point, where the emotional and be referred to hospital counsellors, The RTK-Ag test can cost anywhere from RM50 to
psychological disturbance is too much to Social stigmatisation of depression is psychiatrists, drug or drinking rehabilitation, RM350 while the RT-PCR test ranges from RM100 to
handle. inevitable, perhaps due to education and welfare, or the local council. RM580 at a private hospital.
lack of understanding of the condition.
If these disturbances persist for a long It is appalling that some people tend to Why do private hospitals charge such exorbitant
time and the intensity becomes too much to People lack information, awareness, and have a stronger sense of individuality, rates and why are their costs not fixed but vary from
bear, that person can develop depression. are sceptical of what constitutes depression, thinking they are better positioned than one private hospital to another?
and, in some cases, are in denial that they others, especially when they have a higher
Everybody is vulnerable to developing are experiencing depression. social standing and professionalism. These hospitals need to be more caring and
depression, especially in the current considerate in the way they charge patients.
situation which may exacerbate it. Some might think it is due to the lack of When they joke about mental health, it
faith in God, religion, self-induced attitudes already makes those affected feel worse and The Covid-19 pandemic has caused a global
No doubt, the Covid-19 pandemic has or exposures that made them unable to cope only adds to the public’s already high stigma. economic collapse, and many are losing jobs and
brought significant changes to human life with excessive stress. incomes. Hopefully private hospitals will lower the
and behaviour, and almost everyone is An honourable leader should lead by fees so that more people are able to get their
affected. Failure to understand the situation will example. Sensitive issues should be screening done at the private hospitals.
only inhibit acceptance and in turn cause approached with high caution, without
A housewife is tired of juggling them to refuse to seek treatment. judging and improper labelling. The government should step in and set a ceiling
housework and homeschooling the kids, price for Covid-19 test screening.
especially if she has to do everything alone We had a contrasting experience in the Rather than take the “wait and see”
without help. United Kingdom. The community there was approach, proactive solutions should be laid And this will go a long way towards easing the
more open to talking and discussing mental out to combat societal ills before it destroys over-burdened public healthcare system, which is
Children struggle with their studies, peer- health. the family institution and society as a whole. bogged down with treating infections.
pressure, a new environment, and adapting
to forced isolation during the pandemic. The community school even invited Noor Dzuhaidah Osman is senior lecturer When more people can be tested at private
some speakers from a nearby government of faculty of Syariah and Law, and Natasya hospitals at affordable charges, people will worry less
A person might have lost his job when he hospital and had some sessions with the and be better informed of their health status.
has hungry mouths to feed at home. parents, talking about the challenges they Abdullah is medical lecturer at Universiti
were facing and even to the extent of having Sains Islam Malaysia (USIM). Comments: Now, the thought of going for a screening test at a
Those undergoing quarantine can lose private sessions. private hospital can make one “sick” and “broke”.
their sense of integration with society and [email protected]
During the sessions, we felt awkward as Samuel Yesuiah
Seremban
S E C U R I T I E S S D N. B H D. SunBIZ TUESDAY
FEBRUARY 9, 2021
197201001092 (12738-U)
Editorial: Tel.: 03-7784 6688
A Participating Organisation of Bursa Malaysia Securities Berhad Fax: 03-7785 2624/5
A Trading Participant of Bursa Malaysia Derivatives Berhad Email: [email protected]
Advertising: Tel: 03-7784 8888
Participation Bought Sold Net
% Fax: 03-7784 4424
RM m RM m RM m Email: [email protected]
45.6 Institutions 2047.6 2063.5 -15.9
41.0 Retail 1909.2 1786.1 123.1
13.4 Foreign 547.6 654.8 -107.2 5.30 29.39
KLCI KOSPI
100.0 4504.4 4504.4 0.0 1,573.33 24.29 30.79 36.11 609.31 CLOSED 3,091.24 40.15
STI HANG SENG SCI NIKKEI S&P/ASX200
Preliminary stats (excluding trade amendments). For final data, please refer to www.bursamalaysia.com 3,532.45 29,388.50 TSEC
Source: Burs Malaysia 2,931.40 29,319.47 6,880.68
KL MARKET SUMMARY February 8, 2021
February 8, 2021
Khazanah accepts DNeX’s bid for SilTerra
INDICES 11,479.30 CHANGE -22.90 PETALING JAYA: Dagang NeXchange Bhd’s disclosed until the signing of the definitive DNeX and Green Packet Bhd were the
FBMEMAS (DNeX) bid to buy the entire stake in loss- agreement,” DNeX said in a stock exchange two local bidders for SilTerra.
FBMKLCI 1,573.33 -5.30 making semiconductor fabricating filing yesterday.
CONSUMER PRODUCTS 593.41 +4.03 company SilTerra Malaysia Sdn Bhd has Khazanah had earlier opened up the bid
INDUSTRIAL PRODUCTS 178.06 +1.51 been accepted by Khazanah Nasional Bhd, If successful, DNeX will hold a 60% stake for Silterra to foreign investors, which
CONSTRUCTION 165.47 +1.38 subject to the signing of a definitive in SilTerra while its partner Beijing CGP attracted Taiwanese semiconductor
FINANCIAL SERVICES 14,565.40 -11.50 agreement. Investment Co Ltd will hold the rest. manufacturer Foxconn and Germany-based
ENERGY 865.74 +26.42 semiconductor foundry X-Fab, but later
TELECOMMUNICATIONS 675.80 +6.13 “Acceptance of the bid is still subject to DNeX has offered a total of RM470 decided against selling Silterra directly to
HEALTH CARE 3,495.88 -81.60 strict confidentiality with Khazanah and no million for the acquisition of the entire stake foreign owners, but only to those that have
TRANSPORTATION further details of the bid can be publicly in SilTerra, which includes the assumption formed partnerships with local firms.
PROPERTY of its debts amounting to RM210 million.
PLANTATION
FBMSHA 775.65 +5.47 Unemployment rate in
FBMACE 691.30 -1.44
TECHNOLOGY 7,122.73 -17.90
13,013.40 -48.90
10,771.70 -89.50
85.62 -0.30
TURNOVER VALUE December rises to 4.8%
7.043 BIL RM4.504 BIL
5 MOST ACTIVES o Although CMCO was
February 8, 2021 lifted in most states,
labour market conditions
STOCK VOL CLSG (sen) +/– (sen) were still influenced by
DNEX 668,198,000 37 +9 Covid-19 pandemic
DNEX-WD 294,787,200 6.5 +1.5
LUSTER 214,620,000 22 +0.5
AT 125,554,700 16.5 UNCH
TRIVE 114,847,300 20.5 -5
5 TOP GAINERS
February 8, 2021
STOCK VOL CLSG (RM) RM PETALING JAYA: Malaysia’s unemployment
FANG-2XL 200 14.66 0.66 rate increased 4.8% to 772,900 persons in
HEIM 422,100 23.70 0.62 December according to the latest data
TASCO 3,681,800 5.00 0.51 released by the Department of Statistics.
SJC 908,700 1.78 0.41
SCIB 50,827,000 2.50 0.40 Chief Statistician Malaysia Datuk Seri
Mohd Uzir Mahidin pointed out the final
5 TOP LOSERS month of 2020 saw the conditional The number of own-account workers - daily wage earners at farmers’ markets, night markets
February 8, 2021 movement control order (MCO) lifted in and stalls; freelancers; and smallholders - decreased for the third month in a row, by 0.6% to 2.4
almost all states except for Selangor and million persons in December 2020. – BERNAMAPIX
Sabah, and the Federal Territory of Kuala
STOCK VOL CLSG (RM) RM Lumpur, along with the resumption of freelancers; as well as smallholders, which or insufficient work, against 403,800 persons
BLDPLNT 500 7.51 0.49 interstate travel from Dec 7. account for 15.8% of overall employment, in the previous quarter.
DLADY 25,900 34.40 0.46 decreased for the third month in a row,
HARTA 5,742,200 12.90 0.34 He noted that although the number of falling by 0.6% to 2.4 million persons in The chief statistician observed that for
HLFG 42,100 16.76 0.34 new Covid-19 cases averaged 1,500 a day, December 2020. 2020 the LFPR edged down 0.3% to 68.4%
TOPGLOV 39,538,800 6.27 0.34 economic sectors continued to operate with against 68.7 in 2019, and the number of
strict standard operating procedures (SOP). The number of employed persons who employed persons decreased by 0.2% to
EXCHANGE RATES FEBRUARY 8, 2021 were temporarily not working increased to 15.1 million persons.
“Thus, in December 2020, the number of 146,200 persons from 142,000 persons in
Foreign currency Bank sell Bank buy Bank buy employed persons edged up month on November 2020, due to the implementation “The marginal decrease was due to the
month by 0.1% to 15.22 million persons of phases of MCO throughout the whole uncertainty in the labour market following
1 US DOLLAR TT/OD TT OD after registering a marginal decrease in the month as well as a short school break and the health and economic crises during the
1 AUSTRALIAN DOLLAR 4.1230 3.9980 3.9880 previous month,” he said in a statement. festive holidays. year,” he said.
1 BRUNEI DOLLAR 3.1810 3.0540 3.0380
1 CANADIAN DOLLAR 3.0880 2.9980 2.9900 However, the employment-to-population In December, labour market conditions “The health crisis has given a huge
1 EURO 3.2260 3.1400 3.1280 ratio, which indicates the ability of an were still influenced by the Covid-19 impact on the labour force which led to the
1 NEWZEALAND DOLLAR 4.9690 4.8100 4.7900 economy to create employment, remained pandemic and its economic consequences unemployment rate rising above 4% as
1 SINGAPORE DOLLAR 2.9820 2.8720 2.8560 unchanged at 65.1%. have caused slower recovery momentum. against an average of 3% recorded in the
1 STERLING POUND 3.0880 2.9980 2.9900 pre-crisis period. Thus, the unemployment
1 SWISS FRANC 5.6680 5.4900 5.4700 Going by economic sector, services saw The labour market remained rate rose to 4.5% in 2020, the highest rate
100 UAE DIRHAM 4.5670 4.4630 4.4480 an increasing trend continue largely in competitive with the number of labour force recorded since 1993 (4.1%).”
100 BANGLADESHTAKA 113.5300 107.6600 107.4600 wholesale and retail trade; human health increased to 15.99 million persons
100 CHINESE RENMINBI 4.9420 4.6400 4.4400 and social work; communication and (November 2020: 15.96 million persons) Towards the end of last year, Malaysia
100 HONGKONG DOLLAR 63.9000 61.4000 information; and education activities. and the labour force participation rate passed the 100,000 mark in Covid-19 cases
100 INDIAN RUPEE 53.7300 51.0600 N/A (LFPR) remained at 68.4%. and January 2021 saw the number of new
100 INDONESIAN RUPIAH 5.7500 5.4000 50.8600 Employment in tourism-related cases exceeding an average of 3,200 daily.
100 JAPANESE YEN 0.0304 0.0275 industries such as accommodation and The number of persons outside the
100 NEWTAIWAN DOLLAR 3.9110 3.7900 5.2000 food services; transport and storage; and labour force registered a decrease of 2,600 to With that, the operation of certain
100 PAKISTAN RUPEE 15.8000 0.0225 arts, entertainment and recreational 7.37 million persons compared with activities remained restricted such as social
100 PHILIPPINE PESO 2.6300 N/A 3.7800 activities remained on a declining trend, November 2020 with the largest gathering, cinemas and entertainment and
100 QATAR RIYAL 8.7000 2.4500 reflecting the consequences of the composition due to schooling/training. recreational activities.
100 SAUDI RIYAL 114.4400 8.2000 N/A pandemic to this industry.
100THAI BAHT 111.1100 108.6400 2.2500 The labour market conditions improved “Hence, it is foreseen that Malaysia’s
14.3300 105.4800 8.0000 In the manufacturing sector, employment gradually with the labour force and labour market will remain in a challenging
12.7100 108.4400 continued to record positive growth, employment situation continuing to situation in early 2021 but various assistance
105.2800 whereas the agriculture and mining and increase compared with the preceding and initiatives introduced by the government
12.3100 quarrying sectors remained in negative quarter, recording 15.92 million persons will cushion the impact of the pandemic to
territory for the fifth month. and 15.16 million persons respectively, said the labour market,” said Mohd Uzir.
Source: Malayan Banking Berhad/Bernama Mohd Uzir.
Similarly, the construction sector posted In a note, UOB Research said it expects
a decrease month on month. Meanwhile, the number of unemployed recovery to pick up from the second
persons increased 0.1 percentage point from quarter onwards as the National Covis-19
In terms of employed persons by status 4.7% in third-quarter 2020 and the LFPR Immunisation Programme gets under
of employment, the employee category improved 0.1 percentage point to 68.5%. way.
comprised 77.6% of overall employment,
augmented by 0.2% to 11.81 million persons In the fourth quarter of 2020, there were “We reiterate our 2021 unemployment
from the previous month. 533,700 persons who worked less than 30 rate forecast of 4.0% (MOF official forecast:
hours per week due to working conditions 3.5%) on the back of an uneven economic
The number of own-account workers, recovery,” it said.
made up of daily wage earners working at
farmers’ markets, night markets and stalls;
11theSUN ON TUESDAY | FEBRUARY 9, 2021
* SUNBIZ
Chin Hin eyes projects with Shin Yang Shipping
to buy haulage
firm for RM43m
RM3.7b GDV in next two years
PETALING JAYA: Shin Yang
Shipping Corp Bhd (SYSCorp)
yesterday entered into a conditional
share sale and purchase agreement
with Shin Yang Holding (the
PETALING JAYA: Chin Hin Group o Group to acquire 81.9 acres of land for vendor) to acquire the entire stake
Property Bhd aims to generate RM3.73 development in Klang Valley as part of its in Melinau Transport Sdn Bhd
billion in gross development value property segment expansion plan (MTSB) for RM43 million cash.
(GDV) from on-going and future The proposed acquisition is
developments in the next two years.
deemed a related party transaction
In a press statement yesterday, the in view of the interests of certain
group said it is spending RM268 directors and major shareholders
million to acquire 81.9 acres of land of SYSCorp in the exercise.
for the development of five different and various homeownership Barring any unforeseen The proposed acquisition is
property projects situated in the incentives will certainly bring some circumstances, the acquisition is expected to grow the future
Klang Valley. This is in line with the vibrancy to the market. expected to be completed by the earnings of the shipping segment
group’s overall strategy to “As a developer, this is a good time second quarter of 2021. of SYSCorp’s group of companies.
aggressively expand its property for us to seize opportunities with the “Estimated to generate RM1.1 It will also reduce outsourcing
development segment. currently attractive land prices and billion in GDV, Chin Hin has costs on land transport for
Chin Hin executive director Chiau expand our landbank at strategic proposed to construct a mixed- inbound and outbound cargoes to
Haw Choon (pix) said it intends to locations. This will ensure that the development on this freehold land and from Sibu, Miri, Bintulu, Kota
expand its portfolio of developments group has a clear and sustainable that is currently vacant. We chose this Kinabalu and Kuching, where
to various growth corridors in the growth plan ahead. We are targeting because of its strategic location in MTSB primarily operates in.
Klang Valley such as Serendah, to launch these properties in one to Cyberjaya which has seen significant At the same time it will enable
Bandar Kinrara, Bangsar South, and two years’ time in line with the development over the years driven by SYSCorp to leverage on MTSB’s
Cyberjaya. The types of expected recovery of the property the investment and presence of global network and client base to cross-
developments that are being market,” said Chiau. tech companies, prevalence of sell SYSCorp’s other shipping
proposed include townships, A filing with Bursa Malaysia universities and other amenities, and services under a unified
serviced apartments, mixed-use yesterday showed Chin Hin’s latest well-planned infrastructure. The “SYSCorp” franchise; and
developments and offices. proposal to acquire an 11.53-acre proposed acquisition to build up the strengthen its shipping offerings by
He said with the increasing prospect land in Cyberjaya for RM50.22 land bank and property development reducing the reliance on external
of effective Covid-19 vaccination this million, as part of the group’s pipeline of Chin Hin is expected to land transport service providers.
year, there is optimism that the continuous efforts to replenish its contribute positively to the group in As the vendor group’s sole in-
property market will see a turning point landbank at better and accessible the next five years and improve its house road haulage arm, MTSB
soon. Also, historic low interest rates locations for potential development. earnings visibility,” he added. had in the past three financial
years derived on average 73.7% of
its revenue from the vendor group
XOX acquires PLS Plantation appoints former and persons connected (other
29.4% stake than SYSCorp) various business
in Cheetah activities.
CIMB boss Nazir as chairman MTSB has been profitable in
the last three financial years and
recorded a revenue and profit after
tax of RM52.8 million and RM5.2
PETALING JAYA: XOX Bhd has PETALING JAYA: Ekovest Bhd unit potentially go up to 9.9% and will drop private equity firm Ikhlas Capital, million respectively for the FYE
entered into a sale and purchase PLS Plantation Bhd has invited to 7.44% assuming all of the following his retirement from CIMB June 30, 2020. With the exercise, it
agreement with Chia Yoon Yuen CIMB’s former CEO and chairman outstanding warrants are exercised. Group in 2018. is envisaged that MTSB will
Holdings Sdn. Bhd to acquire 33.8 Datuk Seri Mohamed Nazir Abdul “I look forward to providing my Meanwhile, Tan currently holds contribute positively to the
million shares representing Razak to assume the role of its non- guidance and insights at a time when the position of COO of Taylor’s financial performance and future
29.43% in Cheetah Holdings Bhd executive independent chairman PLS is moving to expand its durian Schools and had previously taken the profitability of SYSCorp.
for a total of RM44.62 million via effective Feb 10, after he emerged as a plantation and downstream role of Tune Group’s group CEO and “MTSB’s haulage activity
its wholly owned subsidiary XOX strategic investor. businesses, and diversify into other also general counsel of CIMB group. remains relevant in the supply
(Hong Kong) Limited. On the same date, Tan Hong agri-food areas,” Nazir said. Kang Hoo said the appointments chain of the Sarawak economy
Cheetah is involved in the Kheng will join its board as an With Nazir’s appointment, the are consistent with the company’s due to its decentralised nature
product designing, product independent non-executive director. group’s current chairman Tan Sri Lim ambitions to grow aggressively and (route flexibility and ability to
development, marketing and PLS had on Jan 22 announced a Kang Hoo will be redesignated as its transform into a major agrifood deliver directly to sites), which in
retailing of apparel for different private placement of up to 10%, which executive vice-chairman. He is also business conglomerate. turn enables just-in-time delivery
market segments and casual life- saw Nazir subscribe for 19 million PLS Ekovest’s group executive chairman. “Nazir brings an extensive particularly for the supply chain of
style. The brands include Cheetah shares at 95 sen per share. After the The changes follow the resignation corporate network and vast perishable and essential goods
Junior, Cheetah Ladies, C. Union, completion of the placement exercise, of Hisham Mahmood as senior experience in investments, merger such as agriculture products.
CTH Unlimited, C2 United, CTH Nazir’s shareholding represents independent non-executive director and acquisitions, finance and Coupled with the recent drop in
Ladies and Baby Cheetah. The 4.75%, based on PLS’s current share on Jan 29 and the earlier resignation governance. Tan has an impressive diesel prices which has reduced
company also has two international capital. of Datuk Lim Kang Poh, the non- track record in banking and finance the variable costs of haulage, the
licensee brands Ladybird–children He has also acquired options to independent non-executive director, and brings years of hands-on decentralised haulage industry in
wear and GQ–mens’ business wear. purchase a further 22.82 million of the on Jan 21. experience in legal and compliance Sarawak is also in a relatively good
The proposed acquisition will warrants in the company and Currently, the incoming chairman matters which become ever more position to quickly respond to
be financed solely from internally assuming these warrants are serves as the founding partner and important as the company scales up,” Covid-19 related disruptions,”
generated funds. exercised, his shareholding could chairman of the Singapore-based he added. SYSCorp said in its Bursa filing.
In a Bursa filing, XOX
highlighted a number of reasons
for the proposed acquisition, chief Censof posts RM2m Q3 net profit
among which, it said the Cheetah
brand dovetails well with the
target market segment that XOX PETALING JAYA: Censof Holdings to RM54.97 million from RM45.33
has dominance over. Bhd returned to the black for its third million.
“In additon, it provides co- quarter ended Dec 31, 2020, posting a In its Bursa filing, the group
branding awareness and product net profit of RM2 million against a net expects the economic outlook for
bundling synergy with XOX loss of RM83,000 reported in the 2021 to remain challenging given the
products and services, and it will same quarter of the previous year, recent surge in Covid-19 infections
automatically allow XOX to attributed to higher sales from and the return of travel restrictions in
mobilise its e-wallet reload attractive government grants in Malaysia.
deployment, by offering reload and Singapore, savings in finance costs, Nevertheless, it opined that the
usage at Cheetah’s touchpoints. and a profit contribution from pandemic has accelerated the shift
“Likewise, XOX has 20,000 Netsense Group acquired earlier in towards digital transformation
dealers who can immediately the year among others. supported by initiatives by the
increase their product offerings by Revenue for the period stood at government. Going forward, it is
offering Cheetah products. RM23.73 million, a 42.2% positive that the demands for Group returns to the black due to higher sales from government grants in
Acquiring a cornerstone stake will improvement from RM16.68 million technology solutions in Malaysia will Singapore, savings in finance costs and profit contribtution from the acquisition
allow consignment options to be reported previously. continue to grow. of Netsense Group. – CENSOF WEBSITE
accessed, providing XOX dealers For the cumulative nine-month “As such, we view this as an
with the capability to increase period, the group’s net profit stood at opportunity to push the adoption of The group recently entered into a “This is a testament of our efforts
their sales and turnover, benefiting RM14.09 million, over a ninefold technology transformation, share sale and purchase agreement to as we remain committed to
both companies,” it said. increase over RM1.54 million leveraging on the demands for acquire an additional 30.87% equity streamline and focus on growing our
The proposed acquisition is reported for the corresponding technology solutions in Malaysia and interest in Asian Business Software core businesses which have since
expected to be completed by first period of last year. Singapore,” said Censof’s group Solutions Pte Ltd, which will increase produced positive results for the
quarter of 2021. Revenue for the period grew 21.3% managing director, Shaik Mydin. its stake to 89.07% upon completion. group,” added Ameer.
12 theSUN ON TUESDAY | FEBRUARY 9, 2021
SUNBIZ
December manufacturing sales improve 4.5% on-year
PETALING JAYA: Malaysia’s food, beverages & tobacco products million decrease in salaries & wages RM366.4 billion compared to the declined 2.1% to RM1.34 trillion as
manufacturing sales rose 4.5% in (7.9%) and electrical & electronics paid to RM7.77 billion compared to same quarter of the previous year, compared to 2019, while the
December 2020 to RM124.6 billion products (4.2%),” said the chief December 2019. driven by transport equipment & number of employees engaged
compared to the previous year, statistician Datuk Seri Mohd Uzir other manufactured products during the period declined by 2% to
according to the latest figures by the Mahidin in a statement. Simultaneously, it reported the (15%), food, beverages & tobacco 2.2 million persons and salaries &
Department of Statistics. sales value per employee in products (9%) and electrical & wages paid fell by 1.1% to RM87.2
He observed the total employees December rose by 6.7% to record electronics products (4.3%). billion.
On a month-on-month basis, engaged by the sector fell 2% to 2.2 RM56,644 as compared with the
sales value rose 3.9%. million persons in December last same month in 2019 with an average The quarter also saw the number The statistics department
year from 2.24 million persons in salaries & wages per employee of of employees and salaries & wages revealed sales value per employee
“The year-on-year increase in December 2019. RM3,533. drop 2% and 1.2% respectively. during the reference period
December 2020 was driven by contracted by 0.2% to record
transport equipment & other According to the department, the In Q4’20, the manufacturing Overall, the manufacturing RM612,324.
manufactured products (20.5%), month also saw a 0.8% or RM59.7 sector’s sales value grew 3% to sector’s sales value for 2020
Industrial Production Mass vaccinations to
Index returns to expansion spur property market
in second half of year
o December reading up
1.7% year on year but KUALA LUMPUR: Malaysia’s economy is
mining and electricity expected to be on the mend after the mass
sectors post declines vaccination programmes with improvements
anticipated to be seen within the property
PETALING JAYA: Malaysia’s Industrial sector in the second half of 2021 (H2’21).
Production Index (IPI) grew 1.7% in
December 2020, compared to the same In a statement yesterday, PropertyGuru
month of the previous year, driven by a Malaysia country manager Sheldon Fernandez
4.1% growth reported by the said the property market is poised for a gradual
manufacturing index. recovery in 2021, driven by a better economic
outlook and low interest-rate environment.
However, the mining and the
electricity indices fell 5.4% and 0.2%. “The outlook is reflected by Bank Negara
Malaysia’s latest decision to maintain the
On a year-on-year basis, Malaysia’s overnight policy rate at 1.75% as the central
chief statistician Datuk Seri Mohd Uzir bank sees continued recovery in the global
Mahidin found manufacturing output economy.
rose 4.1% in December compared to a 2%
increase reported in November 2020. “However, the downside risks remain amid
uncertainties surrounding the Covid-19
“The major sub-sectors contributing pandemic,” he said.
to the growth in the manufacturing
sector in December 2020 were transport Fernandez added that based on the property
equipment & other manufactures (8.4%), portal’s Consumer Sentiment Study H1 2021
petroleum, chemical, rubber & plastic findings, they saw an improvement within the
products (7.7%) and electrical & property sentiment index, from 39 points
electronics products (7.6%),” he said in a (H2’20) to 42 points (H1’21).
statement.
Contributing factors include the current real
Meanwhile, the mining sector’s estate satisfaction, positive outlook on property
output deteriorated 5.4% yoy which was climate, favourable interest rate environment,
attributed to a 9% decline in the crude oil positive government efforts and favourable
& condensate index and a 2.5% drop in price outlook.
the natural gas index.
“Malaysians are cautious about property
The electricity sector output edged purchase, with 42% adopting a wait-and-see
down 0.2% in December 2020 as approach in anticipation of a better deal in the
compared to the same month of the future.
previous year.
“Many are expecting property prices to go
On the whole, the IPI for the final down further as developers adjust their pricing
quarter of 2020 fell 0.3% compared to the strategy to launch more affordable homes,” he
previous year largely due to a 10.5% said. – Bernama
contraction in mining and a 0.6% decline
in electricity. Vaxart oral Covid-19
vaccine gets positive
The quarter saw the manufacturing response in Phase 1
sector record an increase of 2.8%.
PETALING JAYA: Widad Group Bhd which is
For the full year, the IPI shrank 4.2% collaborating with Rinani Dynamic Sdn Bhd
compared to 2019, attributed to a drop in to distribute US-based Vaxart Inc’s oral-based
all indices; mining index (-9.7%), Covid-19 vaccine said phase one of clinical
electricity index (-3.7%) and trials have achieved positive response.
manufacturing index (-2.7%).
Vaxart is an American biotechnology
Foreign net buying at RM117m last week company developing a range of oral
recombinant vaccines based on its
PETALING JAYA: Foreign investors were net outflow was recorded on Friday at RM38.78 Since the beginning of 2021, proprietary delivery platform, which are
buyers last week with inflow to the tune of million and the smallest outflow was on cumulatively, retailers have been the only designed to be administered using tablets that
RM117.05 million, according to MIDF Wednesday at only RM4.9 million,“ MIDF net buyers of the domestic equity market to can be stored and shipped without
Research. said in its fund flow report yesterday. the tune of RM1.98 billion. Local institutions refrigeration and eliminate the risk of needle-
and foreign investors are net sellers to the stick injury.
As the market reopened last Tuesday, It was the opposite for retailers, who were tune of RM1.26 billion and RM720 million
foreign investors bought RM179.11 million net buyers every day for last week except on respectively. According to Vaxart’s filing on Nasdaq, the
net of local equities, with retailers and local Tuesday. Largest net buying was recorded oral vaccine was generally well-tolerated, and
institutions as net sellers of RM6.01 million on Thursday at RM105.81 million and “In comparison to another three immunogenic as measured by multiple
and RM173.1 million respectively. Last week smallest net purchase was on Wednesday at Southeast Asian markets that we tracked last markers of immune response to the Covid-19
was a four-day trading period which started RM49.52 million. week, Thailand is the only country that antigens.
on Tuesday. recorded net outflow last week.”
Meanwhile, local institutions were net In addition, it also reported the vaccine
“Even with the weekly positive inflow, the sellers every day of last week. Cumulative In terms of participation, the retail could have broad activity against existing and
market saw net foreign outflow every day of weekly outflow was to the tune of RM339.17 investors recorded a weekly decrease of - future coronavirus strains.
the week except on Tuesday. The only inflow million. The biggest outflow was on opening 14.55% in average daily trade value (ADTV)
was to the tune of RM179.11 million. day of last week trading period and smallest while the foreign investors and local Widad’s managing director Datuk Mohd
Subsequent continuous selling was not able outflow was on Friday at RM173.1 million institutions experienced declines in ADTV Rizal Mohd Jaafar commented that the results
to negate Tuesday’s inflow. Largest foreign and RM34.04 million. of -9.68% and -19.85% respectively. are timely given the emergence of new
variants being less responsive to first
generation vaccines, thus making potential
cross-reactivity another important advantage
of next-generation vaccines.
“These results, together with recent data
from other biotechnology companies that are
currently doing their clinical study on the
Covid-19 vaccine, further raise our confidence
in the success of Vaxart Covid-19 oral vaccine,”
he told Bursa.
IN THE MATTER OF THE 13theSUN ON TUESDAY | FEBRUARY 9, 2021
COMPANIES ACT, 2016 * SPORTS
and Osaka, ‘vintage’ Serena make flying starts
IN THE MATTER OF
322 Notices 322 Notices SYARIKAT PELANCONGAN NAOMI OSAKA overcame an attack well,” Osaka told a smattering of Mihaela Buzarnescu 6-2, 4-6, 6-3.
SERI ANDALAN (M) SDN. BHD. of nerves and Serena Williams put on spectators on the socially-distanced The 20-year-old Canadian last
IN THE MATTER OF THE IN THE MATTER OF THE Registration No. 198301008562 a “vintage” performance as the court.
COMPANIES ACT, 2016 COMPANIES ACT, 2016 coronavirus-delayed Australian Open played at the WTA Finals in October
(103813-X) finally got underway yesterday. Williams started her quest for a 2019 at Shenzen, China, where she
AND AND (In Members’ Voluntary record-equalling 24th Grand Slam suffered the knee injury that
IN THE MATTER OF IN THE MATTER OF World No. 2 Simona Halep also title in style with a 6-1, 6-1 romp past scuppered her entire 2020 season.
XINREN CAPITAL Winding-Up) breezed past Australia’s Lizette Germany’s Laura Siegemund in 56
AUTOMOL SDN. NOTICE IS HEREBY GIVEN that Cabrera in straight sets in another minutes. French Open champion Iga
SDN. BHD. BHD. (Company No: pursuant to Section 459(2) of the convincing start by one of the Swiatek, 19, beat Arantxa Rus 6-1, 6-3
(Company No: Companies Act, 2016, the Final tournament’s leading lights. “This was a good start, it was to reach the second round and
200501011179 (688227-H)) 200601011232 Meeting of the contributories of the vintage Serena,“ said the 39-year-old, continue her Grand Slam winning
(IN MEMBERS’ VOLUNTARY (730982-W)) abovenamed Company will be held After the tortuous build-up, third playing an unparalleled 100th match streak.
WINDING-UP) at the Liquidators’ office at Wisma seed Osaka struck the first serve on at the tournament and turning
NOTICE IS HEREBY GIVEN (IN MEMBERS’ VOLUNTARY Goshen, 2nd Floor, 60, 62 & 64 the centre court against Russia’s heads in a brightly coloured, one- Angelique Kerber, the 2016
that in pursuant to Section WINDING-UP) Jalan SS 22/21, Damansara Jaya, Anastasia Pavlyuchenkova and legged catsuit. Australian Open winner, was the first
459 of the Companies Act, 47400 Petaling Jaya, Selangor strode just 68 minutes later as a 6-1, significant casualty of the women’s
2016 a Final Meeting of the NOTICE IS HEREBY GIVEN Darul Ehsan on Friday, 12th day of 6-2 winner. Later, the 2019 US Open championship when the 23rd-
abovenamed Company will that in pursuant to Section March, 2021 at 5.00 p.m. for the champion Bianca Andreescu won an seeded German lost 6-0, 6-4 to 63rd-
be held at 12A (Room 2), 459 of the Companies Act, following purposes:- “I was really nervous coming into emotional first match after 15 ranked American Bernarda Pera. –
Medan Bendahara 2, Medan 2016 a Final Meeting of the 1. To lay before the meeting this match. I just wanted to play months out against Romania’s AFP
Bendahara, 31650 Ipoh, Perak abovenamed Company will
on the 12th day of March, be held at 12A (Room 2), the Liquidators’ statement of 322 Notices Joker
2021 at 10.00 a.m. for the Medan Bendahara 2, Medan account and to give explanations
following purposes :- Bendahara, 31650 Ipoh, Perak thereof. IN THE MATTER OF THE IN THE MATTER OF THE masterclass
1. To receive and consider the on the 12th day of March, 2. To decide under Section 518(3) COMPANIES ACT, 2016 COMPANIES ACT, 2016
Liquidator’s final statement 2021 at 9.00 a.m. for the (b) of the Companies Act, 2016, Djokovic crushes Chardy in AO warningEFENDING champion Novak Djokovic blasted past
of accounts showing following purposes :- the manner in which the books, AND AND Frenchman Jeremy Chardy in emphatic fashion yesterday
the manner in which the 1. To receive and consider the accounts and documents of the IN THE MATTER OF IN THE MATTER OF to ominously kick off his bid for an unprecedented ninth
winding-up has been Company may be destroyed. MAHKOTA REALTY SDN BHD REGENCY HEALTHCARE SDN BHD
conducted and to receive Liquidator’s final statement Dated this (199301011537 (266274-D)) (199501040600 (369804-W)) DAustralian Open title.
any explanations arising of accounts showing 9th day of February, 2021. The Serbian world No. 1, who clinched his 17th Grand Slam in last
therefrom. the manner in which the Tan Kee Huat (Members’ (Members’ year’s gripping final at Melbourne Park against Dominic Thiem,
2. To resolve that under winding-up has been Lam Lee San (f) Voluntary Winding-up) Voluntary Winding-up) wasted little energy in the 6-3, 6-1, 6-2 romp in just 91 minutes on Rod
Section 518(3)(b) of the conducted and to receive Liquidators At an Extraordinary General Meeting Laver Arena.
Companies Act, 2016, any explanations arising NOTE: At an Extraordinary General Meeting of the Company duly convened and
the books, accounts and therefrom. A contributory entitled to attend of the Company duly convened and held at SOHO Suites @ KLCC, Block The writing was on the wall with the pair meeting 13 times before
documents of the Company 2. To resolve that under and vote at the abovementioned held at SOHO Suites @ KLCC, Block A2, Level 32-3A, No. 20, Jalan Perak, and the Serb winning them all, with Chardy failing to take a single set.
and the Liquidator, be Section 518(3)(b) of the meeting is entitled to appoint a A2, Level 32-3A, No. 20, Jalan Perak, 50450 Kuala Lumpur on 5 February
destroyed after the Companies Act, 2016, proxy who need not be a member 50450 Kuala Lumpur on 5 February 2021 the following special/ordinary Djokovic, chasing an 18th Slam crown to close in on the 20 held by
expiration of three months the books, accounts and of the Company to attend and 2021 the following special/ordinary resolutions were duly passed:- Roger Federer and Rafael Nadal, has likened his relationship with the
from the date of the final documents of the Company vote in his stead. The instrument resolutions were duly passed:- 1. THAT the Company be wound up Australian Open to “a love affair”.
meeting. and the Liquidator, be appointing a proxy must be duly voluntarily pursuant to Section
Dated this 9th February, 2021 destroyed after the deposited at the Liquidators’ office, 1. THAT the Company be wound up 439(1)(b) of the Companies Act, And he clearly enjoyed himself, dishing up a masterclass for the
Chew Choon Seong expiration of three months not less than 48 hours before the voluntarily pursuant to Section 2016 and that Chong Ai Ling of socially-distanced fans in the stadium.
Liquidator from the date of the final time of the meeting. 439(1)(b) of the Companies Act, SOHO Suites @ KLCC, Block A2,
meeting. 2016 and that Chong Ai Ling of Level 32-3A, No. 20, Jalan Perak, “It feels great, so great to see people back in the stadium,” he said.
322 Notices Dated this 9th February, 2021 IN THE MATTER OF THE SOHO Suites @ KLCC, Block A2, 50450 Kuala Lumpur be and is “I’m really glad to see a lot of people actually – this is the most I’ve
Chew Choon Seong COMPANIES ACT 2016 Level 32-3A, No. 20, Jalan Perak, hereby appointed liquidator of the seen on a tennis court in 12 months.
DALAM MAHKAMAH MAJISTRET DI Liquidator 50450 Kuala Lumpur be and is Company for the purpose of such “Sometimes we take these things (crowds) for granted, but very
GEORGETOWN AND hereby appointed liquidator of the winding up. very grateful to see you all,” he added.
322 Notices IN THE MATTER OF Company for the purpose of such 2. THAT Chong Ai Ling the Company’s In other matches, third seed and US Open champion Dominic
GUAMAN SIVIL NO.: SPLENDID SKY SDN. BHD. winding up. Liquidator be and is hereby Thiem was made to work hard in the first set by Kazakh veteran
PA-A72NCvC- 420-11/2020 IN THE HIGH COURT OF MALAYA AT 201001027124 (911043-H) authorised to distribute either in Mikhail Kukushkin before coming through 7-6 (7-2), 6-2, 6-3.
KUALA LUMPUR 2. THAT Chong Ai Ling the Company’s cash, specie or in kind any surplus “He’s very experienced and the first set was super-challenging,”
ANTARA (In Members’ Liquidator be and is hereby assets of the Company as she said Thiem, beaten by Djokovic in five epic sets in the Australian
TAN KHEK PHENG IN THE STATE OF WILAYAH Voluntary Winding up) authorised to distribute either in shall think fit to the contributory Open final last year.
[NO.K/P: 511127-07-5005/4206386] PERSEKUTUAN, MALAYSIA cash, specie or in kind any surplus of the Company in accordance Sixth seed Alexander Zverev dropped a set and smashed a racquet
SEBAGAI WASI DAN PEMEGANG (COMPANIES WINDING UP) NOTICE OF assets of the Company as she with their respective rights and before grinding to a 6-7 (8-10), 7-6 (7-5), 6-3, 6-2 win against
AMANAH KEPADA NO: WA-28NCC-693-12/2020 FINAL MEETING OF MEMBERS shall think fit to the contributory interests therein. American Marcos Giron.
HARTA PUSAKA YU MENG QUENG In the matter of Section 465(1)(h) and/ NOTICE IS HEREBY GIVEN of the Company in accordance Dated this 9th day of February 2021 “He played incredible,” said the German, who lost to Thiem in the
or Section 465(1)(f) of the Companies pursuant to Section 459(2) of with their respective rights and Datuk Fakhri Yassin Bin Mahiaddin final in New York and the Melbourne semifinals last year.
... PLAINTIF Act 2016; the Companies Act 2016, the interests therein. Director “He had me on the ropes, particularly in the second set tie-break.”
DAN Final Meeting of Members of the There were no such problems for the 2014 men’s champion, Stan
LEE OOI CHUAN And Company will be conducted on a Dated this 9th day of February 2021 IN THE MATTER OF THE Wawrinka, as he reached the second round for a 16th straight time
(NO.K/P:951215-02-5357) In the matter of Generasi Nirwana Sdn fully virtual basis on Thursday, COMPANIES ACT, 2016 with a 6-3, 6-2, 6-4 win against Portugal’s Paulo Sousa.
(PEMILIK TUNGGAL YANG BERNIAGA DI Bhd (Company No. 199501018297 11th March 2021 at 11.00 a.m. Datuk Fakhri Yassin Bin Mahiaddin Milos Raonic, the 14th seed from Canada, also enjoyed serene
BAWAH NAMA “WILLIAM EVENT (347500-K)); from the broadcast venue at Director AND progress through to the second round with a 6-3, 6-3, 6-2 win over
SUPPORT”, NO. PENDAFTARAN Suite 2.01, 2nd Floor, Wisma IN THE MATTER OF Federico Coria of Argentina.
PERNIAGAAN: 002659375-W) And Badan Peguam Malaysia, No 2, IN THE MATTER OF THE REGENCY HEALTHCARE SDN BHD Bulgaria’s Grigor Dimitrov got through in three sets against
In the matter of the Companies (Winding Lebuh Pasar Besar, 50050 Kuala COMPANIES ACT, 2016 (199501040600 (369804-W)) Croatia’s Marin Clic, the 2014 US Open champion.
… DEFENDAN Up) Rules 1972. Lumpur. But Gael Monfils, the French 10th seed, was stunned 3-6, 6-4, 7-5,
NOTIS PENGIKLANAN AGENDA: AND (Members’ 3-6, 6-3 by Emil Ruusuvuori of Finland and Japan’s Kei Nishikori also
Kepada :- BETWEEN 1. To receive the Liquidator’s IN THE MATTER OF Voluntary Winding-up) fell at the first hurdle with a straight-sets defeat to Pablo Carreno
LEE OOI CHUAN CHONG BOON HENG MAHKOTA REALTY SDN BHD NOTICE IS HEREBY GIVEN THAT the Busta of Spain. – AFP/Reuters
(No.K/P:951215-02-5357) (NRIC NO: 620124-10-5195) statement of accounts (199301011537 (266274-D)) Creditors of the abovementioned
(Pemilik Tunggal yang berniaga di showing the manner in which Company which is being wound Hamilton signs new deal
bawah nama “WILLIAM EVENT ...PETITIONER the winding-up has been (Members’ up voluntarily are required, to send
SUPPORT”, No. Pendaftaran AND conducted and to receive any Voluntary Winding-up) in their names and addresses on FORMULA ONE world champion Lewis Hamilton will chase a record
Perniagaan: 002659375-W) 1. GENERASI NIRWANA SDN BHD explanation thereon; or before 10 March 2021, with eighth title with Mercedes this season after signing a new deal, the
No. 24, Jalan SS 6/12, Kelana Jaya, (COMPANY NO : 199501018297 2. To determine the manner in NOTICE IS HEREBY GIVEN THAT the particulars of their debts or claims team said in a statement yesterday that ended any uncertainty about
47301 Petaling Jaya,Selangor. (347500-K)) which the books, accounts and Creditors of the abovementioned and their names and addresses of his immediate future.
Dan 2. SER CHIN POH documents of the Company Company which is being wound their solicitors (if any) to:-
LEE OOI CHUAN (NRIC NO : 620520-10-6181) and of the Liquidator shall be up voluntarily are required, to send The Liquidators The 36-year-old Briton had been out of contract since the end of
(No.K/P:951215-02-5357) 3. NG LIAN ANN disposed off in accordance in their names and addresses on REGENCY HEALTHCARE SDN BHD last year but the negotiations had turned into something of a saga,
(Pemilik Tunggal yang berniaga di (NRIC NO : 610508-10-5347) with Section 518(3)(b) of the or before 10 March 2021, with (199501040600 (369804-W)) with questions raised about why it was taking so long.
bawah nama “WILLIAM EVENT Companies Act 2016. particulars of their debts or claims SOHO Suites @ KLCC
SUPPORT”, No. Pendaftaran …RESPONDENTS Dated this 05 February 2021. and their names and addresses of Block A2, Level 32-3A Mercedes said the new agreement, which referred only to 2021,
Perniagaan: 002659375-W) ADVERTISEMENT OF PETITION YEP CHONG SANG @ YAP CHONG their solicitors (if any) to:- No. 20, Jalan Perak included a joint commitment for greater diversity and inclusion.
Unit B-6-4, Northpoint Residence, Notice is hereby given that a petition for SANG 50450 Kuala Lumpur
Mid Valley City, No. 1 Medan Syed winding-up of the abovenamed company Liquidator The Liquidators BHD and if so required by notice in writing Hamilton, the sport’s only Black driver and its most successful racer,
Putra Utara, 59200 Kuala Lumpur. by the High Court was, on 28.12.2020 MAHKOTA REALTY SDN from the said Liquidators, or by their has used his platform and profile increasingly to push for equal
AMBIL PERHATIAN bahawa Writ presented by Chong Boon Heng with the IN THE MATTER OF THE (199301011537 (266274-D)) solicitors or personally, to come in opportunities and speak out against racial injustice.
Saman dan Pernyataan Tuntutan address at No.4, 2nd Floor, Jalan Anggerik COMPANIES ACT 2016 SOHO Suites @ KLCC and prove their debts and claims
(‘dokumen-dokumen tersebut’) yang Mokara 31/44, Sec 31, Kota Kemuning, Block A2, Level 32-3A at such time and place as shall be “I am excited to be heading into my ninth season with my
kedua-dua bertarikh 30-11-2020 40460 Shah Alam, Selangor Darul Ehsan, AND No. 20, Jalan Perak specified in such notice, or in default Mercedes teammates,” he said.
disampaikan ke atas Defendan and that the said Petition is directed IN THE MATTER OF 50450 Kuala Lumpur thereof, they will be excluded from
secara penyampaian ganti melalui to be heard before the Court sitting at INNOVATIVE EAGLE SDN. BHD. the benefit of any distribution made “Our team has achieved incredible things together and we look
penampalan salinan dokumen- Kuala Lumpur at 9.00am on the 16th 199401021746 (307425-P) and if so required by notice in writing before such debts and claims are forward to building on our success even further, while continuously
dokumen tersebut berserta dengan day of March 2021, and any creditor or (In Members’ Voluntary from the said Liquidators, or by their proved. looking to improve, both on and off the track.”
salinan Perintah Untuk Penyampaian contributory of the said Company desiring solicitors or personally, to come in Chong Ai Ling
ganti yang termeterai di Papan Notis to support or oppose the making of an Winding up) and prove their debts and claims Liquidator Mercedes team boss and co-owner Toto Wolff said it had always
Mahkamah Majistret Georgetown, order on the said Petition may appear at NOTICE OF at such time and place as shall be Dated this 9th day of February 2021 been the plan to continue the relationship but the Covid-19 pandemic
Tingkat 6, Bangunan Sri Pinang, Jalan the time of the hearing by himself or his FINAL MEETING OF MEMBERS specified in such notice, or in default meant it had taken some time to get everything in place.
Tun Syed Sheh Barakbah, 10200 counsel for that purpose; and a copy of the NOTICE IS HEREBY GIVEN thereof, they will be excluded from
Pulau Pinang dan pengiklanan dalam petition will be furnished to any creditor pursuant to Section 459(2) of the benefit of any distribution made “The story of Mercedes and Lewis has written itself into the history
bentuk Notis di di satu surat akhbar or contributory of the said Company the Companies Act 2016, the before such debts and claims are books of our sport over the past eight seasons, and we are hungry to
tempatan yang mana penampalan requiring the same by the undersigned Final Meeting of Members of the proved. compete and to add more chapters to it,” the Austrian said. – Reuters
dan pengiklanan tersebut hendaklah on payment of the regulated charges for Company will be conducted on
menjadi penyampaian yang the same. a fully virtual basis on Thursday, Chong Ai Ling
sempurna dan cukup bagi dokumen- The Petitioner’s address is at No.4, 2nd 11th March 2021 at 10.00 a.m. Liquidator
dokumen tersebut ke atas Defendan Floor, Jalan Anggerik Mokara 31/44, Sec from the broadcast venue at
selepas tujuh (7) hari selepas tarikh 31, Kota Kemuning, 40460 Shah Alam, Suite 2.01, 2nd Floor, Wisma Dated this 9th day of February 2021
penyampaian terakhir. Selangor Darul Ehsan. Badan Peguam Malaysia, No 2,
Jika kamu berhasrat untuk membela The Petitioner’s solicitors are Messrs. Lebuh Pasar Besar, 50050 Kuala
tindakan tersebut kamu mestilah Chow Kok Leong & Co. of C3-5-3, Solaris Lumpur.
memfailkan atau memasukkan Dutamas, No.1, Jalan Dutamas 1, 50480 AGENDA:
Memorandum Kehadiran di Kuala Lumpur. 1. To receive the Liquidator’s
Mahkamah Majistret Georgetown 7 ……………………………… statement of accounts
hari dari tarikh iklan ini. Messrs. Chow Kok Leong & Co. showing the manner in which
Jika kamu ingkar memfailkan atau Solicitors for the Petitioner the winding-up has been
memasukkan kehadiran sedemikian, NOTE: conducted and to receive any
penghakiman boleh diberikan Any person who intends to appear on the explanation thereon;
terhadap kamu. hearing of the said Petition must serve 2. To determine the manner
Bertarikh pada 18 Januari 2021 on or send by post to the abovenamed in which the books,
solicitors, notice in writing of the intention accounts and documents
(t.t) to do so. The notice must state the name of the Company and of the
…………………………..... and address of the person, or, if a firm, the Liquidator shall be disposed
name and address of the firm, and must off in accordance with
TETUAN TAN, YU & CO. be signed by the person or firm, or his or Section 518(3)(b) of the
PEGUAMCARA PLAINTIF their solicitors (if any) and must be served, Companies Act 2016.
NOTIS PENGIKLANAN ini difailkan or, if posted must be sent by post in Dated this 05 February 2021.
oleh Tetuan Tan, Yu & Company, sufficient time to reach the abovenamed TAN CHAN SENG
Peguamcara bagi Plaintif yang not later than twelve (12) o’clock noon on Liquidator
beralamat di No. 44, Lebuh Armenian, the 15th day of March 2021.
Tingkat Satu, 10200 Pulau Pinang. This ADVERTISEMENT OF PETITION is
(No. Telefon : 04-2610945, No. Fax : filed by Messrs. Chow Kok Leong & Co.,
04-2628070, e-mel: tanyuco@gmail. the solicitors for the Petitioner whose
com) Rujukan Fail: TKP/L/3383/2020 address of service is at c3-5-3, Solaris
Dutamas, No.1, Jalan Dutamas 1, 50480,
Kuala Lumpur, Wilayah Persekutuan Kuala
Lumpur.
[Tel: 03-6201 6680; Fax: 03-6201 3680]
[Ref: CKL/WUP/664/20]
14 theSUN ON TUESDAY | FEBRUARY 9, 2021
SPORTS
LIONEL MESSI scored his fastest league Messi leads SHORTS
goal as a substitute as his strike 136 Barca comeback Hasan leads Pakistan to series win
seconds after coming on inspired Talisman striker rescues Catalans
Barcelona to a 3-2 victory over Real with fastest goal off the bench MEDIUM pacer Hasan Ali took a maiden 10-
Betis yesterday. wicket haul to help Pakistan win its first series
forced off with an ankle injury early on. many minutes and games, although Araujo’s against South Africa since 2003 with a 95-run
Messi was among several key players rested, With Gerard Pique already a long-term injury has made it even more complicated,” the victory in the second Test on the fifth and final
with Ronald Koeman seemingly prioritising Barcelona boss told Spanish sports daily Marca. day in Rawalpindi yesterday.
Thursday’s (4am Malaysian time) Copa del Rey absentee, Araujo’s fitness will be a huge
semifinal against Sevilla ahead of Barca’s fading concern, especially with a Champions League “You have to highlight the team mentality, in Hasan finished with 5-60 to record his best
title challenge in La Liga. last 16 first leg at home to Paris Saint-Germain a hard game we’ve won with our quality and match figures of 11-114 and help dismiss South
to come, a week after the test against Sevilla. character.” Africa – who were set a daunting 370 to chase –
Defeat would have called that decision into for 274 before the tea break.
question but Messi drove in an equaliser less Betis will wonder how they managed not to The coach was also asked why he preferred
than three minutes after coming on in the take at least a point from a wild contest at the to bring on Frenkie de Jong for Araujo, despite Hasan's new-ball partner Shaheen Shah
second half and then helped set up Francisco Benito Villamarin but Barcelona sustain their having Sergino Dest and Samuel Umtiti on the Afridi finished with 4-51, while spinner Yasir
Trincao to score a late winner, the 21-year-old’s momentum, this their sixth league victory in a bench. Shah took the last wicket to spark jubilation
first goal for Barcelona. row. among the Pakistan players.
“I like to have a right-footer and a left-footer
“He changed the game,” said Koeman, when Some were surprised that Messi and others as a pair of central defenders and Dest had Opener Aiden Markram scored a fighting 108
asked about Messi. “Barcelona with Messi is a were on the bench, but Koeman underlined his discomfort yesterday and wasn’t ready to play and Temba Bavuma 61.
better team, much more effective,” the rotation policy. so long, so we went for Frenkie,” he said. –
Dutchman admitted. AFP/Agencies They put on a 106-run stand for the fourth
“We’ve made rotations for players with wicket to give Pakistan a scare.
“He’s been here many years showing that
he’s a vital player for this team. It’s a bit about Markram took a single off the last ball before
the cup game but we also have to decide when lunch as South Africa reached the break on 219-
the best moment is to rest players. The cup is 3, needing 151 for a win.
the shortest route to a title this season.”
But Hasan ripped through the tourists'
Koeman’s side sit seven points behind La batting order, which lost seven wickets for just
Liga’s leaders Atletico Madrid, who have played 33 runs with the second new ball.
two games fewer and face Celta Vigo at home
overnight. This is Pakistan's only second Test series win
over South Africa in 12 attempts, having lost
Success also came at a cost as Barca’s best eight and drawn three.
available central defender Ronald Araujo was
Pakistan last beat South Africa 1-0 in a two-
‘Exceptional’ Ibra keeps AC Milan top match series at home in 2003. Pakistan won the
first Test by seven wickets in Karachi.
ZLATAN IBRAHIMOVIC broke the 500-mark never fails.” seven are all capable of fighting for the title
for career club goals with a brace yesterday as Ante Rebic turned the game into a and the first four places. The two teams will now play three Twenty20
AC Milan held top spot in Serie A with a 4-0 comprehensive win with a quick-fire brace of internationals on Feb 11, 13 and 14, all in
win over lowly Crotone. his own past Crotone goalkeeper Alex Cordaz. “It’s not yet time to look too much at the Lahore.
“It’s difficult to be surprised by The Croatian headed in a Hakan table, a challenging period will come with
Ibrahimovic,” said Milan coach Stefano Pioli of Calhanoglu corner in the 69th minute and many matches and the Europa League is Windies hero Mayers does not want
the 39-year-old who is powering his team’s then seconds later turned in a rebound after about to start again.” to be a one-hit wonder
bid for a first Scudetto since 2011. Cordaz kept out an Ibrahimovic strike.
Milan moved back two points in front of “The Scudetto? The decisive Ibrahimovic showed his incredible form 22 KYLE MAYERS is determined not to become a
city rivals Inter Milan who had pulled ahead matches will come later, now we years after making his professional debut one-hit wonder after a double century on his
after a 2-0 win over Fiorentina on have to withstand all the Test debut guided West Indies to an improbable
Friday. pressures which is a for Swedish club Malmo, scoring his Test win over Bangladesh.
Champions Juventus are a privilege to have,” first goal in October 1999.
further five back in third after continued Pioli. “It means that I have scored a few Playing his first Test for West Indies at the age
beating Roma 2-0 on Saturday. “The top goals in my career,” said the Swede, of 28, Mayers became only the sixth cricketer to
The capital side dropped to who was substituted off hit a double hundred in his premiere innings.
fourth equal on points with city with 15 minutes to go.
rivals Lazio who beat Cagliari 1- “The important His unbeaten 210 was crucial in the three-
0. thing is to continue wicket win after West Indies reached 395-7 with
Ibrahimovic opened the scoring to help the team in just nine balls left on Sunday's final day.
on the half hour at the San Siro the best possible
after combining with Rafael Leao way. My job is to Mayers said he was still a cricket “student”
for his 500th strike with nine score and create learning the tricks.
situations to
score.” – AFP “I will try to learn as much from this innings
and take it to the next game where I start from
different clubs. zero,” he said.
And the Swede brought
his tally to 501 in the 64th “I don’t want to be a one-hit wonder. I want
minute, finishing off a to be successful and consistent for the duration
Theo Hernandez cross of my career.”
for his 83rd Milan goal.
“To hold up at this West Indies fast bowler Shannon Gabriel took
level means you’re an three wickets at the start of Bangladesh’s second
exceptional innings to reduce the host to 33-3 at one stage.
professional and he’s
helped by a They recovered to declare at 223-8, but the
physique that few West Indies players had confidence they could
have,” continued reach the huge target.
Pioli.
“He’s a “To be honest, the spirit in the dressing room
champion, was always positive,” said Mayers.
an athlete AC Milan’s Zlatan
who has Ibrahimovic (centre) “We always had the belief that we could do
great celebrates with teammates well,” he added.
motivation, he after opening the scoring
takes care of his during yesterday’s Serie A England set India daunting target
body match against Crotone at
scrupulously. the San Siro. – AFPPIX A CAUTIOUS England spared India the
Sometimes he’s ignominy of a follow-on but set them a
tired, but he daunting 420-run victory target in the opening
Test at Chennai's MA Chidambaram Stadium
Mbappe sparks PSG win over Marseille yesterday.
KYLIAN MBAPPE set Paris Saint-Germain on three adrift of Lille, who won 2-0 at Nantes. we are forced to play with intensity in every England, who had posted a mammoth 578
the way to a 2-0 win over troubled Marseille Marseille finished with 10 men after Dimitri game and that can mean that you’re not taken in the first innings, bowled India out for 337 but
yesterday, keeping the reigning champions by surprise when it comes to the Champions opted against enforcing the follow-on.
within three points of Ligue 1 leaders Lille Payet’s late sending-off, and are down in ninth League.”
who earlier recorded their sixth consecutive having won just once in 11 games. The tourists walked out to bat instead and
victory. Canada’s Jonathan David continued his were bowled out for 178 an hour before
The Parisians go to Barcelona in the recent scoring streak with a brace as Lille saw stumps, baffling many by their refusal to declare
Mbappe burst through at incredible pace Champions League on Feb 16 but Mbappe off Nantes to reclaim top spot from Lyon, who which would have given them more time to
to give PSG the lead on the counter-attack in insisted their thoughts remained on domestic beat Strasbourg 3-0 on Saturday. bowl out India.
the ninth minute at the Velodrome, with matters as they first play in the French Cup in
Mauro Icardi adding a second for Mauricio midweek and then host Nice next weekend. David has five goals in as many games The hosts finished the penultimate day on
Pochettino’s side. after pouncing on a defensive mix-up to put 39-1, still 381 behind the target, with
“In previous years we might have been Lille in front early on and then scoring a Shubhman Gill batting on 15 and Cheteshwar
The victory was achieved despite Neymar – able to concentrate more on the Champions fantastic second seven minutes from time Pujara on 12.
who celebrated his 29th birthday on Friday – League but this year we really need to stay following a one-two with Renato Sanches.
only appearing as a substitute having missed focused on the league because we are Earlier yesterday, Washington Sundar led
training with a stomach bug. trailing,” the World Cup winner told “We are on a magnificent run but nobody India's rearguard resistance with an unbeaten
broadcaster Canal Plus. is pulling away because everyone is winning,” 85 before he ran out of partners.
PSG stay third, a point behind Lyon and said Lille coach Christophe Galtier. – AFP
“But maybe that’s not a bad thing because The all-rounder added 80 runs with
Ravichandran Ashwin in a spirited seventh-
wicket stand to take India, who had resumed on
257-6, past the 300-mark.
When England came out for their second
innings, Ashwin dismissed Rory Burns with the
very first ball and went on to claim 6-61 as
England batted on with a safety-first approach.
India lost opener Rohit Sharma early, with
Jack Leach spinning one past the bat to hit the
off-stump.
15theSUN ON TUESDAY | FEBRUARY 9, 2021
* SPORTS
Keane says Liverpool are ‘bad champions’
ROY KEANE has accused Liverpool For Liverpool it has been a “They are making a lot they’ve been bad my mindset when you win the
of being “bad champions” after their challenging season, with an injury of excuses,” Keane said of champions. I just can’t league the next challenge is always
4-1 beating at the hands of crisis at centreback proving Liverpool, speaking as a figure this group out… I ‘can we do it again?’
Manchester City left Jurgen Klopp’s particularly difficult, with Virgil van pundit on Sky Sports. think they’ve maybe all
2019-20 Premier League winners 10 Dijk, Joe Gomez and Joel Matip all “To me “I never got the impression from
points off the pace. out for sustained periods and believed the hype this group, from their interviews,
forcing Klopp to pick another Roy Keane over the last from their manager last year, they
Goals by Ilkay Gundogan, makeshift pairing of Jordan year or said it’s a long wait, 30 years, let’s
Raheem Sterling and Phil Foden Henderson and Fabinho for the two… enjoy this, but I never heard the
capped a performance reminiscent showdown. In players come out and say ‘we want
of champions-elect, and Pep to do this again’.
Guardiola’s side are now heavy But Keane, who defended the
favourites to clinch the title back title three times as a Manchester “They’re now talking about
from their rivals. United player, had little sympathy. trying to get in the top four.” – The
Independent
RESULTS & STANDINGS Timo to the fore Mour talks
trophy
ENGLISH PREMIER LEAGUE: Tottenham 2 Werner explains new role under Tuchel after prospects
(Kane 54, Son 58) West Brom 0, Wolves 0 inspiring Chelsea win at Sheffield United after WBA win
Leicester 0, Liverpool 1 (Salah 63-pen)
Manchester City 4 (Gundogan 49, 73, Sterling 76, TOTTENHAM boss Jose Mourinho
Foden 83), Sheffield United 1 (Rudiger 54-og) has claimed that his side will end
Chelsea 2 (Mount 43, Jorginho 58-pen). the season ‘where they belong’ after
securing their first win in four
P W D L F A Pts TIMO WERNER insists his new role Premier League matches against
Man City 22 15 5 2 43 14 50 as a “left 10” under Thomas Tuchel behind a striker or with a 10 behind me, it’s West Bromwich Albion.
Man Utd 23 13 6 4 49 30 45 is “very good” for him after helping very good for me.”
Leicester 23 13 4 6 39 25 43 Chelsea to victory at Sheffield Harry Kane scored his 13th goal
Liverpool 23 11 7 5 44 29 40 Werner hobbled off with a dead leg, of the campaign in the second half
Chelsea 23 11 6 6 38 24 39 which required strapping, and he revealed after making a surprise return from
United. that he asked Tuchel to come off due to the injury, before Son Heung-min
West Ham 23 11 6 6 34 28 39 The German forward’s scoring drought nature of the game. doubled the north London club’s
Everton 21 11 4 6 34 28 37 lead four minutes later.
Tottenham 22 10 6 6 36 22 36 continued at Bramall Lane, but the former “It was a dead leg,” Werner added. “The
Aston Villa 21 11 2 8 36 24 35 Leipzig star played a key role in both goals 10 minutes afterwards were hard, I told the Spurs went into Sunday’s match
for the visitors. manager it’s better if I come off because it’s clinging on to their top-four hopes
Arsenal 23 9 4 10 27 23 31 Firstly, Werner combined well down the a hard game.” by a thread after three consecutive
Leeds 21 9 2 10 36 38 29 left before setting up Mason Mount for the Tuchel hailed Werner’s contribution defeats against Liverpool, Brighton
Southampton22 8 5 9 29 37 29 opener, before his speed after the game as Chelsea closed to within a and Hove Albion and Chelsea.
Crystal Palace 22 8 5 9 27 37 29 forced Aaron Ramsdale point of the top four with a third win in his
Wolves 23 7 6 10 23 31 27 to haul him down for a four games in charge. However, the result saw them
Brighton 23 5 10 8 25 30 25 penalty, which “When he plays like this we are very climb to eight in the Premier
Newcastle 23 7 4 12 25 38 25 Jorginho dispatched League table, just four points adrift
Burnley 22 6 5 11 14 29 23 to earn all three happy,” said Tuchel. “This was a big step of the Reds in fourth place.
Fulham 22 2 9 11 17 31 15 forward. The first goal was an amazing run
points. and amazing assist. The goals will come.” Tottenham are still in with a
West Brom 23 2 6 15 18 54 12 And Werner Werner was left on the bench for Frank shout of ending their trophy
Sheffield Utd 23 3 2 18 15 37 11 insists he is Lampard’s final two League games before heartache this season, with the club
happy and that the former England international was going strong in the Europa League
LA LIGA: Real Sociedad 4 (Oyarzabal 26-pen, “the goals will sacked last month. and looking forward to April’s
35, Isak 54, 59) Cadiz 1 (Izquierdo 65), Athletic come” in his One of Tuchel’s targets is to get the 24- League Cup final against
Bilbao 1 (Guillamon 43-og) Valencia 1 (Gabriel new role Manchester City.
Paulista 66), Osasuna 2 (Calleri 18, Budimir 86) year-old producing the prolific numbers he
Eibar 1 (Kike 44), Real Betis 2 (Iglesias 38, Ruiz under did for Leipzig in the Bundesliga. Mourinho was in a bullish mood
75) Barcelona 3 (Messi 59, Ruiz 68-o.g., Trincao Tuchel. after the final whistle against West
87). Chelsea are now breathing down Brom, backing his side to reap the
“It’s a Liverpool’s necks for a place in next fruits of their labour between now
g o o d season’s Champions League after the and the end of the campaign.
TOP 10 P W D L F A Pts win for defending champions were thrashed 4-1 at
Atletico 19 16 2 1 40 10 50 us, it home by Manchester City in an earlier “I loved the compromise of the
Barcelona 21 13 4 4 44 20 43 was match. players,” the Portuguese boss told
Real Madrid 21 13 4 4 37 19 43 very Tuchel has benefited from a kind run of BT Sport.
Sevilla 21 13 3 5 31 16 42 difficult
Villarreal 22 8 12 2 31 22 36 game, fixtures to bed himself into English football, “The effort, the determination,
Sociedad 22 9 8 5 36 20 35 we are but the former Paris Saint-Germain the clear wish to show everyone
Real Betis 22 9 3 10 29 37 30 manager has quickly implemented his how together they are and how
proud of ideas. much they were suffering with the
Granada 22 8 6 8 26 36 30 this win to Any suggestion Mount, who shot to bad results and how much they
Levante 21 6 9 6 31 31 27 continue our prominence under Lampard, would be a wanted the victory.
Bilbao 21 7 4 10 28 26 25 last wins and casualty of the change of management have
for myself, no proven unfounded as the England “That was the fundamental
SERIE A: Benevento 1 (Caprari 55) Sampdo- goal, but it’s good international was again Chelsea’s most thing. In the first half we were
ria 1 (Balde 80), AC Milan 4 (Ibrahimovic 30, 64, to see I can help dangerous player. dominant and could have killed the
Rebic 69, 70) Crotone 0, Udinese 2 (Silvestri the team with game.
83-og, Deulofeu 90+1) Hellas Verona 0, Parma other moments,” Mount rounded off a brilliant team
0 Bologna 3 (Barrow 15, 33, Orsolini 90+2), move, also involving Ben Chilwell and “At halftime we had confidence,
Lazio 1 (Immobile 61) Cagliari 0. Werner told Sky Werner, to give Chelsea the half-time lead we were positive, I only spoke to
Sports. their dominance deserved at Bramall Lane. them for one minute. We were
TOP 10 P W D L F A Pts “I’m happy Tuchel’s men had barely even faced a going in the right direction.
AC Milan 21 15 4 2 45 23 49 when we win, shot at goal in their previous three games
Inter Milan 21 14 5 2 51 23 47 when I can make against Wolves, Burnley and Tottenham, “Harry Kane is a special player in
Juventus 20 12 6 2 41 18 42 two assists, it’s good, but finally conceded thanks to a self- the history of the club. He will beat
Roma 21 12 4 5 44 35 40 when I don’t score, inflicted blow. every possible record. We had very
Lazio 21 12 4 5 36 27 40 it’s a long period for good individual performances
Napoli 20 12 1 7 44 21 37 me, you can’t do Antonio Rudiger is one of those to have today.
Atalanta 21 10 7 4 48 29 37 benefited from Lampard’s departure after
anything, you have to being frozen out for much of the season. “At the end of the season you
Sassuolo 21 8 7 6 34 32 31 keep going and the goals But the German defender did his new have the truth, we will be where we
Hellas Verona 21 8 6 7 26 23 30 will come. boss little favours as his attempted back belong, where we deserve to be.” –
Sampdoria 21 8 3 10 31 32 27 “Every manager is pass beat the onrushing Edouard Mendy Express Newspapers
Chelsea’s different, he gives us a lot and rolled into his own net.
BUNDESLIGA: Hoffenheim 1 Eintracht Timo Werner. of ideas, I play as a left 10,
Frankfurt 3. not a winger, so I have more “Still no goal from the opponents, but we
space in the middle, I play did it ourselves,” said Tuchel. – The
TOP 10 PWD L F A Pts Independent/AFP
Bayern 20 15 3 2 58 26 48
RB Leipzig 20 12 5 3 35 17 41 Foxes grind out point against Wolves
Wolfsburg 20 10 8 2 32 19 38
E. Frankfurt 20 9 9 2 41 29 36
Leverkusen 20 10 5 5 37 21 35 LEICESTER CITY’S outside hopes of winning the injury on the hour mark and almost won it in did that very well.
Dortmund 20 10 2 8 39 29 32 Premier League title suffered a blow after being time added on but headed wide from a “It was a fair result. Kasper (Schmeichel) didn’t
B. M’gladbach20 8 8 4 37 31 32 held to a goalless draw at Midlands rivals promising position.
Freiburg 20 8 6 6 35 33 30 Wolves. have too much to do. We had moments in the
Union Berlin 20 7 8 5 34 25 29 This was the third week of six where the game. We knew we were going to have to
Stuttgart 20 6 7 7 37 34 25 Brendan Rodgers’ side lie in third place, seven Foxes have had to play twice in seven days, and defend well.
points adrift of League leaders Manchester City, with the fixtures piling up, Rodgers said his team
LIGUE 1: Brest 2 Bordeaux 1, Montpellier 4 who also have a further game in hand. will have to prove they can grind out results like “It looked as the second half went on that we
Dijon 2, Nice 3 Angers 0, Nimes 3 Monaco 4, they did yesterday. could force the issue but we couldn’t quite make
Saint-Etienne 1 Metz 0, Nantes 0 Lille 2, The visitors have an excellent away record the breakthrough.
Marseille 0 Paris Saint-Germain 2. this season but were flat for large periods of the “With this period of the season, where there
contest and failed to fully test Rui Patricio. are so many games, we are going to have to “The players gave everything and we kept
grind them out,” Rodgers said. “And I thought we another clean sheet and we could have nicked it
Striker Jamie Vardy made his return from at the end with Jamie’s header.” – Agencies
TUESDAY • FEBRUARY 9, 2021 QUOTE OF THE DAY
It’s a good win for us, it was very difficult game,
we are proud of this win to continue our last
wins and for myself, no goal, but it’s good to see I can help
the team with other moments. I’m happy when we win, when
I can make two assists, it’s good, when I don’t score, it’s a
long period for me, you can’t do anything, you have to keep
going and the goals will come.”
Chelsea’s Timo Werner
Pep hails ‘huge’ win but not getting carried away
PEP GUARDIOLA said Manchester City’s stunning course the gap to fifth is big right now and that
4-1 win at Liverpool was a “huge” moment for the means for the Champions League for next season understand he can still improve.”
Foden, 20, said City have the destiny
Premier League leaders as they put a massive is important but 10 (league) wins in a row in this of the title in their hands.
dent in the champions’ bid to retain the title. period is something exceptional,” he said. “They made it so difficult for us
Guardiola’s side are 10 points clear of fourth- Foden was the star of the show for City as the but we showed courage to play our
placed Liverpool after winning at Anfield for the England midfielder gave a coming of age football. In the end it paid off,” Foden
first time since 2003. performance. said.
City demolished Liverpool thanks to a brace “Phil Foden is a guy who keeps the ball really “It gives us every chance to go
from Ilkay Gundogan, after he missed a first half well, he arrives so aggressive,” Guardiola said. on and win (the title), but the job
penalty, and strikes from Raheem Sterling and “The action for the second goal and the isn’t done.
Phil Foden. fourth goal, we know “When you beat the
Mohamed Salah scored Liverpool’s equaliser what a huge champions everyone’s
after Gundogan’s second half opener, but the talent he is confidence goes sky
troubled Reds were no match for slick City. but he is high, so it can only help
“Huge victory for us. Three more points at the still us.”
end but I take into consideration the fact we won young The only concern for
after we missed a penalty and conceded a goal. and Guardiola was City’s
The way we reacted, that made the difference,” hopefully third penalty miss this
Guardiola said. he can season and he
We played in the way you have to suffer here. suggested keeper
We started really well. We cannot play like Ederson might take
they play, we have to play in a slow the next one.
rhythm. “It’s a problem that
“Second half we adjusted our set up we have. In important
and the quality of the players did the moments we cannot miss
rest. it, and it doesn’t matter
“For many years we were not the taker,” he said.
able to win here, hopefully next “Again, I’m going
time we can do it with people to think about
inside. Anfield is so Ederson, he
intimidating.” might be the
City hold a five-point lead taker next
over second placed time.” –
Manchester United and AFP
have a game in hand on
their local rivals as they
eye a third title in four
seasons.
They have won 14
successive games in all
competitions to equal Man City’s
the record for an Ilkay Gundogan
English top-flight club, (left) celebrates with
teammate Bernardo
set by Preston in 1892 Silva after scoring the
and Arsenal in 1987.
Guardiola admitted opening goal of their
English Premier
beating Liverpool carried
extra significance, but he League match
refused to get carried against Liverpool
away about their title at Anfield
charge.
“It’s an important win yesterday.
– AFPPIX
but it is February. Of
Gegenslipping
Liverpool manager
Liverpool’s ‘mistake management’ leaves plenty to be desired Jurgen Klopp looking
dejected after
Manchester City beat
the Reds yesterday.
“FOOTBALL is a game of mistake defence of the title. equaliser and then we made two massive happens to him again.
management” has been one of After the defeat, Klopp said Liverpool need mistakes, that is how it is. “Tonight it was decisive, but that’s OK. He
Liverpool’s mantras during the
Jurgen Klopp era; an to “accept the reality” but believes there was “Then it was pretty much game over. In a saved our lives I don’t know how often. He’s an
acknowledgement that errors will be made, enough in the performance for him and his staff game when you have such a good moment, absolutely world-class goalie.
especially if you are side that takes the initiative, to work with over the coming weeks as the these two goals were obviously the killer in the
so more significant is how you minimise and champions aim to arrest an alarming post- game and everyone knows that. We don’t have “There is not a real explanation. Maybe he
react to them. Christmas slump that has seen them win just to speak about that, that is the truth. had cold feet? It sounds funny but it could be.”
two of their last nine games.
In that context, perhaps the most instructive “The two things is the result is absolutely not Klopp later added: “I said to him: ‘We have
element of the defending champions’ 4-1 defeat “Look, big parts of the game were really, what we wanted, the performance is what we stands, you can shoot the ball there.’ It’s a
to Manchester City yesterday was how much really good. I think tonight two teams played, wanted for the majority of the game. In the end, mistake, but different things came together.
better the League leaders navigated their faults one with a crazy good run, won now 14 in a row we lost anyway.”
at Anfield. and another team with obviously a different set “In the first half Ali (Alisson) played
of results,” Klopp told liverpoolecho.co.uk. Klopp told Sky Sport he had no explanation exceptional football and was really calm on the
The excellent Phil Foden said City “definitely for the two howlers from Alisson other than to ball, passed it in small spaces, exactly what we
forced the errors, and that’s something we’ve “Nobody saw that in the first half, you only suggest cold feet contributed to the wanted him to do.
been working on in training,” but what was saw two really good football teams who tried to goalkeeper’s Anfield nightmare.
astounding was how many times the cause each other problems and I think some “Then in the beginning of the second half he
Merseysiders repeated their flaws. people were surprised we were quite dominant “I spoke to him a few seconds ago and he’s didn’t do that. He didn’t see the offers because
in the first half. obviously very disappointed. He was like: ‘Not we didn’t make them in the right way, and then
There was no mistake management from today, not today.’ the problem is that he doesn’t shoot the ball
Klopp’s charges, only mistake magnification. “We changed our high press (in the second somewhere far away from the danger spots.
half) and we had a few minutes where we tried “I said to him that’s the problem with
The manager conceded as much afterwards to find a solution in the final third. mistakes, you cannot decide when you make “I can’t help him through tonight but
and Liverpool have all but conceded their them. The only thing you can do is learn from tomorrow he will be OK and we will go again.” –
“They scored the first goal, we got the them and he will. He will make sure it never The Independent/Express Newspapers/
Agencies
theSun is published and printed by Sun Media Corporation Sdn Bhd (221220-K) of Lot 6, Jalan 51/217, 46050 Petaling Jaya, Selangor. Tel: 03-7784 6688 Fax: 03-7783 7435 • Tel (Editorial): 03-7784 6688 Fax: 03-7785 2624/5 Email: [email protected] • Tel (Advertising): 03-7784 8888 Fax: 03-7784 4424 Email: [email protected]