The Local Eye - Issue 124 - February 2016

The FEBRUARY

Local EyeIssue 2016

124 Advertising For Local Businesses, Trades
and Community Information...

CB BS Local Eye Cover Feb16 FP.qxp_Layout 1 19/01/2016 10:06 Page 1

JanuaryNOW EXTENDED INTO FEBRUARY

• OPEN 7 DAYS
• FREE ESTIMATES
• 100’S OF BIG BRANDS
• BEDROOM FURNITURE

& 100’S OF RUGS

BANG!STARTTHE NEWYEARWITHA

MASSIVE SAVINGS ON CARPETS, BEDS, BEDROOM FURNITURE & FLOORING!
WE’LL BEAT ANY LIKE FOR LIKE WRITTEN QUOTE!

PLUS, SPREAD THE COST WITH INTEREST FREE CREDIT

Ferndown Industrial Estate, btehed
WIMBORNE BH21 7PE,Tel: 01202 872240 store
The Bed Specialist
NEW LOCATION Nuffield Ind Estate,
Poole, BH17 0RR,Tel: 01202 723162

carpetsandbeds.com

Flooring Superstore

2
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

128mm x 190mm

3

REPAIR CENTRE

10%

DISCOUNT

ON LABOUR

QUOTE OFFER CODE:

EZ11

· Specialist in Dell Systems and Monitors
· Virus and Malware Removal Our Speciality
· Computer and Notebook Repairs
· Failed Hard Drive Data Recovery
· Systems Built to Specification
· No Fix - No Fee (terms & conditions apply)

606 Wimborne Road, Winton, OPENING TIMES:
Bournemouth BH9 2EN
MON-FRI 8:30am - 7pm
01202 267267 SAT 9:30am - 5pm

www.ezcomputers.co.uk CLOSED SUNDAYS AND
[email protected] PUBLIC HOLIDAYS

Please mention this magazine when responding to these adverts - Thank you

4
Welcome to the February issue

What a very wet and windy
start to the new year it was,
continuing on from the bad
weather of 2015.
I think we should consider
ourselves very fortunate when you
realise how badly affected other
parts of the country have been.
Let’s hope that with Spring just
around the corner, and the days
getting longer, some brighter and
dryer weather may be with us.

is magazine is delivered free to an alternating selection of around
13,000 homes and businesses in Bournemouth, mainly through the
Charminster, Queens Park, Moordown, Ensbury Park, Redhill, Winton,
Muscliffe & Strouden Park districts.

If you would still like to obtain a copy when it is not your regular month,
copies are available at e Bournemouth Life Centre in Moordown,
Mike Stokes Tyres and Johns Fish & Chips in Moordown,
AH Parfitt - Chiropodist/Podiatrist and e Hungry Wolf Cafe in
Winton, Charminster & Winton libraries, Moordown Community
Centre, several laundrettes in Charminster, Moordown & Winton
as well as e Richmond Park Bowls Club in Charminster and the
Bournemouth Indoor Bowling Club, Kings Park.
(If you’d like to be included in one of these locations please do contact
me, all details are below)

I intend to continue increasing the coverage of e Local Eye over the
coming months and of course I will be looking for a lot more new
advertisers, so if you have a business you would like to let more people
know about, please get in touch.

More information on rates and ad copy submission as well as online
copies of the current and previous issues can be found on the website.

08000 430485 / 01202 255485 / 07801 474788
email [email protected]
www.thelocaleye.com

Until next month, try and keep dry!

Chris

Every effort has been made to ensure that the information contained within this publication was correct at the time of going to print. We
cannot be held responsible for any inaccuracies in advertisements, editorials or features nor for any consequences arising from these. We are
not to be held responsible for any errors, loss or damage to copy in printing. The Local Eye does not officially endorse any advertising material
included within this publication. It is the advertisers responsibility to ensure conformity with laws and/or acts relating to Trade Descriptions,
Sex Discrimination, Consumer Credit, Copyright etc. No part of this publication may be reproduced, stored in any retrieval systems or
transmitted in any form - electronic, mechanical, photocopying, recording or otherwise - without the prior permission of the publisher. The use
of this publication for canvassing, direct marketing or any other activity apart from sourcing local goods and services, is strictly prohibited.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

5
Please mention this magazine when responding to these adverts - Thank you

6 February 2016 - History Spotlights...

Decimalisation - 15th February 1971

On Monday 15 February 1971, Britain went decimal. The old money - pounds, shillings and
pence was replaced by a new system with 100 pence in the pound and no shillings. It seems
simple to those who have never known it to be different, but at the time people were worried
about it. Imagine the confusion though, if we were to go the other way now! Think of the
complications of a pound that has 240 pennies, with 20 shillings to the pound along with half
crowns & tanners, thrupenny bits and farthings! Decimalisation was not a new idea, proposals
were made to Parliament to decimalise sterling as early as 1824 though rejected of course.

For a while the old and the new currencies ran hand in hand. People could pay in pounds,
shillings and pence and get new pence in their change. There was an original intention to keep
the old money in circulation for eighteen months, but in the end, the old penny, halfpenny and
threepenny bits were no longer legal tender by August 1971. There were also a handful of shops
that refused to switch, resolutely clinging onto the past, but eventually even they had to change.
One big controversy with decimal currency was that people thought the shops used it as an
excuse to put up prices. We still have yet to embrace the idea of metrication over imperial
measurements as fully as we accepted the decimal currency, and you may still hear the phrase
“What’s that in old money?” when referring to metric measures. (Often by me!)

Birthdays This Month Include... Holly Willoughby
10th February
David Jason John Williams 1981
2nd February 8th February

1949 1932


Warwick Davis Mia Farrow June Brown
3rd February 9th February 16th February

1970 1945 1927

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

7

STURTONS & TAPPERS

NEW YEAR • NEW STOCK • NEW SAVINGS

• SOFASSAVE UP TO
• FURNITURE
• SOFT FURNISHINGS

%• KITCHENWARE

50OFF!•CARPETS
PLENTY OF FREE PARKING AT REAR OF STORE

STURTONS & TAPPERS
Winton - 426 Wimborne Rd, Bournemouth, Dorset, BH9 2EZ Tel: 01202 512345

Wimborne - 20 East Street, Wimborne, Dorset, BH21 1DT Tel: 01202 883311

www.sturtons.co.uk Find us on...

Please mention this magazine when responding to these adverts - Thank you

8
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

Clean Start 9

Carpet Cleaners

The ultimate in discounted
carpet and upholstery cleaning

SINGLE ROOM - WAS £36 - NOW £18
LOUNGE DINER - WAS £44 - NOW £22
3 PIECE SUITE - WAS £120 - NOW £60

HALL /S/L - WAS £60 - NOW £30
2 BED HOUSE - WAS £160 - NOW £80

END OF TENANCY CLEANS

T: 0800 246 5183 / 07455 427414
www. cleanstartcarpetcleaners.co.uk

WINTON WOOL SHOP

CARLY‛S CRAFTS

Stockists of:-

NORO ~ DEBBIE BLISS
PATONS ~ RICO

STYLECRAFT ~ SIRDAR
ROWAN ~ KING COLE

Large selection of Patterns,
Needles and Accessories

Shop 1, 1a Cardigan Road

(road opposite Poundland)

0W1i2nt0o2n 5B1H29110BJ6

Delivery Service available

Please mention this magazine when responding to these adverts - Thank you

10

Derek J.Rolls

Independent Estate Agents & Valuers

ASK THE AGENT...

Q. With the market starting to pick up, should I put my home on the market now or wait till
Spring?

A. You have no idea just how often we estate agents get asked this question whatever the
time of the year, and whatever the state of the market!
And the answer, as always, is a resounding ‘NO! You do not need to wait till Spring’

You are right insofar as the market certainly has started to pick up. In fact, the past 6-8
months have seen an almost uninterrupted flow of good, positive news. But with prices
starting to creep upwards again, does that mean the canny vendor should wait a while longer
before coming to market in order to get the best possible price? No it doesn’t!

The simple fact is that there is rarely, if ever, anything to gain from waiting before putting
your home on the market. You mention Spring and certainly the period around Easter, in
particular, is traditionally supposed to bring the buyers out in their hoards. But that very fact
also tends to attract large numbers of vendors, eager to capitalise on what they optimistically
imagine is going to be the resulting feeding frenzy.

There is a philosophical point here as well. With prices on the increase, you could
theoretically wait forever in order to get top price for your home! Indeed, the only way you
could ever be certain of having got the best possible price, in this cycle at least, would be if
you sold just before values started falling again. And unless you were extremely lucky with
your timing, that would be unlikely to happen!

The longer answer to the question is you should move home when it suits you rather than try
to play the market.

Besides which, the one thing that just about every estate agent in the land is saying at
the moment is that there is a serious shortage of properties for sale right now. Buyers are
registering in their thousands, buoyed up by growing confidence in the state of the economy
as a whole, increasing availability of a wider range of mortgage products, and continuing
low interest rates. Yet agents don’t have enough stock on their books to satisfy them.


So, my advice is: “Go for it!”

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

11

Derek J.Rolls

Independent Estate Agents & Valuers

You may have seen us, but have you met us?

Derek Rolls...
One of the area’s most known and respected Estate Agents. Selling property
locally for over 30 years. Much business is from recommendation and most
of you will have either instructed Derek or know somebody whom he has
helped to move home! Derek has a very valued and sought after opinion on
the local market having experienced and worked through all it can throw. A
charitable chap who devotes much of his spare time to organisations helping
to help others. Currently, one of the sponsors of Moordown Bowls Club, we
are very proud to support a truly local Moordown club, a great community
facility involving many local residents.

Wendy Rolls...
We couldn’t do it without Wendy’s support. Mum and self proclaimed
C.E.O! From a Banking and Finance background fulfilling the admin role
and basically runs the place! Wendy will be there for anybody if needed
especially for those with four legs and a tail. As well as handling the day to
day challenges of a successful estate agency Wendy is voluntarily involved
with local animal search concerns. Her main passion is Dorset Search
Dogs and she’s training hard to raise funds for them in the 2016 London
Marathon. Currently working towards getting Giant Schnauzer, Hattie,
operational as a search dog to find missing persons (and even lost estate
agents) throughout the area.

Martin Traves...
Lives locally and devoted to the industry for 30 years (catching up with
Derek). Worked with a corporate agent and 10 years for a local independent
company. We were thrilled to have Martin join us just over 2 years ago and
he is a vital part of our small team. He has sold more than a few thousand
properties over the years for families, companies, solicitor recommendations
and helped to build investment portfolios. There’s not much goes on he
doesn’t know about. Spare time, volunteers for Bournemouth Lifeguard
Corps, teaches rookie Lifeguards, a qualified beach Lifeguard/Rescue Boat
Crew, doesn’t need too much encouragement to get wet.

We are a very busy agency but always have time for anybody
wanting to sell or buy probably their most valuable asset.
Honest straightforward advice.

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

Please mention this magazine when responding to these adverts - Thank you

12

Gales solicitors is a long established Bournemouth firm providing legal advice and
representation to the public since 1948. Over the years we have worked out of Charminster
and Winton and are currently located in Winton. We are an active part of the local
community taking part in local traders groups and events such as the Winton carnival and
the Kinson donkey derby. This year we were also proud to contribute to the Winton in
Bloom fund which helped brighten up Winton high street.

Over the years we have prided ourselves on offering a service which is both professional
and friendly. We have built up a large client base of satisfied and loyal customers. Many of
our clients have used the firm for years and in some cases we are now acting for a second
or even third generation. Whether someone is a long established customer or a brand new
client our aim is to ensure that our customers always want more.

As part of this we have maintained a broad range of services with experts in several
specialisms. This means that we are able to provide most of our clients with a complete
service under one roof. This ensures that we are aware of the wider circumstances of the
case and can pick up issues which might otherwise be missed. It can also help keep the cost
down.

We know that the legal world is changing and as part of that we have introduced new case
management software to improve our service for people moving house. However, we also
know that our clients want a personal service from an experienced professional. For this
reason we continue to ensure that every case is managed by one key person so that you
know who is handling your case rather than having to speak to an anonymous assistant in a
large team.

We also know what it is like to be fobbed off with jargon and we pride ourselves on giving
advice in straightforward English. Whether verbally or in writing we like to keep it clear
and simple.

Whether you have a simple problem or a complex case we can help. If you are looking for
representation in lengthy court proceedings, for help in making a will or house purchase or
just quick advice on your legal rights while you consider what to do we can help.

Give us a call to see how we can help solve your legal puzzles.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

13
Please mention this magazine when responding to these adverts - Thank you

14 Mount Pleasant
Townswomens
Picture Box Afternoon Guild

A simple question of say what you see? We meet in the Bradpole Road
For example the first one below is? Community Centre at 2pm on the 1st
Wednesday of every month for a social
GUESS
afternoon, when we have different
GUESS activities including a speaker, and we
welcome visitors who we hope may join us
‘Second Guess’ of course!
and become members of TG.
AaRrmM
Our other activities include Trampers
BLONDE 6/10 8/10 10/10 & Eaters (when we visit nearby places of
interest and end up with lunch), skittles,
& a music afternoon (all sorts) and a Social
Studies afternoon when we reminisce and
TRAVEL discuss any current subjects of interest.
We are a happy group and look forward to
CHINA RED IRISH
NORTH BLACK making new friends,

(Answers on page 38) so whyWnoitnctoomne aLloinbgraanrdyjoin us.
WWinitnetroWn LoioblrCarryaft
A boy walked into a pharmacy
and asked the chemist to give him WNiEnWteforr thWe woinotelr mConrtahsf.t
something to cure the hiccups. The
pharmacist merely leaned over and Do you needNiEdeWasffoorrtpherwsoinntaelrismedonCthrsi.stmas gifts?

slapped the kid on the back. Do you need ideasLefot ruspeinrssopniraeliysoeud Christmas gifts?
“Why did you do that to me?” asked Scarves, toys, gloves; anything is possible!
Let us inspire you
the boy.“Well, you don’t have the
hiccups now, do you!” Said the Scarves, toyFs,rigelonvdelsy; aannydthfiungn is possible!
pharmacist. Friendly and fun

“No, but my Mum out in the car still SSuuiittaabbllee ffoorr aallll lleevveellss
does!” the boy cried.
.................... TTuueessddaayyss 22..3300 –– 44..0000

Five students were discussing which 11sstt aanndd 33rrdd wweeeekk ooff eeaacchh mmoonntthh
of their specialities was of the most
practical use. One of them went to
the bar and came back with a large

pink gin.
The chemist proceeded to explain

why it was pink in colour.
The physicist measured the specific

gravity and alcohol percentage.
The mathematician calculated the

cost per unit volume.
The doctor outlined what it would do

to the liver.
The engineer picked it up, swirled it

around and drank the lot.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

15

Berry Hill Farm
Local Vegetables for local people

GUARANTEED FRESH SEASONAL VEGETABLES
DELIVERED TO YOUR DOOR IN HOURS

Grown locally in 1-2 people - £9.00
Bournemouth for approx 6 servings

local people, 2-4 people - £14.00
using only approx 10 servings
traditional
4-6 people - £19.00
farming methods. approx 14 servings

SELECT A BOX TO SUIT All boxes contain a selection of fresh seasonal vegetables
YOU AND WE DELIVER IT
For example: Potatoes, Cauli, Bunched Carrots, Cabbage, Brussel Sprouts, Purple
FRESH TO YOUR DOOR
Sprouting Broccolo, Leeks, Swede, Parsnips, Celeriac, Runner Beans, Broad Beans,

Marrows, Courgettes, Peas in Pod, Bunch Beetroot, Sweetcorn, Kale, Seasonal Salads.

Tel. 07971 795740 Berry Hill Farm, 185 Muscliffe Lane, Throop,

www.berryhill-farm.co.uk Bournemouth BH9 3NH Email. [email protected]

Stephens

Carpentry & Building

Kitchen Fitting General Building
Renovations
Fitted Wardrobes
& Cupboards Bricklaying & Plastering
Patios
Door Hanging,
Architrave & Skirting General Maintenance

Fencing, Decking, Sheds

1st and 2nd Fix

No Job too Small • References Available • Fully Insured • Free Estimates

Brian Stephens

Tel: 01202 525 445 Mob: 07921 525 424
[email protected] www.stephensbuilding.co.uk

26 Green Road Bournemouth BH9 1EA

Please mention this magazine when responding to these adverts - Thank you

16

Travel Feature -

2016.When is the best time to go? ... By Mags Addison

It’s cold outside. And we still have grey skies. Roll on escaping for a short while.
So while we are still in the grip of deep winter here in the UK, it’s comforting to
think ahead - towards a holiday or short break during 2016. But when is the best
time to go? What season? Matching the best time of year to various destinations
and parts of the world, is one way to get the most out of your precious holiday.
After all, why would you travel somewhere at the wrong time of year if you can
help it. So maybe this quick rundown will help, and give ideas.

January – February

This is usually the time for a sunshine holiday to escape the cold and frost here.
But bear in mind that if the sun is shining and it is hot weather somewhere – it
will be their peak season and the prices are higher. The Canaries, Cape Verde and far flung destinations like The
Caribbean, Australia, The Far East, Goa, Dubai, Abu Dhabi and also parts of Africa are ideal.
March – April

The end of our winter is in sight and places like Cyprus with its long warmer season become a good choice.
City breaks in Europe are good, when it’s less oppressive, or chilly – although watch out for the Easter crowds.
European river cruises, Holland and the tulips are pleasant at this time of year. Try far flung places like Cuba,
Mexico, India, and Sri Lanka. Although paradoxically March is a good time to see the Northern Lights in the Arctic!
Take your choice!
May-June

These are usually pleasant, warm months in the Mediterranean, and the prices in May are at their lowest for the
summer season. Spain, Portugal, Greece, Turkey and Egypt start to get busier now. Italy is lovely also now. Further
away, try the USA, Canada, Hawaii, Brazil or China.
July-August

So – it’s peak season, when prices start to rise along with the temperatures. All of the Med and Europe, Eastern
Europe, and the UK- have good weather now, so take your pick. This is when families have to take their annual
break because of school holidays, so prices are highest. It’s also peak time for the club scene in some of the hot
spots for young people. So, be careful which resort you book while thinking of popular Mediterranean areas.
September-October

The kids are back at school, so prices drop marginally – always a popular month for older clients.
Most of Southern Europe is still reasonably warm, so City Breaks and Touring holidays are popular. For sun spots -
usually the best bet to pick the places in the Eastern Med for more sunshine, like certain parts of Greece, and Turkey,
along with Malta and Cyprus.
November - December

Towards the end of the year, and it’s time to grab some late sunshine in the
Canaries, or Madeira. Good prices too, before the Christmas season swings in.
Late November is also the start of the Christmas Markets around the UK and
Europe – now a big part of the short break season.

I hope this has given you some ideas and insight? Happy travelling to you.

Beach holidays, City breaks, Honeymoons, Weddings abroad, Adventure holidays, Ski,
Cruise, Tailormade trips, Flight only, Car hire, Airport hotels and parking and much more...

Contact Travel Counsellor

Mags Addison

0845 058 7812 Travel Counsellors ensures complete
financial protection on every booking
[email protected]
www.travelcounsellors.co.uk/margaret.addison

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

17

Phone us ‘The Bourne
today on Academy is a
01202 528554
for a tour of GOOD
the Academy. school.’
Ofsted 2014

COMMUNITY LETTINGS

We have excellent
facilities for hire.

If you are considering holding an event, club or group activity,
contact us today for availability and prices.

Hadow Road, Bournemouth BH10 5HS | 01202 528554 | [email protected]
www.thebourneacademy.com

Please mention this magazine when responding to these adverts - Thank you

18

SUDOKU

How to Play

Fill in the grid so that every
row, every column,
and every 3x3 box
contains the digits
1 through 9,
with no repetition!

Simples!

You solve the puzzle with
reasoning and logic,

there’s no maths involved
and no adding up.
It’s challenging.
It’s addictive!
It’s fun.

(Solution on page 38)

Wanted

Reliable Delivery People

Due to the continued growth of The Local Eye,
I am in need of additional reliable delivery people.

You will need to be reasonably fit and healthy, and have
your own transport as each round is usually at least 500

magazines and they are too heavy carry all at once.

If you would be interested in earning a few extra pounds
for a few hours walking each month, then please give me a
call on 08000 430485 or email: [email protected]

Name that band....

e Searchers - taken from a John Wayne film of the same name.
e Small Faces - all four members of the band were under 5’ 6” hence the ‘small’

part of the name and the ‘faces’ came from the mod slang for cool dudes.
Duran Duran - was a villain in the film ‘Barbarella’ which starred Jane Fonda.
ree Dog Night - derived from Australian slang for a freezing night. In the outback
on a cold night a man would need to sleep with a dog to keep warm. On a very cold
night he would need two dogs to keep him warm and three dogs on a freezing night.

Simple Minds - taken from ‘Jean Genie’ lyrics by David Bowie

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

19

FEBRUARY SPECIAL

Please mention this magazine when responding to these adverts - Thank you

20

Project Indigo

One boy’s adventure through time and space!

Hi, I’m Tom, a local Doctor Who blogger & I write about my adventures online at
anadventurethroughtimeandspace.com

We are going to hop in my TARDIS and
travel back in time to the summer of 2015.
Welcome to Puzzlewood in The Forest of
Dean, Gloucestershire - a forest for which
there is no map! Puzzlewood is a filming
location for many TV shows and films-
including a film called Star Wars - The Force
Awakens!
DON’T BLINK! Do you remember in Flesh
and Stone (2010) when the Doctor, River
and Amy are being chased down by the
Weeping Angels? Puzzlewood was the filming
location for the cybernetic forest on board
The Byzantium which provided the passengers with air. As they travelled through the
forest, poor Amy had to keep her eyes shut as she had a Weeping Angel in her eye. Luckily
for me I didn’t run into any Weeping Angels when I was there! Puzzlewood was also a
filming location for The Time of the Doctor (Christmas Special 2013), Matt Smith’s final
episode which saw the Eleventh Doctor regenerate. In this episode the Doctor and Clara
were attacked by the Weeping Angels in a frosty land.
Other things filmed at Puzzlewood include Atlantis, Merlin, Wizards vs Aliens, Jack the Giant
Slayer and Tree Fu Tom. Puzzlewood is so popular because of its very special scenery and
it looks amazing on screen. There is a wall of photos inside showing the many programmes
and films that have used this location.
On show at Puzzlewood, Scowles are the geological feature. Scowles are found throughout
the Forest of Dean and are ancient caves formed millions of years ago in the carboniferous
limestone that have come to the surface due to erosion. The rocks are covered in a
feathery moss that makes the forest so green (and the trees are so green too!) it is the

greenest place I have ever been. It is said
that Puzzlewood was the inspiration for
the forests of Middle Earth in JRR Tolkein’s
books, which sounds pretty reasonable to
me!
I had a really nice time at Puzzlewood and
enjoyed getting lost in the woods and trying
to figure my way out -it was a real puzzle!
I found many things including a magic
doorway and dinosaur feet. The weather
changed all the time and it got wetter and
muddier as the weather changed from good
to bad, good to bad. Top tip - if you visit
wear old clothes and wellies!
Thank you for reading and I hope you will join me again for my next
Doctor Who adventure.
Tom Project Indigo anadventurethroughtimeandspace.com

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

21

LFB MEATS

01202 533997

L F B Meats have been serving the local and
wider community for years, delivering great
quality local sourced produce at great prices.

Quality counts and we assure you that you
can’t get better than us! An award winning

butchers, we offer free range local foods
served to the highest standard, the good old

fashioned way.

349-351 CHARMINSTER ROAD, BOURNEMOUTH. BH8 9QR

Isn’t there
something you’d
rather be doing with
your spare time?

Could you use some help with your Cleaning, Ironing or Both?

• Regular hourly rate only £10.50 - £11.50 per hour
• One off spring cleans available - call for price details
• Times and hours to suit you - (minimum 2 hours per week)
• Reliable, honest, professional service
• Insurance provided

Call 0800 0925 773
Email: [email protected]

You deserve a rest... So be served by the best

Please mention this magazine when responding to these adverts - Thank you

22
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

23

D Learn To
A

N Dance Now
C

E

D Specialists in the following:
A

N *Ballroom

C *Latin

E *Junior Street

*Ballet & Modern
D *1st Wedding Dance
A
N *Adults

C *Juniors

E *Tiny Tots

D ANGLO DANCE STUDIOS
A 93a Chatsworth Road
N Bournemouth BH8 8SN
C Tel: 01202 514551
E www.anglodance.co.uk

Please mention this magazine when responding to these adverts - Thank you

24





















t $! ( * , ) $ , $) % $
t %)$
#) ( ( %
t $! ( + !! % $* *

t $ $ ( %) ( ) (%
& ) & (# # ($& # ! #


$ !
( !
) %



& " ( " )$ )(
, ',' ' , '
***w"w w$.a b (s&o l u+t e ly -f#l o o$$rl e s#s!. c&o$."u k "(

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

With25Th%isOAFdF 25

Conservatories

Soffits, Fascias, New Guttering & Downpipe
Doors & Windows

Highly Competitive Prices

Local Bournemouth Company - Established 20 Years

aspecthomeimprovements.com

Please mention this magazine when responding to these adverts - Thank you

26

Hi I‛m Eva a pretty 2 year old German Shepherd cross,
I came to Waggy Tails Rescue because of a change in my
family‛s circumstances. I am a good girl who loves to play
and I get on with humans and dogs alike but as I am still
fairly young I will need ongoing training. I am really good
company and I‛m missing having a family of my own where
I would be a loving and loyal member. The people here at
Waggy Tails call me their pretty princess and look after me
very well but please please could someone give me a forever

home.

For more information on Eva or any of the other animals in
our care please contact us on 01202 87500, e-mail: admin@
waggytails.org.uk or visit our website www.waggytails.org.uk

Christmas is now over for another year, but life at Waggy
Tails Rescue still keeps taking in animals that for one

reason or another cannot stay with their owners. All this cost the charity
a great deal of money so we are forever grateful of any donations made to
us, so if you have any unwanted Christmas presents why not donate them to
one of our shops who will gratefully receive them. As always we will be out
and about collecting throughout the year so look out for our yellow tops, so

all there is left to say is thank you to all who have supported us over the
years and hope you all have a good 2016.

Waggy Tails Rescue is a registered charity based in Dorset; we rescue
and rehome dogs that have been abandoned, neglected or otherwise
in need of a new home.
We also find homes for other small furries that may be in our care,
so to find out more you can contact us on the number above
or send donations or letters to:

Donations for Waggy Tails can be sent to:
Waggy Tails Rescue, Helens House, 143 Magna Rd, Canford Magna

Wimborne, Dorset BH21 3AW

*Please note, these are NOT Waggy Tails animals, just very guilty ones!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

27

NOW OPEN

ALL YOUR REQUIREMENTS FOR CATS AND DOGS

SMALL ANIMALS, FISH AND BIRDS

NUTRIMENT RAW FOOD

JAMES WELLBELOVED

ROYAL CANIN NOWNOOWPEONPEN
FORTH GLADE

NUTRUM

ABLULRAYNLOSLUYRORUERQRUEIRQEUMIREENMTSENFTOSRFCOARTSCAATNSDADNODGDSOGS

And mSuMchALSmLMuAALcNLhIMmAANLoISMr,eAFILSSH, FAINSHD ABNIRDDBSIRDS

NUTRIMENNTUTRRANIWMUTEFNROTIMOREADNWT ~RFOAFOWODFROTOHD GLADE

ROFYFARrJiALeEIMnCfEdAEwdlNSieeeRNBJFIWAlONUOsUihMRtvRTYEaETe~ANRpLSNBJFRvrHLSUAeLOBUOUWyeMCMGtBRRTYUAELoEEnTAsNRNRALnSHhLLSULoIDNWNoBMOCGaEtSAEpELlV.gLlNAL..EOioLoIDnNDBVrtE&NEdTiLD~mteoOOrwpuVNsWcElUnhoeDT,,vamRaeOsrnuAePcdM£ha2Ewms5Nkeorawe nildl mwaetcwhiallneynpdriecaevionuBrotuorngeemt iotu

If we havAeALnnLodt(YimAgnOonu5tUdcSmihRtMmOipmlARueplecLureEhaaLcnQsdhmeiUinAumuaIsgNsR)coIkhHrMEeamoMAnuLodErSrNswe, FTMeISSwoHFinlOAldRNeanDCydABe–aITRvSSDoauAStruNtrDodgaDeyOt 9iGt –Sfo6r you.
FrieTnedlli:Ie0fs1wt2peN0IeUhf2tTawsRv9heeI1oMhpn1Eao3iNvnt5eTg0tnRooAotwtWintgpFoaEOltnemOidatDsawpeilelea:awsskielmalanmsodkgawtagcniehedwsawanilnyel dewpndridiolclegeeagnivnidoeeuBsar1ov@tuorunogreeumttoilotoguoetthki..tcom
OPENFrIieNnGdFrlieJRAHsnOMtdYOpElAieSeLUtsWCtsRAhEpoNLeSpLtINBsi:nEhLMoTOpoVwOinEnDNT,oaDwndnA,wYaendw- wiSlleAmwTaitlUcl hmRaantDcyhAparYincyepi9nriAcBeoMuinrnB-eom5u.ro3nue0tmhP!oMuth!
Tel: 01202 9FNO1U1RTTR3HU5MG0OLApeDnEEOinpmgeHnaoiniulg:rsHmMouoornsgdMgaiyoen–sdaSaanytud–rdSdaaotyug9rgd–iaey6s91–@6 outlook.com
9303 WTeiml:0b1T2oeAB0lr:Un20nRd19eN21mS0R123uo5c9a0h1d1m3,5uM0EcmhoamoilEro:mdreoamiwlo:gng,mieBosaogngudierdsnoaegngdmideoos1gu@gtiehosu,[email protected] 2BN

Please mention this magazine when responding to these adverts - Thank you

If we have not got it please ask and we will endeavour to get it

28

Brainstorm

1. If it were two hours later, it would be half as long until midnight as it would be if it were an
hour later. What time is it??

2. I am thinking of a five digit number. To help you it has the following parameters.
It contains neither zero or the number 1 and no digit is repeated.
The fourth digit is a quarter of the total of all of the digits.
The second digit is twice the first digit.
The third digit is the largest.
The last digit is the sum of the first two digits.

3. A jewellers safe has a rather unusual security keypad.
In order to open the safe you have to press every single
button once only, in the correct sequence, ending on the
button marked E.
Each button clearly states which button to press next, for
example, 2U means move up 2 buttons and 3R means move
right 3 buttons.
Can you discover which button you must start with?

4: How does this make sense? 1 was a race horse, 2 was 12, 111 race, 2112
Answer on page 38

Contact The Elderly - Volunteer Drivers & Afternoon Hosts Required

Once a month on a Sunday afternoon local elderly people, who are without family in the area, are taken out
by volunteer car drivers for a little ride before going to the homes of volunteer hosts and hostesses for Sunday
afternoon tea.
We only ask our volunteer hosts to entertain up to six elderly people and two
drivers or one driver with up to three elderly people once or twice a year.
A downstairs cloakroom is a must.
Reserve drivers are always wanted when the regulars are unavailable. This
would be possibly two or three times a year.

Elderly people who would like to take part in one of these afternoons are
welcome to join the group but must be able to get in and out of a car, as we
can’t take zimmers or wheelchairs. There is no charge.

For more details phone Carolyn Dennis 01202 424482

“Honey, why don’t you sit down by the table and we’ll start supper.” Said
Dorothy to her husband of 50 years. “Sure thing,” said Bob, settling himself

down. “Now my darling, would you like some bread with your soup?”
“Umm I think a slice would go nicely please,” He answered.

After an evening of one loving term after another, their guest the local vicar,
couldn’t contain his curiosity any longer. Following her into the kitchen he
asked, “Dorothy do you always talk to your husband like that?”

“Well, I’ll be honest with you,” Dorothy replied. “It’s been five years now, I just
can’t remember his name, and I am just too embarrassed to ask him!”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

29

Bosch Car Service Centre
The national network of independent garages

3-5 Malvern Road
Moordown

Bournemouth

BH9 3AE

4square . Servicing
. Air Conditioning
bickerley . MOT Testing Station
. Wheel Alignment
. Tyres
. Clutches
. Braking Systems
. Diagnostics
. All Makes & Models
. Technical Expertise
. First Class Customer Care
. Top Quality Bosch Trained

Mechanics

. Free Collection & Delivery
. Loan Car Available

01202 528772 www.malverngarage.boschauto.co.uk
E: [email protected]

Please mention this magazine when responding to these adverts - Thank you

30
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

31

BRING THE

WORLD 15OPS_HF_Recruitment_Flyer_A5.indd 1
into your

HOME

And host an International24/10/14 18:05 Student!

We are looking for couples, singles & families to host students from across the globe.

Being a host family is as rewarding for you as it is for your students.

You learn about another culture and provide a once-in-a-lifetime experience.

Homestay accommodation required all year round.

15OPS_HF_Recruitment_Flyer_A5.indd 1 24/10/14 18:05

Guaranteed weekly payments

24 hour staff support

50 years experience in language education CONTACT24/10/14 18:05

World’s largest private15OPS_HF_Recruitment_Flyer_A5.indd 1 education company
Friendly & supportive team

01202Accommodation required all year round
832830EF International Language Centre
11 Poole Road, Bournemouth, BH2 5QR

[email protected]
www.ef.com/host

Please mention this magazine when responding to these adverts - Thank you

32

TIRED OF POTHOLES

DOG POOP VANDALISM

BROKEN STREET LIGHTING

FLYYTIPPING LOOSE PAVING?

REPORT THEM TO THE COUNCIL WITH

.com by

Bumpy ride this morning? View blocked by dumped rubbish?

Potholes and fly tipping are just two of the street faults that can be reported via
the website www.FixMyStreet.com along with vandalism, graffiti, dog fouling
and many other common community issues.

While most of us know that the council are responsible for fixing these things,
we may not know which council, let along which department in which council.
With FixMyStreet, all you have to do is locate the problem on a map, and select
a category: the site then sends it off to the right place to get it fixed.

All reports are published on the site, as well as being sent to the council.
Browsing your own postcode can be interesting, as you soon learn what the
persistent problems are in your area, and whether or not they are being fixed.
There’s also the opportunity to discuss individual reports in the comments
section.

FixMyStreet comes from the UK not-for-profit organisation mySociety, and
is one of its longest-running and most-used services. It is just one of several
projects aimed at making it easier for citizens to get things changed in their
own community. So, next time you see something that needs fixing, be it a
broken paving slab or a flickering streetlight, all you need to remember is

FixMyStreet.com

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

33

RR..JJ..HHuullll && CCoommppaannyy
CertiAfiecd PcroacutisningtaAcncotusntants

Accountants312 Charminster Road, Tel: 533370

312For moreCthahnwa2wr5wmy.erjaihnrsuslwltaeechcraovRuenobtaaenedtns,.acTsose.iuslkt:in5g3b3us3in7e0ss

people in the Charminster and surrounding areas with :-

pF∗∗oeSProoapmlreltoenTreiernrasttdhhheaieprnCaa3chc0cacyoromeuuannirnttsssstweer ahnadvesu∗∗brTPeraaeoyxnurnRaodsellistnuisgrtniansrgeabsuswinitehs:s-

∗ Limited Company accounts ∗ Bookkeeping & VAT

FSaoslte, eTfrfaicdieernatcpceorusnotns al serviceTaatxaRffeotrudranbsle fees
 Partnership accounts  Payroll
PinlcelausdeeePnqayuriLoreillma, bBiootueotdkokuCereocpominmgppaalnentdeyVmaAacnTca,goaelulmnceotnmst psearnvyBicroeetofuokrrnkLs,eimaenipnteiudnalgcoac&mcpoVaunAniteTss, to
and

management advice on a fixed or variable fee basis

Fast, efficient personal service at affordable fees

Please enquire about our complete management service for Limited companies to
include Payroll, Bookkeeping and VAT, all company returns, annual accounts, and
management advice on a fixed or variable fee basis

BOURNEMOUTH Zoe Bellamy
VETERINARY CLINIC
BSc.Pod.Med - M.Inst. Ch.Pod

Chiropodist / Podiatrist

Is your household on benefits
or low income?

Are you a pensioner on pension credit?

If so, you may be entitiled to low cost CHIROPODY
neutering and other vet treatments. HOME VISITING

For more information on how to SERVICE
register please call the clinic: IN YOUR AREA

01202 526520 For total footcare please call

144 Richmond Park Road 01202 309932
Bournemouth, BH8 8TW
24 HOUR ANSWERING SERVICE
Mon-Fri 10am-4pm

Charity No. 205126

Please mention this magazine when responding to these adverts - Thank you

34

Tea for Tinnitus – Tinnitus Awareness Week 8th – 14th February

Do you suffer from ringing in your ears?

Ringing in the ears or tinnitus, as it is
medically known, is often described as
a hissing, buzzing, chirping, whistling
or a humming noise. Tinnitus is not a
disease or illness, but is thought to be
caused within a person’s own auditory
pathway. About 10 per cent of adults in
the UK experience mild tinnitus but up
to one per cent have tinnitus that affects
their quality of life.

The British Tinnitus Association (BTA) are a charity and world leader in
providing support and advice about tinnitus. This year sees them celebrate their
10th anniversary of Tinnitus Awareness Week by launching their Tea for Tinnitus
campaign.

Come along to your local event - Friday 12th February at 2pm.
Sunrise Senior Living, 42 Belle Vue Road, Southbourne

The local Bournemouth Tinnitus Support Group are holding a Tea for Tinnitus
event at on Members of the support group including Keeley Salmon, a hearing care
professional from Key to Hearing, will be on hand to provide advice about tinnitus,
tinnitus management and prevention. Come along and have a chat whilst enjoying a
nice cup of tea and some delicious cakes.

All donations collected on the day
will go to the BTA. Every penny
raised will make a difference by
helping to pay for the support the
BTA provide and their important
medical research into causes and
treatments for the condition.

To book your place please call
Ian Warren at Sunrise Senior Living 01202 437600

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

35

Experienced, Honest and Reliable Multi-Skilled Handyman

Inside Outside

 Carpentry  Decking
 Plumbing  Patios
 Plastering  Gardening
 Tiling  Pressure Washing
 Painting and Decorating

Available for full or half day hire to catch up with all the little jobs you have
been meaning to do.

Phone David McDonald for free no obligation quote 07951738446 or e mail
[email protected]

Numerous references available.

Get Fit & Flexible for the 50+

Thursdays 11 am until 12 noon.

ENSBURY PARK COMMUNITY CENTRE

Arrive before 10.45 am for your first session to complete registration

FREE FIRST WEEK THEN £1.25* PER SESSION.

*Special offer until Sept. ‘16 from Ensbury Park Community Association

Phone Sue on 01202 282315 for more information.

Please mention this magazine when responding to these adverts - Thank you

36

FELICITY WARD

As seen on:

Josh Widdicombe’s ‘Josh’ BBC1
Russell Howard’s Good News BBC3

FRIDAY 26th
FEBRUARY 2016

Doors open 7.15pm

BOX OFFICE

0w1w2w.0co2ast3a1lc6om3e1d6y.com

Advanced tickets £10 Opening Act

£15 on the door. Show starts 8.30pm James Redmond
From Casualty and Hollyoaks
Hotel Celebrity, 47 Gervis Road Hosted by Adrienne Coles
Bournemouth BH1 3DD plus support
Over 18’s only

Acts may change due
to TV commitments

ft

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

Romantically Yours 37

123 4567

Prize Crossword

8 9 10 11

12 13

14 15

16

17 18 19 20

21

22 23 24

25

26 27 Win 2 tickets to
28 29 Coastal Comedy
Friday 26th February

(c) Chett January 2016

Across Down
Down1. A saint to love this time of year (9) 1. Lady Love in avenues without a
o love th58i..sPAtlitigmuhrent ooliftftfilyedeeAalilrtayn(9(c5)o)uld perform1.toLbaedy Lp2oo.viPneotsi(nit5i)aovnsenthueessewfloitwhoerustcaanpobient
fidelityu(n5a)ltered (7) (5) found in (7)
tle Alan1du0cg.oMiunyltdovipseoewurfrioscertmhoeftptoeraibvreast(e7i)nvesti2g.aPtoorsitio43n..sCRtaohrseeesseffoofulrnotdwheheircmsaricenarntsh(be6es)qfuoaurned(4)
7) 12. Its no secret if you wear youirnhe(7a)rt 6. When you look back this is where
w is the1hp3err.ieIvn(a6tse)hoinrtv,efsotrigyoautorrindfuorgmation3.aCares f7yoo.ruAtfhctaeemrcaeallrferisorsmsa((i6d7))and done, this is
of tearsth(o7u)sand and 50 form the unit (64). Rose fowuhnedrehtiomgoin(9th)e square (4)
ecret if y1145o..uTIdwraeedaailtrpioaynroatunlleryrhwfeoharirtttehheheolramede? w(4it)6ho. uWt hen y9coo. mAudplooarnoeikohnbe?ra(cI5kh)ethari,stihsewvehreyreclose
publicity upfront (5) you came1f1r.oGmam(7es) I play for the pictures (6)
, for yo1bue7rv.iePnrufaorgsreume(a5tt)hioenpuarethwoiuthsaonutdafte7rn.oAonfter a1pllo4ip.sIttshsaetiidqmuaeenssdtliiokdneo(tnh4ee,,5s)tehsisheisshould
m the un1it9.(6Y)oung suitor I leave for the bwirhde(r4e) to 1g6o. (A9ll) in pull together for candle (6)
rtner fof2ro2rt.haYenonluautdha?lien(vi4tei)anltly(6a)rrives before9ti.mAedore 1wh7eit.rhDImidhaePgariricn,actleheenwtviinceerfmayiercnllaot?dsye(7th) is way
onally w2h3i.teA hdooumbelewceitnhtouuryt breaks rod cwoitmhpanio1n8?. S(5to)re the money its said (5)
(52to)6t.aCl haogoreseemyoenutr (6) don’t1g1o. fGoramei2ss0Iy. ePpsrl!oa(py7o)fsoerdtohuetcpoimcteurifetsh(e6a)nswer
pfront target but

the purethweittahroguett a(3ft,4er)noon 14. Its tim2e1s. Slihkoertthoeffisceesrhisebsehfooureldouprosphade
27. Zero tbimadelyhaasndnoapfeperoliancgh(i7n) athtiemqiduesti(2o64n).
) 28. Slide Y(4o,u5h) ave belief whichever way

suitor I mleaanvneerfo(r5)the bird (4) 16. All inypouulllotookgaetthite(r5f)or candle (6)
nitially(2a49r,.r5iD)vierescbtieofnoirnesttirmucetiofonris correc1t7. Did P(2r4i5n).cReuswsiiannfsarierfluasdayl stthililsuwndaeyr pole
nt (6) with magical enticement? (7)

le century breaks rod with total 18. Store the money its said (5)

(6) Please mention this magazin2e0w. hPernorpeospsoenddionugttcootmheeseifadtvheertasn- sTwhaenrkisyou

your target but don’t go for the yes! (7)

38

PRIZE CROSSWORD ENTRY FORM

Win 2 tickets to

Send your completed entries to:
February Prize Crossword, The Local Eye,
22 Oswald Road, Moordown, Bournemouth. BH9 2TQ

Name: ________________________________ Tel:____________________

Address:______________________________________________________

Address:______________________________________________________

Closing date for entries is Friday 19th February

Congratulations to the winner of the January Crossword
Mrs Cooper of Ensbury Park who won 2 tickets to Coastal Comedy

DeSocluetiomn –bSeeasronSs Goreleutintgison Picture Box Answers

1C H 2R I S T M A 3S 4E L 5V E 6S 1. Father time
2. Arm in arm
HE NNAT 3. Fair and square
7O L D 8P R 9E L O A D 10T O O 4. The best man
5. Travel overseas
I OT WU C Brainstorms 6. Puss in boots
1R1 U 1D2 O L P H 1M3 E R R 14Y K
1: 9pm Sudoku Solution
EAE AEU I If the time was T, then T + 2
1M5 I S T R A L 1N6 A S A L N is half the minutes to midnight
compared with T + 1.
IE EG So 1 hour halves the gap. This
S 1R7 E 18L I 1C9 20J I 2N1 G L E S can only happen at 10pm and
11pm, which makes the current
TT I RA I O time 9pm
L 2S2 A N T A 2S3 L E I G H 2S4
2: Number is 24976
E ECOC P
25T O 2P6 2A7 S K A N C E 2S8 K I 3: Start with the 1U which is on
the 3rd row down and the 7th
OAGE IC column across
2E9 R N I E 3R0 A C E H O R S E
4: One was a race horse,
January Solution Two was one too.
Solution – Garden Centred One won one race,
Two won one too.
1B A 2C K 3B O N 4E 5M E 6A D O 7W

AHE NAP I
S E 8G A 9R D E N S H E D S
10I G L O O A
UI T
L S N N 1P1 R O D 1U2 C E
1S3 E E D I N G E N R
A A 1E4 X 15I S T E D
I
1C6 O S 1E7 R A
RN
O 1H8 A C 1K9 S A W 2P0
R
T O I 2O1 R A N G E 2S2
2T3 O W 2P4 A T H O R R T
A R C D 2A5 R O M A
2G6 R E E N H O 2U7 S E S U L

E SE S ONK
2S8 E A S O N 2E9 X C L U D E S

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

39

The Victoria Park Methodist Drama Group
“THE BELLES OF ST. MICHAEL’S”

February 17th, 18th & 19th - 7.30pm
February 20th - 2.30pm

Victoria Park Methodist Church Hall
Edgehill Road, Winton, Bournemouth

The scene is set in the cluttered drawing room of the Vicarage of St. Michael’s
and All Angels. Here the Rev. Hugh Featherstone’s attempts to write his weekly

sermon have already been disrupted by general dogsbody Dora’s singing and
hoovering; and the arrival of Mrs. Green and her daughter to discuss the latter’s
wedding. The arrival of a letter from the Bishop poses a problem both for Hugh

and the Rev. Justin Wade - vicar of the adjoining parish.
Programmes/tickets : Please call 01202 520482
£7.00 adults - £3.00 students in full time education
We have good access for wheel chair users but request advance notice in order to
re-arrange the seating. This year our profits will be going to Cherry Tree Nursery .
“Just relax”, the hospital staff kept telling Jim, but it was to no avail. Jim’s
wife was in labour and Jim was a nervous wreck. After what seemed like an
eternity, to both Jim and the hospital staff, a nurse came out with the happy
news, “it’s a girl”, she cried. “Thank God, a girl”, said Jim, “at least she won’t

have to go through what I just went through!”

Please mention this magazine when responding to these adverts - Thank you

40

& Nature Pictures Worldwide

Present an Evening with

www.becc.photography

"Brian Pettit"

"A Wildlife Year to Remember"

Wednesday 17th Feb 2016
@ 7.30pm

Bournemouth Electric Sports & Social Club
Broadway Park
Broadway Lane
Bournemouth
BH8 0AA

Tickets £6 to non Members on door or
£3 to Members Mike 07850 335746

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

41

Bournemouth Electric Sports and Social Club

The club used to be the social club for Southern Electric but is now open
to anyone and will be known as Broadway Park Sports and Community
Club (Trading as B.E.S.& S.C.)

The club is open to all and has a Large Function Hall that can be used for
Shows, Parties, Christenings, Wakes etc.
(The local Ghurkhas & Indian Community hold their parties here.)

The Club has a large number of sections for people to join.
These include Junior & Senior Football Teams, Ladies & Mens Darts,
Skittles, Golf, Bowls, (includes short mat indoor bowls), Camera Club,
Drama, Wednesday Club (known as the Retired Section) or join just as a
social member. The skittle alley (Butler Suit) can be hired out separately.
The club has three bars:- Main Club, Function Hall & Butler Suit which
enables it to hold several functions at the same time.
It also has a large car park and disabled access.

For more information visit: www.bournemouthelectricclub-bh8.co.uk
Or Telephone 01202 918698

01202 255485 Local Trades
08000 430485 & Businesses
07801 474788

Made For
Each Other

The [email protected]
Local Eye www.thelocaleye.com

Please mention this magazine when responding to these adverts - Thank you

42

There is no beating the taste of truly fresh
fruit and veg especially, when it’s yours!

Gardening Tips for February

There is a surprising amount to do in February in spite of the weather and short days.
• Sow Sweet Peas inside in pots and pinch out the tops when 2 leaves have appeared.
• Fork and rake over flower beds in readiness for planting later.
• Plant any hedging you have planned for this year.
• Buy your seed potatoes and chit them inside in a bright frost
free area.
• If you did not force Rhubarb last year you can do it now by
placing a black bucket over to exclude any light.
• Start sowing crops from seed in the greenhouse.
• Use a Copper fungicide in watering to prevent Damping Off
disease.
• Clean up Greenhouses and cloches not already done with warm soapy water adding Jeyes fluid
if you wish. Don’t forget last year’s plant pots, stakes and plant supports intended for use in the
Spring.
• Take care not to tread on Spring Bulbs when walking across lawns and borders.
• Apply Ferrous Sulphate on lawns where moss is a problem.
• Plant Rose bushes now but do not prune until all risk of frost has passed.
• Hydrangea flower heads can now be removed down to a pair of shoots to encourage new growth.
• Remember to continue to feed the birds and provide clean water to drink and wash in.

Do you live in Bournemouth?

Do you want to grow your own fresh fruit & vegetables & get fit & healthy?
Then come in & see us in our allotment shop. Saturdays & Sundays 10am - Midday

Large plots are £36 pa and half plots are £19pa
For more information – just ask us when you visit us

North Bournemouth Allotment Society, Cornelia Road, BH10 4FG
www.northbournemouthallotmentsociety.co.uk

Two elderly ladies were sitting on a park bench outside the local town hall
where a flower show was in progress.

One leaned over and said, “Life is so boring. We never have any fun anymore.
For £5 I’d take my clothes off right now and streak through that stupid flower

show!” “You’re on!” said the other old lady, holding up a fiver.
As fast as she could, the first little old lady fumbled her way out of her clothes

and, completely naked, streaked through the front door of the flower show.
Waiting outside, her friend soon heard a huge commotion inside the hall,
followed by loud applause. The naked lady burst out through the door
surrounded by a cheering crowd. “What happened?” asked her waiting
friend. “Brilliant, I won first prize for Best Dried Arrangement.”
............................
A toddler who was found chewing on a slug.
After the initial surge of disgust the parent said,
“Well . . . What does it taste like?”
“Not as crunchy as snails,” was the reply.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

43

Take care of your feet...
Chilblains

Global warming is blamed for many worldwide disasters but
there has been one benefit as we have not had a really very
cold winter for over twenty years.
Chilblains (Erythema pernio) could be a thing of the past due to mild winters and better
living conditions, especially central heating. If we have a very cold spell now there will
be those who will wonder what this itchy red skin condition is on their legs and feet.

Keeping feet and legs warm with appropriate clothing is important. The best way to
keep warm is layers of clothing, ie two pairs of thin socks are better than one pair of
thick. I recommend thermal insoles for cold feet and for very cold weather fur lined
boots.

Chilblains are made worse by applying heat to the affected
area so keep feet away from the electric fire and hot water
bottles. If needed there are over the counter treatments
to ease the red itchy skin, eg iodine compounds such as
betadine, savlon spray, videne and ointments containing
methyl salicylate and many more. An old remedy for
chilblains was to soak the affected area with their piddle
(urine). This is not an old wives tale, it does actually work,
but there are creams containing manufactured urine (uric
acid) which are obviously far more pleasant to use!

Scratching the irritation will make the problem
a lot worse. Dirty fingernails could cause an
infection and broken chilblains could be the end
result which is a more serious problem requiring
medical help.

For chilblains sake let’s hope our winters remain
mild.

A H PARFITT CHIROPODIST / PODIATRIST
533-535 WIMBORNE ROAD
STATE REGISTERED WINTON BH9 2AP
HPC REGISTERED

Tel: 01202 528942

Please mention this magazine when responding to these adverts - Thank you

44

The Moordown Traders Association are an enthusiastic group of business
owners from the Moordown community who have come together to promote

local trade and raise the profile of Moordown as a shopping and business
destination, to support local traders and enhance local businesses.

We meet regularly, work voluntarily and liaise closely with the Bournemouth
Chamber of Trade & Commerce (BCTC), Bournemouth Council, elected

Members and local media to ensure that the Moordown trading district is
represented in a positive light.

The Moordown Traders Association meet monthly between 6pm-8pm
upstairs at the Moordown Conservative Club in Balfour Road.
All Moordown traders & businesses are welcome.

Come along, air your views and meet other local business people.
Drinks available at the bar and sandwiches are provided for the peckish.

Next meeting dates are:
Tuesday 16th February / Tuesday 15th March
For more information visit: www.more2moordown.com

Charminster Afternoon Townswomens Guild

Trinity URC Hall, Sutton Road - 2pm Tuesday 23rd February

Our guest speaker this month will be Miss Louise Jones talking about
The Louis mann Hospice
All ladies welcome.

Come and meet us and make new friends, and find new interests!
Further details from our secretary, Margaret, on 01202 512543

Husband of the year contestant #7

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

45

џᖙ㠵᫟͝భ႖⩏႖㔵㖄䄺ъ

Chinese Students & Scholars Association Bournemouth
Please mention this magazine when responding to these adverts - Thank you

46 Catering & events

www.adamandevesfood.webs.com
InCgaretdeireinntsg & events
30w0HgwDewarile.tdhaycdocauosm-ncsocauisenndceeveTsafsotyo&d.ewaseybc
fruit & nut muffinsHOGm48oano0oenrmeddleflvsumlbeulgoogoeinlfoit-ncafcgabhOploweleipvarspsettoeeOcdrkiwlincituchbhoeunsnekaBMsoorespitlm4I3hlnt0a8oho0g0sdrehmrgeewolvDdfbearigotiteeheeildneitrnatcagobos
Catering & Events

www.adamandevesfood.webs.com On20ing0ehgtthacihnriddckoc-ofpoaekajeasdrs.ooaf ksuend-dovrieerd-‘AfcluodfodfOGHkytoan.htoenheddlrefoosumltulhogoenhfor-’cf.coahOSi
[email protected] Idea2l0ly0,glecahvicek-aplel
g & eventosr call 07948 494024 for a quote herbbaSsederadvtOHnnoeioangsmtwehnihfatdtieytthfarohuoinresludmdlsoi,cpfocseenofcradehioapt
damandevesfood.webs.com tomatoes, snipped fresh
Handful of chopped
Ingredients Seasoning

Tasty30&0geDarsieydccoouuss--ccoouus s Seasoning

1112do1121111I1n//////rat1tect222242gssbsuo/gppt2ccccchrsaA‘fSaBIbMtpgseuuuuucdlhpcepubvneddoodpppppbweeesuravaauifpdoisredtavpelfnmmcwckheatnahkylfnhaesmtlgiaoiolrttGnOHOm4tH2Slhsiio.lhsnttoyeeuohmllllttse08siwteiedlkoielgnaapnngth,hheomitfea0egaa0wateoeerphlnnirerdpwbysetmsogeadooteddofshrhohltolalffuedttuaenhoffeallvwcessuovhuuamtgmalluiihgtbednonuirhexdeellatecridghopiduoggsceeroobereflrs,eia’klrntrleaff.oadcoososaietol--nennoSfccuatlfifpcnidvlg,ahiaoeelartbhpO-ednacoehpkprlowpahje.lsapgneeeaaipaeesveadperdsrrppdfdsestettal.eoooeeadaaasdOtafcedrvrblekkslsiafwooltuilrteanetoceurinhdetsugcscr-heohkblashdowinkoeouhitvrcniionsetneetiISbTfaMaA‘BeuFfeaS3FBMsBFtcdhlheirrkoewd,ngusioldestraoocbald6b-eeesaliousaesrgtlooakfalopdoireidxssrittdavn&klfar,truoemntwhksuyslcfhetedvliafok.iyextlnereso.naho9neyunheiBnwBegaPttswdwatggdtidgue111d11I2211orh,ilahhfadan&.fege//i//teafnkTtre1ttw2ko22g22sfrenfssa,cslnlbiger/.erhyprfmipcchdt2cwtyvee0tesigotusnuuu.nuoaoonjiOvpeedbdcoptrsdanhpp0btpauoadguueiaiVfritigneesrel2tutarcmepbckynvmecaLinFasntmahsl0oautslsfimvhikagillattnmtsoililset0ulgteolkmeagseoenltbaetgupitgui,hlneeeetgeflepcanhfspapnmrevhrnprorbtrafitesobeeogesrryeerhdoonueoesluwtdaed’2leer2tinvsrfnagda.ildsdderifis0oohaeeu0oarroalelnnicieb)itkrSninmotllnrssigaeftanrieecdsmacvl,oineelued,!utlnnfha-mnidpnocmpuacehnprovteueistietataedhasdul.nsgonedkksprseoa.na.esrp.ere.-use.dsmps-oYtrm5apid-fteatencirttalhwcrpcacreoeaediaoaeasurmesirooetlrsnlenuxsfaluvkrabtlersiuiuslu-ladinino.insotlljtnctsutgai(etodhsugsricahsohetesagnceobhcreaonattleklcnastewundhotinnfrtkoowdldritdeseecryonweihoertedwtifiaaucrl.t.l.anhrcaoFhsldscwoFl@dssscbo0atrbeaaeoemr7ncooafdfe9aoldoémaoaeqadntd4eikrnmeuyw8hodati&droinu4wairiwsenueg9nnhcbvimegrmfts4fdk.aeooin0rffdeekso&oi2aomrvifeninrnongP4ueeadtang2ogssvutsfbrii0codet.tastae1iorn.nknoweetnrf0faatedossefe.nqte.codb.ru..douo&dseot.o.ucrdtkoeerrmvLikseoee, nvrtaootenvrsriekogacelfhnioovetdupre.
Flaxseed is a source of Omega 3,6 & 9 and other antioxidants

us-cous

People are like Potatoes!
Some people never seem motivated to participate, but are content to
cubes.SPoomuer waoarvetecrahlcwooatuhyses-rclsoouo..ks. ianngdTtohecyauasree called “Speck Taters.”
add stock problems and really get under
psaerpaatreaategawinitThwhaeitrhfeoaarkrfe.goertLkhteoataysoroveouekuwrenfhsoedkoprtin5oacrom.de.uo.iasinnlcswgota.Tuo.yh.sseysaaWyrieengccaatllhlleetdhye“wmAigll“g,HibeeuzTtzasiteoemrTsae.t”herosw.”, they never
Some folks spent a lot of time sitting and staring at their belly buttons ...
nd all the otheTr hinegrereadrieenthtsosaendthmaTtihxtrelyyigtahortelmyc.aaxlilmedis“eMtehdeiirTactreorps.y”ields while reducing
e flavours to soak in overenxipgehnt.seYsou...canWe call them “Compu Taters.”
couSrogmeteteps,eoopr loelihvaevseannodamosta“hCnenormerms oorn class, they are simply known
getables like Taters”

. In showbusiness some performers like to mimic other people, as such we
know them as “Immy Taters”
heese or onAitssmoawllnn.umber have a first name of Richard, better known as “Dick Taters”

People with presenation and organisational skills are known in the world of
business as “Fassilly Taters”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

47
Please mention this magazine when responding to these adverts - Thank you

48

We are recruiting for friendly cheerful individuals to work as
Health Care Support Workers in the local community providing
care and support to people who wish to remain living in their

own homes.

What we O er

Full training.
Uniform and
equipment.
Excellent starting
rates of pay.
Enhanced pay for
weekends, evenings
and nights.

Mileage and travel
Allowance.
Support with learning
new skills.
Opportunities to progress
within Social Care.

We operate 24 hours a day providing round the clock care. We can therefore offer flexible
working shift patterns and hours from full time to part time.

If you think you have got what it takes, then contact us for an informal chat.

01202 737456 Poole Office. 01202 579624 Bournemouth Office
www.horizonhomecare.co.uk

E-mail: [email protected]

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com