The Local Eye - Issue 141 - July 17

The JULY
2017
Local EyeIssue

141 Advertising For Local Businesses, Trades
and Community Information...

Carpet Rugs Wood
Laminate Vinyl
Carpet Tiles
Luxury Vinyl Tiles
Commercial Flooring

Visit our new Karndean flooring showroom

01202 524052

www.cutwisecarpetsbournemouth.co.uk
39/41 Charminster Avenue, Bournemouth. BH9 1RR

LE July (44).indd 1 23/06/2017 12:48:31

2

D Learn To
A

N Dance Now
C

E

D Specialists in the following:
A
N *Ballroom

C *Latin

E *Junior Street
*Ballet & Modern
D *1st Wedding Dance
A
N *Adults

C *Juniors

E *Tiny Tots

D ANGLO DANCE STUDIOS
A 93a Chatsworth Road
N Bournemouth BH8 8SN
C Tel: 01202 514551
E www.anglodance.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 2 23/06/2017 12:48:32

3

Nu Staff are a family run business, we are local, reliable and dependable.
We have over 48 years of experience providing care in the community

Nu Staff believe continuity of care is extremely important, we recognise
how intrusive our job can be on the individuals for which we provide care.

All our staff are PROUD TO say they CARE being both
friendly and approachable.

We ensure our carer’s receive the best training and support to deliver
the care you rightly demand.

Nu Staff fully support Bournemouth Borough Councils
PROUD TO CARE initiative.

01202 292870

Our services include:

• Assistance with personal care
• Help with medication
• Meal preparation
• Light domestic duties
• Laundry
• Waking or sleeping nights
• Companionship and outings
• Respite sits

Visit times can range from 15 minutes right up to 24 hours a day
We provide care in the Bournemouth and Poole areas, if you or a loved one need
support please give us a call to discuss your requirements or we can arrange for a

member of the team to come and meet with you in your own home

www.nustaffimageplan.co.uk

602 Wimborne Road Winton Bournemouth BH9 2EN

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 3 23/06/2017 12:48:32

4
Welcome to the July issue of e Local Eye

is magazine is delivered free to an alternating selection of around
13,000 homes and businesses in Bournemouth, mainly through the
Charminster, Queens Park, Moordown, Ensbury Park, Redhill, Winton,

Muscliffe & Strouden Park districts.

It can also be picked up from:
e Bournemouth Life Centre in Moordown, Mike Stokes Tyres and

Johns Fish & Chips in Moordown, KwikFit Castle Lane,
e Hungry Wolf Cafe & AH Parfitt - Chiropodist/Podiatrist in Winton,

and Charminster & Winton libraries, Moordown Community Centre,
as well as several laundrettes in Charminster, Moordown & Winton.
More information on rates and ad copy submission as well as online
copies of the current and previous issues can be found on the website.

01202 255485 / 08000 430485
07801 474788

[email protected]
www.thelocaleye.com

Until next month..
Chris

The Moordown Traders Association are an enthusiastic group of business
owners from the Moordown community who have come together to promote

local trade and raise the profile of Moordown as a shopping and business
destination, to support local traders and enhance local businesses.

We meet regularly, work voluntarily and liaise closely with the Bournemouth
Chamber of Trade & Commerce (BCTC), Bournemouth Council, elected

Members and local media to ensure that the Moordown trading district is
represented in a positive light.

The Moordown Traders Association meet monthly between 6pm-8pm
upstairs at the Moordown Conservative Club in Balfour Road.

All Moordown traders & businesses are welcome.
Come along, air your views and meet other local business people.
Drinks available at the bar and sandwiches are provided for the peckish.

Next meeting date is:

Tuesday 18th July (No meeting in August)

For more information visit: www.more2moordown.com

Every effort has been made to ensure that the information contained within this publication was correct at the time of going to print. We
cannot be held responsible for any inaccuracies in advertisements, editorials or features nor for any consequences arising from these. We are
not to be held responsible for any errors, loss or damage to copy in printing. The Local Eye does not officially endorse any advertising material
included within this publication. It is the advertisers responsibility to ensure conformity with laws and/or acts relating to Trade Descriptions,
Sex Discrimination, Consumer Credit, Copyright etc. No part of this publication may be reproduced, stored in any retrieval systems or
transmitted in any form - electronic, mechanical, photocopying, recording or otherwise - without the prior permission of the publisher. The use
of this publication for canvassing, direct marketing or any other activity apart from sourcing local goods and services, is strictly prohibited.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 4 23/06/2017 12:48:32

5

LFB MEATS

01202 533997
www.lfbmeats.com

THE BBQ SEASON IS UPON US!

BBQ PACKS £3.99 each

Pork Ribs, Chicken, Burgers, Flavoured Sausages

MULTIPACK SPECIALS

3 FOR £10

MATCH ANY 3 BLACK LABELS FOR £10

Also available a wide
selection of flavoured

sausages...
Pork & Leek, HoneyRoast,

Merguez, Hot Chilli,
Old English, Romany, British

Banger, Black Pepper, Beef
& Beer, Alabama, Stilton &
Chive, Sun Dried Tomato,

Pork & Apple.

(*all subject to availability)

Frozen Fish Fillets...

7-8oz Cod Loin Fillet - £2.50
6-7oz Haddock Fillet - £2.20
6-7oz Salmon Fillet -

£4.00 or 2 for £7.50

349-351 CHARMINSTER ROAD, BOURNEMOUTH. BH8 9QR
(Opposite Esso garage, lower Charminster)

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 5 23/06/2017 12:48:32

6 Zoe Bellamy

WINTON WOOL SHOP BSc.Pod.Med - M.Inst. Ch.Pod

CARLY‛S CRAFTS Chiropodist / Podiatrist

Stockists of:- CHIROPODY
HOME VISITING
NORO ~ DEBBIE BLISS
PATONS ~ RICO SERVICE
IN YOUR AREA
STYLECRAFT ~ SIRDAR
ROWAN ~ KING COLE For total footcare please call

Large selection of Patterns, 01202 309932
Needles and Accessories
24 HOUR ANSWERING SERVICE
Shop 1, 1a Cardigan Road

(road opposite Poundland)

Winton BH9 1BJ

01202 512106
Delivery Service available

Disney Crafting Hour
at Charminster Library

Saturdays > Fornightly > 10-11am
Drop in sessions to make & take crafts based on Disney Characters

Contact the library for more information on dates and themes

Tel: 01202 510379 Email: [email protected]

Famous First Time...

Henry Sullivan 1923 -- 1st American to swim across the English Channel.
Gertrude Ederle - 1926 -- 1st American woman to swim the English Channel. It took her 14 hours and 39 minutes.

(She broke the existing men’s record.)
Ferenc Szisz - 1906 -- Winner of the 1st Grand Prix held at Le Mans, France. e Romanian driver drove a Renault
Craig Breedlove - 1998 -- 1st person to break the sound barrier in a car, at Lake Bonneville, UT, with a trap speed

of over 760 MPH.
Annie Taylor - 1901 -- 1st woman to go over Niagara Falls in a barrel. She was aged 64 years at the time.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 6 23/06/2017 12:48:33

7

GET AN

EXTRA

%
OFF

STOCK ITEMS

WITH THIS VOUCHER

L. EYE. Not to be used D THE COST WIT
in conjunction with
0%
any other offer
INTEREST
 SPREA H
SUBJECT TO CONDITIONS

CARPETS, FLOORING, • OPEN 7 DAYS
BEDS & BEDROOM FURNITURE • FREE ESTIMATES
• 100’S OF BIG BRANDS
PLUS!WE WILL BEAT ANY LIKE • HUGE RANGE OF MATTRESSES
FOR LIKE WRITTEN QUOTE! • 100’S OF RUGS
• DISPOSAL OF OLD FLOORING & BEDS

Nuffield Industrial Estate, btehed
Poole, BH17 0RR, Tel: 01202 723162 store

Ferndown Industrial Estate,
WIMBORNE BH21 7PE, Tel: 01202 872240

www.carpetsandbeds.com

Please mention this magPaozoilneN,euBfwHfi1eh7lde0nIRnRdr,ueTssetprl:ioa0l1nE2ds0ti2ant7ge2,3t1o62these adverts - Thank you

LE July (44).indd 7 Ferndown Industrial Estate, 23/06/2017 12:48:33
WIMBORNE BH21 7PE, Tel: 01202 872240

8

SUDOKU

How to Play

Fill in the grid so that every
row, every column,
and every 3x3 box
contains the digits
1 through 9,
with no repetition!

Simples!

You solve the puzzle with
reasoning and logic,

there’s no maths involved
and no adding up.
It’s challenging.
It’s addictive!
It’s fun.

(Solution on page 40)

THROOP FENCING
& DECKING

REGISTERED WASTE CARRIER
FULLY INSURED

Contact: TERRY

07866 540062

[email protected]
TWITTER.COM/THROOPFENCING

The African cicada fly spends up to 17 years sleeping, then wakes up for
two weeks, mates and then die. Hope the wait was worth it!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 8 23/06/2017 12:48:34

9

Garden Tidy Up
Hedge Cutting
Turfing
Lawn Treatment
Waste Recycled
Patio / Driveway Cleaning

For urgent jobs, one offs, or
regular fixed price service call:

01202 805 375

www.EdsGardenMaintenance.co.uk

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 9 23/06/2017 12:48:35

10 AVON

DING Would you like to earn extra to help with your
DONG! holiday or to clear some bills?
New Reps always required to sell AVON to family
and friends and work colleagues.
Call me to find out more – Dianne: 07816 933319
or visit my website: www.pamperpark.biz

Contact The Elderly - Volunteer Drivers & Afternoon Hosts Required

Once a month on a Sunday afternoon local elderly people, who are without family in the area, are taken out
by volunteer car drivers for a little ride before going to the homes of volunteer hosts and hostesses for Sunday
afternoon tea.
We only ask our volunteer hosts to entertain up to six elderly people and two
drivers or one driver with up to three elderly people once or twice a year.
A downstairs cloakroom is a must.
Reserve drivers are always wanted when the regulars are unavailable.
This would be possibly two or three times a year.

Elderly people who would like to take part in one of these afternoons are
welcome to join the group but must be able to get in and out of a car, as we are
unable to take zimmers or wheelchairs. There is no charge.

For more details phone Carolyn Dennis 01202 424482

Element: Woman Atomic Weight: Ask if you dare
Physical Properites: Generally round in form. Boils at nothing yet may also freeze
without warning but melts with proper attention. Can turn bitter if not looked after.
Chemical Properties: Highly unstable and active. May discolour to green when

placed next to a younger or better specimen. Has affinities to precious metals and
stones. Also brightens with silks and other expensive materials.

Usage: Highly ornamental. Very effective at reduction of income and wealth.
Caution: Volatile and likely to explode in inexperienced hands.

Element: Man Atomic Weight: Variable but unconcerned by it.
Physical Properties: Fairly dense. Solid at room temperature but gets bent out of

shape easily. Difficult to find a pure untarnished example.
Chemical Properties: Will attempt to bond with Woman element at any
opportunity. Can become hard to find when linked to Kid element. If located, may

explode but can be defused by application of alcohol.
Usages: None specific. Reliable source of methane though has a tendancy to exceed

demands. Will clear large amounts of food and drink at one sitting.
Caution: If left alone without association of Woman element may become smelly.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 10 23/06/2017 12:48:35

11

50% off available on selected lines only, 0% finance available on items over £600, subject to terms and conditions

OUR LONG AWAITED SUMMER

UPTO

BEDS | BEDDING|CARPETS&RUGS | SOFAS | CURTAINS | FURNITURE | COOKSHOP|GIFTS

OFFER FOR JULY ONLY! 3 Seater large sofa
(Fabric) Was £1215 (Aqua clean) Was £1275
THREE SEATER SOFA FOR THE PRICE OF A TWO SEATER!
NOW £835 NOW £875

2 seater small sofa
(Fabric) Was £1135 (Aqua clean) Was £1189

NOW £835 NOW £875

Chair
Fabric Was £825 (Aqua clean) Was £869

NOW £605 NOW £639

SALE NOW ON, DON’T MISS OUT! 0%

STURTONS & TAPPERS INTEREST FREE FINANCE
Winton - 426 Wimborne Rd, Bournemouth, Dorset, BH9 2EZ AVAILABLE
Tel: 01202 512345

Wimborne - 20 East Street, Wimborne, Dorset, BH21 1DT
Tel: 01202 883311

www.sturtons.co.uk FREE PARKING

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 11 23/06/2017 12:48:35

12

Derek J.Rolls

Independent Estate Agents & Valuers

Ask The Agent

Q. I’ve just had a valuation, and as it was being done, the agents asked if they could
bring someone round to view my home straight away, even though I haven’t formally
appointed them yet. Advice, please!
A. I totally understand that at first glance, this might sound like brilliant news.
However, there are a couple of issues you might want to consider first..
To start with, there’s the little matter of the law. This states quite unequivocally that
you must be in possession of a signed agency agreement (which in any case entitles
you to a 14 day cooling-off period), and the agent must have commissioned an Energy
Performance Certificate for your home (unless it is exempt), before any marketing an
take place. If either of these two things have not been done. then both the agent and
you are breaking the law. And by the way, don’t believe this agent if they try to claim
that a quick advance viewing doesn’t constitute marketing, because It does!

Now, of course, this might not overly bother you. But just think: when it comes to
selling what is almost certainly your single most valuable asset, do you really want to
use an agent who’s apparently prepared to break the law - even if it’s in return for a
reduced fee? In any case, besides these little legal niceties, there are a couple of very
practical points to consider. If you give this one buyer - who is clearly on some kind
of inside track with the agent - the huge advantage of seeing your home before anyone
else. how can you be sure that the price they offer is really the best you could get? It
is often said that the first offer is the best one. But this is more applicable in a market
where buyers are spoiled for choice. That is certainly not the case in the current market,
where there is not enough stock to meet demand. Consequently, the last thing you
should be doing is jumping at the first offer that comes along. Besides which, even if
you like the offer that this alleged buyer is prepared to make, how can you be sure that
they are actually in the best position to complete the purchase within your chosen time
frame?

So, my advice is to politely decline this kind offer. take your time in choosing a
professional agent who sticks to the rules, and let them do what they are actually
paid to do - which is to market your home properly to the widest possible number of
potential buyers, using all their skills and all the tools at their disposal!

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 12 23/06/2017 12:48:35

13

Derek J.Rolls

Independent Estate Agents & Valuers

NO SALE NO FEE. COMPETITITVE COMMISSION RATES

We believe that the housing market and prices are stronger than
ever so now is a great time to achieve the best price for your
property. Please call Derek or Martin on 01202 525778 or email
[email protected] for a free market valuation.

We have a combined 50 plus years of knowledge and experience
in selling homes in the area so truly do know what your property

should be worth in today’s market.

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 13 23/06/2017 12:48:35

14

“Bourne2Sing”
Male Voice Choir

Future Concerts are: (Fridays - Performances commence 7.30pm)

14th JULY ST MARK’S CHURCH, TALBOT WOODS

8th SEPTEMBER VERWOOD METHODIST CHURCH, VERWOOD

22nd SEPTEMBER SHELLEY THEATRE, BOURNEMOUTH

13th OCTOBER ST MARY’S CHURCH, FERNDOWN

17th NOVEMBER VICTORIA SCHOOL, POOLE

More information on Bourne2Sing and further Concerts can be found at:

www.bourne2singchoir.uk

Charminster Afternoon Townswomens Guild

Trinity URC Hall, Sutton Road - 2pm Tuesday 27th June

Come and meet us and make new friends, and find new interests!

Further details from our secretary,
Margaret, on 01202 512543

Redhill
Townswomens Guild

Hillview School, Hillview Road
7pm every 2nd & 4th Tuesday of each month.

We have a wide range of speakers and different social sections, choir,
craft group and a reading group.

This friendly group of ladies always welcome visitors and new members so
come along for a chat.

For more information please call: 01202 240815

Sarah was always late to work no matter how much she tried to be on time, or
how many times her boss scolded her. She just could not wake up on time. Her boss
said she would fire her if it did not stop. Sarah decided to seek the advice of her doctor.
He prescribed her some medication and told her to take one pill before going to sleep.
She did and she woke up before the alarm clock sounded and headed into work feeling
well rested. Sarah told her boss about the doctor’s prescription and how well it worked.

Her boss said, “That’s great, Sarah, but where were you yesterday?”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 14 23/06/2017 12:48:36

15

Isn’t there
something you’d
rather be doing with
your spare time?

Could you use some help with your Cleaning, Ironing or Both?

• Regular hourly rate only £11 - £12 per hour
• One off spring cleans available - call for price details
• Times and hours to suit you - (minimum 2 hours per week)
• Reliable, honest, professional service
• Insurance provided

Call 0800 0925 773
Email: [email protected]

You deserve a rest... So be served by the best

RR..JJ..HHuullll && CCoommppaannyy
AccountantsCertiAfiecd PcroacutisningtaAcncotusntants

312 Charminster Road, Tel: 533370

312For moreCthahnwa2wr5wmy.erjaihnrsuslwltaeechcraovRuenobtaaenedtns,.acTsose.iuslkt:in5g3b3us3in7e0ss

people in the Charminster and surrounding areas with :-

pF∗∗oeSProoapmlreltoenTreiernrasttdhhheaieprnCaa3chc0cacyoromeuuannirnttsssstweer ahnadvesu∗∗brTPeraaeoyxnurnRaodsellistnuisgrtniansrgeabsuswinitehs:s-

∗ Limited Company accounts ∗ Bookkeeping & VAT

FSaoslte, eTfrfaicdieernatcpceorusnotns al serviceTaatxaRffeotrudranbsle fees
 Partnership accounts  Payroll
iPnlcelausdeeePnqayuriLoreillma, bBiootueotdkokuCereocpominmgppaalnentdeyVmaAacnTca,goaelulmnceotnmst psearnvyBicroeetofuokrrnkLs,eimaenipnteiudnalgcoac&mcpoVaunAniteTss, to
and

management advice on a fixed or variable fee basis

Fast, efficient personal service at affordable fees

Please enquire about our complete management service for Limited companies to
include Payroll, Bookkeeping and VAT, all company returns, annual accounts, and
management advice on a fixed or variable fee basis

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 15 23/06/2017 12:48:36

16

VETERINARY CLINIC
144 Richmond Park Road
Bournemouth, BH8 8TW

Are you struggling with the costs of private vet care?
We offer affordable veterinary services for your pets

Consultations £15 Boosters from £22
Neutering from £30 for cats, £51 for dogs

You could be eligible if:
• Your household has a low income
• You are a pensioner
• You receive means tested benefits

For more information on how to register
Please call the clinic on 01202 526520
Monday – Friday 9.30am – 4pm

Registered Charity No. 205126

An 85-year-old man is having his Picture Box Pictu
annual check-up. The doctor asks him A simple test of say what you see? 1. Over
how he’s feeling. “I’ve never been better!” For example the first one below is? 2. Blue
Hitting below the belt of course! 3. A sti
he replies. “I’ve got an 18-year-old
bride who’s pregnant and having my child! (Answers on page 40) nine
4. Drai
What do you think about that?” Belt 5. Seco
The doctor considers this for a moment, Hitting 6. Was

then says, “Well, let me tell you a STAY
story. I knew a guy who was an avid
hunter. He never missed a season. 9
But one day he’s in a bit of a hurry and
he accidentally grabs his umbrella instead GUESS
of his gun. “So, he’s in the woods, GUESS
and suddenly a grizzly bear appears
in front of him! He raises up his umbrella,
points it at the bear, and squeezes

the handle.
The bear drops dead in front of him.”

That’s impossible!
Someone else must have shot that bear.”

“Exactly.” Said the Doctor

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 16 23/06/2017 12:48:36

20%cushOion 17

CUSHIONS REFILLEDHacluvoOesshtoyiomothunpershir? all lls
re

FROM THIS FOAM - FABRICS - SUNDRIES
TO THIS All aspects of upholstery undertaken
890 Wimborne Road, Moordown, BH9 2DR
01202 516949 : [email protected]

Polishing in the Bournemouth area for over 30
years!

- Removal of water and heat marks
- Colour matching
- Free collection and delivery service

Why buy new when you can have your old quality
furniture restored as good as new?

For a free quotation please call JIM PRICE

Tel: 01202 529910 Mobile: 07855 044732

16 Victoria Avenue, Winton, Bournemouth, BH9 2RN

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 17 23/06/2017 12:48:36

18

Legal Eye…… Employment Law

Legal Eye…… Employment Law

A look at some of the questions asked by members of the public regarding
tAhetlhoireoeikrmeapmtlopsoylommymeeneotnfrtetrhleaeltaioqtinousenhssihtpiiop.n. s asked by members of the public regarding

“I w“oI wrkoinrkaincaacrearheohmoem, eI a, Imamthteheonolynlpy epresorsnonononshsihftiftoovveernrnigighhttaaltlhthoouugghhIIaammaalllloowweedd ttoo sslleeeepp wwhheennIIaamm
notnbout sbyu,sbyu, bt uI ot Inolynrlyecreeciveeivae afixfeixdedamamouonutnot fomf moonneeyyfofor rththisisshshifitf.t.AAmmIIeennttiittlleedd ttoo tthhee Nationaall MMiinnimimuumm
WaWgeagfoerfnoirgnhigtshhtisfthsi?ft”s?”

PCoosPusoirbtsslsyitboylyesusy,eptshp,iosthratisrteahareeoafafoclaftwlathwisaftisanfsaitgschthctsahhnaifgntsigncignagannaadntdttrhathecertertehhheaavnveaebtbioeeneeannlamaninnuuimmmbubmeerrwooffarrgeeecc.eeInnt ttwddileel cdciiessiipoonensnsfdfrrooommnttthhheee
facCtsooufrtes atochsuipnpdoivritdtuhael fcaacstet,hbaut tniifgyhotsuhiaftrsecuannaabtlteratcotlethaevneatthioenparlemminisiemsudmurwinaggyeo. uItrwshillifdt;eitpies ndecoenssthaery

for fraecgtus loaftoeraycrheiansdoivnisdufoarl cyoauser ,ebmupt ilfoyyoeur atorehuanvaebale ptoelresoanveotnhethperepmreismesisdeusrianngdyothuer srehifits; ait nis naedceeqsusaartye
degforer eregouf lraetsopryonresiabsiloitnysdfuorrinygoutrheemnpiglohytsehrifttothheanveit ais ppeorsssoibnleonthtahteyporuemmiaseys baendenthtietleredistoanbeadpeaqiduathtee
natdioengarel emionfimreusmpownsaibgileitygdouinrigngfotrhweanrdigahtnsdhifpt othsseibnlyit fios rpsoosmsibeleofthtahet ynoiguhmtsahyiftbs ealreenatidtleydwtoorkbeed.paid the

“I hnaavteionbaelemnineimmupmloyweadgefogr ojuinstgofoverwr aardyeaanrd, mpoysseibmlypflooryseormheasodf tishmeisnsiegdhtsmhieftsbaulrtehaadsynwootrtkoeldd. me why.

Can they do this?”

“I have been employed for just over a year, my employer has dismissed me but has not told me why.
wThiethCifnairns1t4tihsdseuayeydstoootfhbyieos?ue”rsdtaisbmliisshsaeldtoisretoqufinedst out what the reason was for the dismissal. You have the right
reasons for your dismissal in writing. Once you know the reason

for dismissal, it is worth considering whether the dismissal was unfair. A claim for unfair dismissal normally

reqTuhierefsirtswt iossuyeeatros cboenetisntauboulisshseedrviiscteo, fhinodweouvet rw, hthaetrethearreeasosomnewcairscufomr stthaencdeisms wisshael.reYothuehlaavwecthoensriidgehtrs
dismwitshsainl 1o4f daanyesmofpyloyuer deiswmitishsaulntoderer qtwueostyreeaarso’ nses rfvoircyeotuor dbiesmuisnsfaaliirn. Fworritingst.aOncnec,eifyaoun kenmopwlothye ereraasiosens

an fiossrudeisambisosault, iht eisawltohrtahncdosnasfideetyriningtwhehewthoerkrpthlaecdeisamnisdsatlhweay saurenfadiirs.mAiscseladimasfoar urensfualitr,dthisemilsaswal snaoyrms tahlalyt
thisrewqouuirledsbtweoauyetoamrsactoicnatilnlyuuonusfasier.rvice, however, there are some circumstances where the law considers

“I sduifsfmeriswsaitlhofdaenpreemsspiolonyaenedwaithnxuientdyear ntwdofiynedairts’dsifefircvuicltettootbeell wunofrakirt.hFaotr Iincstaannncoet, aiftatennedm. Mployyeemepraloisyeesr
waannts itsosudeisacbipoluintehmeaelthfoar nthdis,sawfehatyt icnathneI dwoo?rk”place and they are dismissed as a result, the law says that

this would be automatically unfair.

If your condition affects your normal day to day activities, such as going to work, sleeping, concentrating,

sAyooccutw“i.rIaacsTliunhsoiftenfnsegttErroaqawcduniattidshucliattidhyplealdAinptuceratetimefspfseslei.aocMncftoeaiarssntnmhaydiosdp,arewuentohxtyhipaeoalttenyncseaamumnnfifdnIpeodrlfoirionn,y?gdteh”rweitsridtetohififsmdicaeaupplktreoetosrssesitbiaoeislnlliotwysntotarhurbkagletgthylaeaodtutojIuhcskataemvneeenponrigittnshatrtotesteguhnunedldlap.erMyrcotyohuneectmaEacqprrtluoywayoleiiuttrhyt

their employer. Employers will often implement their sickness reporting policies quite rigidly and employee

ofteIfnyosuufrfceor nwditithionnoapffaecytos ryoduisrcnipolrimnaarlydparyotcoedeadyinagcstiavsitiaesr,esusuclht. aHsogwoeinvgert,othwios riks,oslneeepairnega, cwohnecreenitrwatoinugld,
besroecaiasolisninagbalendtothmaat kaeffeacnt ias dmjuosrtemtheannt tmointhoar,tthreepreoirstiangpopsrsoibcileityduthreattyoohuehlpavteherigehmts pulnodyeerethaenEdqauavolitiyd
ldinisecAimcptlai.nnaTahryegesEarqnaucbatoliitouyntAsmcfoat rpkuilnangcaeausdtahjuodsrutismteyedonnatsbetsmheapntlcoaeyr.eerEssmutoitpamlobaylekeeeforsersabhsoootunhladpbadleristicaeuds.sjus swtmithentthsetoir HheRlpdeyopuacrtamrerynotuotr

your contractual duties. Many people suffering with depression struggle to keep in regular contact with

their employer. Employers will often implement their sickness reporting policies quite rigidly and employee

often suffer with no pay or disciplinary proceedings as a result. However, this is one area where it would

be reasonable to make an adjustment to that reporting procedure to help the employee and avoid

disciplinary sanctions for unauthorised absence. Employees should discuss with their HR department or

line manager about making adjustments that are suitable for both parties.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 18 23/06/2017 12:48:36

19

Expert Advice with a Friendly Face

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 19 23/06/2017 12:48:37

20

Hi,My name is Smokey and I am an 18 mth old Staffie.

I am very bouncy and playfull. I love my walks and also my
cuddles. I do get very excited. I will need an experienced

home. I would also benefit from attending training classes. If
you think you are the person or family for me, please contact

the office on the number below.
We also currently have lots of rabbits and guinea pigs

looking for their forever homes.

Waggy Tails has several events in the coming months. Please support us so we can
continue to help these animals. They all deserve our love and their forever home.
Are you a singer or Musician?.

Waggy Tails Rescue is holding a Variety Concert at Q. E. School Wimborne on 9th Sept.
We are looking for acts to appear to help raise much needed funds.
Please call us on 01202875000

For more information on Smokey or any of the other animals in our care please contact
us on 01202 875000, e-mail: [email protected]
or visit our website www.waggytails.org.uk

Waggy Tails Rescue is a registered charity based in Dorset; we rescue
and rehome dogs that have been abandoned, neglected or otherwise in need of a new

home.
We also find homes for other small furries that may be in our care. To find out more you

can contact us on the number above or send donations or letters to:

Waggy Tails Rescue, Helens House,
143 Magna Rd, Canford Magna
Wimborne, BH21 3AW

** These are not Waggy Tails animals, just very guilty ones!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 20 23/06/2017 12:48:37

21

Stephens

Carpentry & Building

Kitchen Fitting General Building
Renovations
Fitted Wardrobes
& Cupboards Bricklaying & Plastering
Patios
Door Hanging,
Architrave & Skirting General Maintenance

Fencing, Decking, Sheds

1st and 2nd Fix

No Job too Small • References Available • Fully Insured • Free Estimates

Brian Stephens

Tel: 01202 525 445 Mob: 07921 525 424
[email protected] www.stephensbuilding.co.uk

26 Green Road Bournemouth BH9 1EA

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 21 23/06/2017 12:48:37

22

DISCOMBOBULATED...

by your PC
or laptop?
Let us make
I•T•

Computer or Looking for a new Are you a business
Laptop problems? PC or Laptop? on a budget?

Local, knowledgeable and affordable. All backed up with fantastic service!

EZ Computers Repair Centre have nus OPENING TIMES
been operating in the Winton
area since the early 1990’s. national union of students Monday - Friday 9:00am - 7:00pm
Initially started as a retail store, Saturday 9:30am - 5:00pm
EZ Computers swiftly branched 10% DISCOUNT Sunday & Public Holidays CLOSED
out into offering repair services ON LABOUR FOR
to the local community on NUS MEMBERS
a NO FIX NO FEE basis.
EZ Computer Repair Centre
The current EZ team has over 80 years
of combined experience in technical 606 Wimborne Road • Winton • Bournemouth • BH9 2EN
support, repairs and servicing, and PC
sales. EZ Computers also offers online Tel: 01202 267267 & 01202 268268
gaming, internet access and printing Email: [email protected]
facilities. Whatever your computer
needs, our friendly and knowledgeable www.facebook.com/EzComputersRepairCentre/
staff will find the right solution for both
your situation and your budget.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 22 23/06/2017 12:48:37

ODfifsercsoFuonrt 23AsCpoedcet L.Eye

ASPECT

CONSTRUCTION

A Professional Approach To Building

Extensions
Loft Conversions
Conservatories

Alterations
Soffits & Fascias

Highly Competitive Prices

Local Bournemouth Company - Established 25 Years

Previous Projects Available To View
Meet Our Happy Customers

01202 381700 / 07525 805091

Call for a free no obligation quote

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 23 23/06/2017 12:48:38

24

Carpet
Before & After

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 24 23/06/2017 12:48:38

25

Imagine We have dry cleaned carpets &
upholstery in 100’s of homes

Dry Carpet Cleaning
“no soggy carpets or wet dog smell in your home”

We also clean... FREE+crFCloGreeloeaeemtnaSdYentroaoydeirundcfYrhoGl&eoaMuraulaganlrweidi/nnitlsglaRtsao2yionsrtsmdemour!

Upholstery Hard Floors with Anti Slip Coating Wooden Floors

Before After

Leather & Fabric Tiles inc Grout • Stone Sandless Wooden
Karndean & Amtico Floor Restoration
with super fast drying

Locally based family run business,
Call us for FREE on

0800 180 43 77
zerodrytime.com

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 25 23/06/2017 12:48:38

26

Travel Feature -
Britannia - weekend cruise from Southampton

By Mags Addison

flwiutetllleelketenongudcthhcroounifseecoaisfutbaioriwnllie-aeniktt moforursmtaobrjeuOaAnmctvtehhrose,dsnaeeutnvaldaouireetsiwckinthmdenrhleodaoasgeectt,frts.hrrtlsvothu–dat,opehTefitssorehaoiteCcytzephfhdblweseriuoeeiecuilegbfarrnaiwetssuegtnrefehkaifeldesneooetleiLrrennrrkaoceitetnggdeamnvs,ec,.nrnedabsroodpruwAwbiroaleiacuesnnatnwnrehsddycwuvats,tehiieehnonstaairheeetosnrynt,ekfeetradvoehadnraeoinaviefdetrafdfoserwiefcteyrleaathththrhtseyclaeeehdacearnisoritnlpmrfshetufeefasobiasaewasrdrrterleisthasteeneosoaestsnhnrnih.rysttoioiestip2nepwnaac.ia-rs.estr4.tmoeniAitfotnhodBclnesyyosautospoehnt,ys,,eahuhssatte’’raehvanreeeidnesrtltyo
mbROtoeieructberhetednivntaahlgyoyr,inpocselueoasslmtec,cebeiortfmcaowotmrialolpiesntaem.mogeapOuniletneusslrylhaickaanhedndousmeIsexwenicnaau2nsnt-ethtneewfidgoSehrtowotuucesttrhrraueeyilrslraneeosrwsfteareguiieclsiektoedtenodn.fdgrAtooencmtrdautrSoisosoogeuuencfttdeohhnraeatmrra,acpeovl!stauopprneile,cetiwayolhfloyicfnhairgseishaittissdwo.enaaBssl.uat
Ws-cepSaovroIiieneulchirvetn-aphe.rgvaniicseimoikenernnpgedtthlgoyaetunhirnrleaafe–arlaPsrfrco&eobrsOruym,inmse’seaeayenrnscdedelsceileeoftd,nhnftebfntseo,efprlwiasanringgacfdeosbghrfyiaoopsosoro,uedmBtdhprecoiaithnsafyoletnyihicn-sceceilaairesoulonlbifstuoesetl,ncesha.Sn,tuhgoiIsteuttehwtmchsaaraauasmfkinesaedpewstgidoatoosenfeodsiltdiusfif,nsfawaaehrtnahaiedouydngnncntseoe’o.t tpSiylnopoaeottarilhktirsnetatalghymotavfpohtrelneoiersramdthlle
TceebBdaforvnhrauulluetesoyleiogrrsntreyewdertgtsaaosehis.ini-adinnnsanmYgfgbadeoweynrahunrdeeafetqclr,lldasoa-ubaakonimxicnntyeikdgonsostgwhrvfitaasehinslsbeturiwprTtanuteoVitdchfeaorhtei.tospstebtbehhGoaereioossdocsnpfoatvoleponeudpdaavirsonaretelfgbiirlotnftyy.oyoogoftrBdwoftlithwhanohaeocnennlk.ddedabeamaoIconynyteeba,usneotraortdrsulirgopw,rc,hmsrecoapauaaenlainfstscvdheeefae,eatwrrdh,cyeoeilgnciwtkioaeeeosdn,qdtguinoaircndeBkave–retlegrtettoisuvuerBmfnnor.iurtnrggTPaeh&issnis.hOjowoAwuoansrnsdnaaetnhydefriinreteo
Br–taheleilvasaetnrhildseeinraishfmagaysiloonssolodued–wtthhaaebalntsuteettraanctihnrraupeteiiosvsxerhectsisuptasobeirrsefiflnlyoacgirrnroggtawheetwdoeseeendaeodkuaEaegunnyhrddso.tfpaouewlealasnocyfac–ipptyeat,hrtewthynaitht
AcHalalbpiinpnsyawlSl,eariitle’isncggo.omofdorvtaalbulee,, Saonudthwaemhpatdonaisgsroeactlotisme,e.the

Beach holidays, City breaks, Honeymoons, Weddings abroad, Adventure holidays, Ski,
Cruise, Tailormade trips, Flight only, Car hire, Airport hotels and parking and much more...

Contact Travel Counsellor

Mags Addison

018240520598017389102 Travel Counsellors ensures complete
financial protection on every booking
[email protected]
www.travelcounsellors.co.uk/margaret.addison

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 26 23/06/2017 12:48:39

27

BOURNEMOUTH FC - THE POPPIES
PARTY AT THE POPPIES

Club House Available For Hire

Large Car Park - Family Friendly
Drinks At Club Prices - Dance Floor

An Ideal Local Venue
For All Your Family Functions

For more information and details of our extremely
competitive rates please call us on

01202 515123 / 07887 477547
A warm welcome is always assured!
Victoria Park, Namu Road, Bournemouth BH9 2RA

VETERINARY CLINIC Dog Walkers
144 Richmond Park Road &
Bournemouth, BH8 8TW
Home Visitors
Are you on a low income? In The
Do you receive benefits?
Bournemouth Area
Are you a pensioner?
Tailored to you and your dogs needs, we
We offer affordable veterinary provide a bespoke dog walking and care
services for your pets service. For your peace of mind, we have
had years of experience with dogs and
Consultations only £15 are also fully insured.

01202 526520 Tel: 01202 468978
Mbl: 07775 905263
Mon-Fri 9.30am-4pm Email: [email protected]

Charity No. 205126 www.howlinggoodwalkies.uk

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 27 23/06/2017 12:48:40

28

Good Communication, Patience and Trust Can Reduce
Mountains To Molehills !

I recently treated a very nervous patient with severe phobia of injections. Although happy to
have dental examinations and treatment that did not need local anaesthetic they refused any
type of injection. Numerous hospital visits when younger had unfortunately overwhelmed my
patient with needle anxiety.
Dental treatment options were obviously restricted and therefore teeth that could be saved
were potentially having to be extracted under general anaesthetic instead, clearly not ideal !
However this bright person with a very supportive family decided not to bury their head in the
sand and to try and overcome the problem instead.

We had open and frank discussions about their phobia including details of their concern and we
set about finding a solution.
We used simple relaxation and distraction techniques together with numbing gel and
desensitisation procedures with the goal of being able to administer a local anaesthetic.
After a few visits, including various mock injection appointments, we succeeded and I am now
able to provide the normal range of dental treatments.
My patient has overcome a significant barrier and has put themselves in a much better position
for life as a result.

854 Wimborne Road, Moordown, Bournemouth, BH9 2DS

www.854dentalhealth.com 01202 512967

WANTED!!!

ELECTRICIANS, TATTOOISTS, FLORISTS,
BEAUTY SALONS, GARAGES, ROOFERS,
DRIVING INSTRUCTORS, TAXI FIRMS,
RESTAURANTS & BARS, ETC, ETC, ETC.

We are looking for more new trades & businesses
to advertise in this magazine.

Contact us now for more information.
Special discounts may be available for new bookings.

01202 255485 <> 08000 430485 <> 07801 474788
[email protected] <> www.thelocaleye.com

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 28 23/06/2017 12:48:40

29

854 Dental Health

Professional, Friendly, Effective
Private Dentistry

01202 512967

Do you wish you had nicer or trouble free teeth ?
It is never too late to get help.
If you have dental problems and have been putting
off a visit, why not call us or pop in for a chat.
Modern dentistry can work wonders.

RICHARD J HULL B.D.S & ANGELOS SIDERIS Dip.D.S.

854 Wimborne Road, Moordown, Bournemouth, BH9 2DS
www.854dentalhealth.com [email protected]

Established 1972

Ply, MDF, Pegboard
Hardboard, Chipboard
No need to buy a full sheet Timber & Sheet Material
Cut to your requirements Large selection of Offcuts

Architectural Over 2000 items of Plastic
Mouldings Hardware & Tracking
DIY Products

Timber, Floorboards, Skirting, Dado & Architraves
Machined to your specific size and profile

Small items of Purpose Made Joinery undertaken

936 Wimborne Road, Moordown, Bournemouth. BH9 2DH
Tel: 01202 516225 <> www.builtindiy.co.uk
Email: [email protected]

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 29 23/06/2017 12:48:40

30

Brain Power

1: It was the Super Hero charity fun run, but in all the excitement the camera
at the finishing line was not switched on, however the following information
was gathered from people watching on the road side.

Can you work out the finishing order?

Superman lost to Batman. Batman beat Superman, The Hulk and Cat Woman.
The Invisible Woman lost to The Thing, Superman and Wonder Woman. The
Hulk beat Iron Man, Wonder Woman and Superman. Wolverine lost to Wonder
Woman, Spiderman and Cat Woman. Wonder Woman beat Wolverine and The
Invisible Woman. Cat Woman lost to Batman and Superman. Spiderman lost to
Cat Woman and The Hulk. The Hulk beat The Invisible Woman, The Thing and
Wonder Woman. Wonder Woman lost to The Hulk, Spiderman and Cat Woman.
Wolverine beat The Invisible Woman and Iron Man. The Thing lost to Iron Man
and Superman. Iron Man lost to Cat Woman and Wonder Woman.

2: How many
squares and
how many
triangles?

3: What number is next in this sequence? 0 3 8 15 24 35 48 63 ?

4: A love-struck young lad has been saving coins to buy the girl of his dreams a
card and flowers for the Prom. Totting up the money he has £25.80 made up of four
different types of coins and coincidentally there are the same quantity of each coin,
the largest denomination of them being £1.
How many of each coin is there and what are the denominations?

Answers on page 40

Language has its problems.....
Honda launched a new car named the Fitta in Scandinavia but then found out the

name was slang for vagina in Norwegian, Swedish & Danish!
Mazda didnt fare much better when they launched a car called the Laputa. It turned
out that ‘puta’ was Spanish for prostitute. e promotional slogan took on a whole
new meaning when it said the Laputa delivered maximum utility in a minimum space

while providing a smooth comfortable ride.
e Kentucky Fried Chicken slogan ‘Finger-lickin-good’ was translated in China as

‘Eat Your Fingers Off ’
Italy produced a mineral water called Traficante.. Spanish for drug dealer!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 30 23/06/2017 12:48:40

31

Take care of your feet... Wearing sandals

Summer is here and we have cast off our winter shoes
and are into sandals again. Will last years sandals do
another season or do they look rather tired and worn?
Perhaps a trip to buy some new cool sandals is in order.
Choose a shoe shop that has trained staff who
understand shoe fitting to get the correct style and size
for your feet. Remember not to wear them out f the
shop, but to take them home and wear them indoors to
ensure they are comfortable and a good fit. Most stores
will allow you to exchange footwear if it has only been
worn indoors, but it is best to always check when purchasing.

The style of sandals is obviously a personal choice, but there
are features that can make a difference. If they are to be worn
for long periods then they should have a closed in back to
prevent calluses forming, and splits in the heels which can
be very painful.
The worst style for your feet is the wooden soled sandal that
only has a strap across the fore foot to keep it on, and the
wearer has to ‘claw’ their toes to keep them on.

The golden mule is the more closed in type of sandal, giving more support to your feet
which means at the end of the day you are less likely to have tired, aching feet. Sandals
provide ventilation helping to reduce perspiration and odour and make the feet feel more
comfortable.

Cotton socks, which are more absorbent than man-made materials, make all footwear
more comfortable by reducing rubbing and friction. Thank goodness wearing ‘trainer’
socks in sandals is not such a taboo anymore.

Foot Facts.
1. Each foot produces on average an egg cup full of
perspiration every day
2. 70% of foot problems are a direct result of ill fitting shoes
3. Leonardo da Vinci was absolutely spot on when he

described the foot as a masterpiece of engineering.

A H PARFITT CHIROPODIST / PODIATRIST
533-535 WIMBORNE ROAD
STATE REGISTERED WINTON BH9 2AP
HPC REGISTERED

Tel: 01202 528942

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 31 23/06/2017 12:48:41

32

Skittle Players/
Teams needed

for the 2017/18 season

At
Bournemouth Electric Sports & Family Club
Broadway Park,
Broadway Lane,
Bournemouth.
BH8 0AA

If you fancy playing please contact:-

Judy - 07743 473710
or Mike - 0077885500 333355774466

Two good ol’ redneck cowboys bought a couple of horses that they
used to make some money during the summer. But when winter came, they
found it cost too much to stable them. So they turned the horses loose in a
pasture where there was pleanty to eat. ‘How will we tell yours from mine

when we pick them up?’ one of them asked the other. ‘Easy,’ replied the
other. ‘We’ll cut the mane off mine and the tail off yours.’

By spring, of course the mane and tail had grown back to normal length.
‘Now what are we going to do?’ asked the first. His pardna said..

‘Why don’t you just take the black one?’ ‘And I’ll take the white one.’

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 32 23/06/2017 12:48:41

33

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 33 23/06/2017 12:48:41

34

Pilates

Fridays 7.00pm to 8.00pm
Beginners to Improvers Welcome Moordown Community Centre

Coronation Avenue, BH9 1TW

Jan: 01202 391468

Mount Pleasant Townswomens Afternoon Guild

We meet in the Bradpole Road Community Centre at 2pm on the 1st Wednesday of every
month for a social afternoon, when we have different activities including a speaker, and

we welcome visitors who we hope may join us and become members of TG.

Our other activities include Trampers & Eaters (when we visit nearby places of interest
and end up with lunch), skittles, a music afternoon (all sorts) and a Social Studies
afternoon when we reminisce and discuss any current subjects of interest.

EnPaLS supports Ensbury Park Library and is busy fund raising to provide better
community facilities at your library.
Our next event is Friday 14th July @7.00pm with live entertainment in from the
Live 45s Ukelele Band followed by a Ploughman’s Supper.
All for only £5 >> tickets on sale at the library.

Why not come along for a family evening and support your community library ?
If you are on-line follow the EnPaLS Facebook for all the latest news and forthcoming
events and dates of the monthly open meetings .

Pop in the library every Friday afternoon for
tea and biscuits and meet the regulars
or Thursday mornings for the
Parent & Toddler sessions.
You will receive a warm welcome.

01202 536397

31 Columbia Rd, Bournemouth BH10 4DZ

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 34 23/06/2017 12:48:42

35

RELEASSEoroptimists Poole
Urge GPs twitter - @SoroptPoole
To Ask The
Question! facebook - Soroptimist International Poole
Linkedin - Soroptimist International Poole

Email - [email protected]

Soroptimist International of Poole (SI Poole) welcomed Rhianon Greenslade of Safer

SoroptPiomoleisPatrstneursrhgipeat GthePirsJunteomAeestinkg atththee SQaluterenssHtiootenl in! Poole to hear about her

latest initiative, the IRIS Project. (www.poole.gov.uk/IRIS).
IRIS stands for Identification and Referral to Improve Safety and is a GP based domestic
violence and abuse programme. It is taking place only in Poole and started a year ago.
It has secured funding for three more years.

nternational of Poole (SI Poole) welcomed Rhianon Greenslade of Safer
es,hthipeaIRt tIhSePirRhseroJhormviujaieennc?ceoe”tsn.maTe(nxwhedpiewslaatgwiiknniev.egpyedsooahtobthojletweehcp.et8gai0vtoSi%eevani.soutltftpkeowe/rIrenoRmnsmcIiSsoeHsun)ioro.iantngetealosivnttiaaolfPklfeotnaobtoaorleesukltattttohhioeehnirqsehucaieiprrsctsauioembenoks“tIuahstneeclhvpeeesfr.rryotmhinhgeaolkthat
or IdentificaHptoiooowrneqvuaeanrl,idtiyf Rvreiecstpfiemonrsrsaed,oldtduoiescItmlooslpaecrakobovufseetrStaoiantfihneegti.ryIGnaPnp,adtrhteinsreerasishGiepvPwidbietnhacspeeraodcftadicnoeimtneaeapmsptsrio,cpanriaItReI,S
abuse prograadmvomcaete. wiIltl issuptapkorint pgrapcltaicceestoanffl,yinicnluPdoinoglerecaenpdtiosntiastrst,esdo atheyyeparrovaigdoe.inIftormation
unding for tahnrdeesumppoortefoyrepaartsie.nts experiencing domestic abuse.

ained hoobjwec8tASbi0evIn%iePonogtihoosielnfretowamagopaerojmneoserciedtosinoitudoniernstaotuogapleepthvaoesvirottepalRerifomhfnjiemttaocnreteodainslisaagatkteinivoldtyihnnhiesgfehrtiqhnitpueeforaeesrmsmeitseaaiodstkinaomnh“nugIesacelbhrpe.oavufsretothrhmyoetwyhhcitneoangablaetonhskdafateotautrhgoemtheeiarnd
a key

gives the paGtPiesnutrgpeerirems tiossigonnutpottoatlhkeainbiotiauttivteh.eir circumstances.

ctims do disScolroospetimaibstussweotroldwthideeiraGrePw,otrhkeinrgetoisraeivseidaewnacreeneosfsaonf dinomapesptircoapbruiasete. S, IpPoooorle has
nse, due to lsaucpkpoortfetdrathine ilnogca.lIRnepfuagretnfoerrsmhainpywyeitahrsp. ractice teams, an IRIS

support praActbicoeutstSaofrf,oipntcimluidsitnIgnrteercneapttiioonnaisltosf, Psoootlhee: y provide information and
atients expeSrioernocptinimgisdt oInmteernsatticionaabluosf eP.oole is the local branch of Soroptimist International, a

global volunteer movement with over 80,000 club members in 127 countries. Its primary

sritsioidnetotolethaevaaineinpmtderimoriinnsjaemttetocireotnindmaiastiiplaogrltneoeivavvlleyeinlotigtrhfhgeataihntlniefeivsodreareustmicooiasfnateswtd,iaooaenmnmndegpabnoeybwaror.neuudrntanghniinrdolgswecgnalatomobblpeabaloeliygpnspbsoayraftletuoanbaiblttoyiechisnaoglf,mognroaewtviaeoormnnnadmelnaenanndtsd girls.
ed to suppoLlorotccaRallhclyoiamSnomorounpnitatimyn.disthIentretrenaatmionaalsPmooulechimapslemtheenytscparonjeacntsdfotrothuergbeetttehrmeiernGt oPf our
ign up to the initiative.

worldwide are For more information about SI Poole has
local Refuge fwoorrmkianngytoyeraairssCe. oanwtaarecnte:sHs eolfednomoens0tic12ab0u2se8.4S2I7P9o5ole
email [email protected] www.sigbi.org/poole

Please mention this magazine when responding to these adverts - Thank you

END.//

LE July (44).indd 35 23/06/2017 12:48:42

36

Project Indigo

One boy’s adventure through time and space!

Hi, I’m Tom, a local Doctor Who blogger & I write about my adventures online at
anadventurethroughtimeandspace.com

Project Indigo is my special blog where I travel the world
(mainly the UK!) visiting places associated with Doctor Who.
Today we are travelling through time and space to
Cambridgeshire. We are visiting Classic Doctor Who filming
location Grantchester where The Fourth Doctor and Romana 2
materialised the TARDIS in the episode Shada (filmed 1979,
released 1992). You may notice that there were quite a few
years between the filming and the release. That is because
there was a big BBC Union strike when Shada was being
filmed which left many scenes of the episode unfinished. It
was eventually released on video in 1992 with Tom Baker narrating what was going on in
the gaps!
Grantchester is a village just outside Cambridge and is said to have the highest
concentration per person of Nobel Prize Winners! This is due to the number of residents
who went to or worked at Cambridge University. In Shada, the Doctor and Romana were
at Cambridge University to visit Professor Chronotis, a retired Time Lord. Whilst they were
there an alien called Skagra called upon the Professor to interrogate him and find the
whereabouts of the lost planet of Shada. It was in Grantchester Meadows that Skagra
concealed a 100m long invisible spaceship and captured Romana, K9 and a student, Chris
Parsons.
When I visited it was very early in the morning and the village was like a ghost town so
sadly I didn’t see any aliens like Skagra. On the High Street I saw The Green Man pub
and its neighbour The Red Lion which Skagra drove past. I explored the village and the
meadows which are just behind the village on the banks of the River Cam. This area was
the inspiration for the Pink Floyd song Grantchester Meadows on the album Ummagumma.
The music reflects how calm and soothing it is to be by the river.
Grantchester is also the setting and filming location for the ITV Series Grantchester. This
is based on the book series The Grantchester Mysteries by James Runcie featuring Sidney
Chambers, a vicar who is also a detective. James Norton plays Sidney, Robson Green plays

Geordie and Morven Christie plays Amanda. Two of the main
stars of Grantchester have also been in Doctor Who - both
in underwater episodes. Isn’t that a coincidence? James
Norton played Onegin a Russian Soldier on the submarine
The Firebird in the episode Cold War (2013) and Morvern
Christie played O’Donnell in Under the Lake (2015) set on
The Drum, an underwater mining base.
I hope you have enjoyed reading about Grantchester, if you
would like to read about other Doctor Who locations I have
visited please check out my blog. Goodbye!

Tom Project Indigo -- anadventurethroughtimeandspace.com

A Boeing 747 had an exceedingly long roll out after
landing when his approach speed was just a little too fast at
Heathrow. The air traffic controller radioed the pilot, “American 751,
please turn right at end of runway. If not able, take the M25 south to
the next junction and return to airport at your convenience.”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 36 23/06/2017 12:48:42

37

Dorset Driver Gold (DDG) at SafeWise Bournemouth

SafeWise road safety initiative dates for publication

Driving skills and confidence sessions helping people aged 65+ drive

safely for longer. The theory session costs just £10 per person and

Dorset DriverlGasotlsdu(pDDtoG3) ahtoSuarsfe, WbreisaeksBoaundrnreemfroesuhtmh eanntds SaarefeiWncilsuedWede–ymthoeuntehxt
Driving skills andtchoenofirdyendcaetseesssairoenslihsetlepdingbepleoowpl:e aged 65+ drive safely for
longer. The theor•y session coSstasfjeuWst £is1e0 Bpeoruprenrseomnoaundthlasts up to 3 houTrsu, bersedaakys a1nsdt August – 1.30pm

refreshments are• included – tShaefneeWxtitsheeBoroyudranteesmaroeultishted below: Monday 2nd October – 1.30pm

• SafeWis•e WeymouthSafeWise BoMuronnedmayo1u5tthh May – 10am Thursday 7th December – 1.30pm

• SafeWisTe hBoeuprnraemctoicuathl session coMsotsnd£a4y55tpheJrunpee–rs1o.3n0apnmd lasts up to 90 minutes. Once your booking form

• SafeWisaenWdepymayomutehnt have beenMroencdeaiyv1e0dthyoJuulyw– i1l0labme given details to arrange your drive directly with one
• SafeWisoefBoouurrnDemoorusteht Driver GTouldesAdapyp1rsot vAeudguDstr–iv1i.3n0gpmInstructors (ADIs).
• SafeWisIefWyeoyumtoaukteh up a practicTauleasndadyt1h2etohrSyepsteesmsiboenr –th1e.30cpomst is just £50
• SafeWise Bournemouth Monday 2nd October – 1.30pm

• SafeWisFe oWremymooruethinformation pTlueeassdeayv1is4itthtNhoevDemobresre–t D10raimver Gold webpage
• SafeWis(esBaofeuwrniesmeo.ourtgh/dorset-drTivhuerrs-dgaoyld7t/h) Doercceomnbtearc–t 1th.3e0pDmDG Administrator on [email protected] ,

The practical sesrsiionngcoorsttse£x4t50p7e7r 1pe3rs4o9n9an7d7l7as(tws uepwtoil9l0cmailnluytoesu. Obnacceky)our booking form and payment have been received
you will be givenodretlaeialsvteo aarrmanegsesaygoueradtriSveafdeirWectilsyewhitehaodnoefofficoeuroDno0rs1e2t D0r2iv5er9G1o3l3d0A.pproved Driving Instructors (ADIs).

If you take up a practical and theory session the cost is just £50

AoFofdfrmicmeinooirsnetr0ian1tf2oo0rr2mon5aLhL9tdai1iidofp3fegnp3eD@0peD.lnrseiaarvafseeinevwdivseisihseditot.eohwtrshgeiegt,ooDnrrioeanyrdgvseootstoiredDtrseretixshvdteieu0orm7cGn7e,o1sdla3dcea4wcv9tiee9dblSeo7p7napa7tgifsne(ewgb(WseytahwfhieeisewlilerlicpssaeiBkln.loigyolrolgusyu/odrabounanrndcsekeg)emte-oxdrrprodlieevurreaiivrvte-ehegnroacsledmt/owe)souistranhcgdoefenrarteatsetcSatapntfohedsWetwD-istDheeGyshtectaohdleloisriyons

and practical sessions.

LifeDrive theoTryhisseFssRioEnEs sacthSeamfeeWisisoepBenoutornaelml yoouutnhg–pveaorpioleuasgdeadtebsetween 17 and 25 who live in Dorset and
LifeDrive is desighnaedvetopraesdsuecde atchceidirendtrsibvyinhgelpteinsgt ywouitnhgienr tdhrievepras stot fuonudrerysteaanrds.why collisions happen and how to avoid them,
developing their AskiFllsRaEndEe£xp5e0riAenmceawziothnfvreoeupcohset-rteisstgthiveoerny taondepvrearcytiocanlesetshsaiotncso. TmhpislFeRteEEs stchheemcoeuisrsoep!en to all young

people aged betwTeheen n17exatndL2if5ewDhroivlievediantDesorasreet:and have passed their driving test within the past four years.

A FREE £50 Amaz•o n voucherTisugeivsednayto1e9vethryoSneepttheamt cboemr p2l0et1e7s the course! The next LifeDrive dates are:
• Tuesday•1 9th SeptemWbeedr n20e1s7day 18th October 2017
• Wednes•d ay 18th OcTtohbuerrs2d0a1y7 23rd November 2017
• TThhuurrssddaa•yy 72t3hrdDNecoevmeTmbhebrue2rrs02d107a1y7 7th December 2017
•

For more informaFtoiornm, looorkeaitnofourrmLifaetDiorinve, lpoaogke (asat foeuwrisLe.iofregD/erdivuceaptiaogn/eli(fes-adfreivwe/is)e.org/education/life-drive/)

ScootWise, MSobcioliotytWScoiostee,rMTraoinbiinlgitayt SSacfoeWotieserBToruarnineminogutaht–S2a1sfteJWuniese20B17ournemouth –

SafeWise are worSkainfgeWin pisaertnaerershwipowrkitihntgheinDoprasrettnCelrinsihcaipl CwomitmhitshsieonDinogrGsreotuCp ltiondicealivleCr osamfemtyiaswsiaorenninesgs Gcoruorsueps ftoor dmeolbivilietyr
scooter users in Dsoarfseetty. Tahweaseressnioensssacroeudresseigsnfeodrfomr tohboisleitaylrsecadoyoutesirnug saemrsobinilitDy oscrosoette.rTohr ethsoesesstihoant saraerleoodkeinsgigtonebduyfaor those
mobility scooter.aTlhreasdesysiuonssincgosat £m10opbeilriptyerscoon.oAtellrseosrsitohnossmeutshtabteaprree-lbooookeindgdutoe tbouliymaitemd oplbaicleistyavsaciloaobltee.rT.hTehneexstessions
ScootWise datescaores:t £10 per person. All sessions must be pre-booked due to limited places available.

• WednesTdahye2n1estxJtuSneco–o1t0W30ihsres tdoa1te3s00ahrres:
• Wednes•d ay 9th AugWuste–dn10e3sd0harys t9oth13A00uhgrus st – 1030hrs to 1300hrs
• Friday 1•3 th October –Fr1i0d3a0yhr1s 3toth13O00chtorsber – 1030hrs to 1300hrs

For more informa(Ftsiooarnf,emiwnocilrsueed.iionnrgfgob/roemodkuainctigaotinino,sntirn/uscccltouioodntiswnpgilesbaeos/)eolkoionkgatinosutrrSuccotoiotWnsiseplpeaagsee(slaofoekwiaste.oourgr/SedcuocoattWioni/ssecopoatgweise/)

Bikeability at SafeWise Weymouth – 27th May & 2nd June

Take CYCLING seriously:Adodn’trmuinss koutsotnaBgikgeeabrilsityi!nHotwo‘aawCesoamteh‘ wooluilcd itCbehifuyroucrhch,iled ncotueldrlesaran acboount bfaesiscsbiikoenal
maintenance, road sbbayfeovteyon,tstuihgrinn,aglsloiniugttsaonngddtoemottahwnehorneoiusavbdrasiunstguttrserksoinlualsntydinisionagnnntahomebtasuhazifnteigntytohgcuet.endtTordoehr?rreWuoahnPdatskr’asifemjetuoysrscteet,ncatslorleioutfasntghdtihsThfHsoeEraNrFRepfEue.Et!wthetsikmills tehseyt’voe
learnt into practice

For more information, incFludiinngabloloyk,intghinestrPucrtiioenss tplepasoeulonokdast otuhr Brikeeeabtiliitmy paegse (osanfewthisee.orwg/aedlulc.aTtiohne/bidkeraubilnityk/)
*Places are allocatemd ounma ‘fbirsltecosm, e“,Afirsitnse’trvendo’ bausiss.eThke dnaoy ycokuricnhi’,ldtihs aellorceat’sednwoill bpe adeppeenrdeontnontahgei/sabsiliitdy aendeither.”

numbers.

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 37 23/06/2017 12:48:42

38

There is no beating the taste of truly fresh
fruit and veg especially, when it’s yours!
Gardening Tips for July

July, this is the height of Summer.
You too should be enjoying the view of your labours over the previous
months. The flower garden blooming, all the vegetables developing and
everywhere should be green and lush. You might have some Courgettes
to harvest, do it whilst they are small do not wait until they become as
big as Marrows. In the fruit garden your Summer Raspberries should
be loaded, currents Red, Black and the less popular White ones will all
be ready for picking. Eat them fresh or make Jam & jelly for a taste of
Summer on your toast in Winter.
Keep your eye on Clematis do not let it wilt. Use rainwater for any watering if you can. Do it in the
evening and do not let pots, baskets and indoor plants dry out. Look after your pond if you have one
and keep clear of blanket weed. Take a walk along your perennial flowering border and remove any
deadheads. This will encourage new flowering and extend the colour and your pleasure throughout the
summer. Time to cut your Dahlias and enjoy a full vase indoors every week if you can. If you have pots
of Geraniums (my favourite pot flower) they should be providing a glorious show of Crimson, Pinks,
Salmon and combinations to provide a sense of the balmy Mediterranean climate.

Gardening Tips for August

Well here we are again in August. If you are going on holiday, do remember to make arrangements to
keep your plants watered. We could have the Sun here too whilst you are away. Before going away
gather up your outdoor pots together in a shady area, make sure your plants are well watered, by using
an automatic watering system or by asking a friendly neighbour. Keep feeding plants with a quick acting
fertilizer like Growmore or Phostrogen to keep them producing.

Greenhouse.

If you have not done so already pinch out the tops of Tomato plants once they have 4 sets of trusses to
prevent them from growing too tall and will improve quality of the harvest.

Fruit garden.

Prune cordon and espalier apples <> Water trees if need be, especially young plants less than 3 years.
Cover ripening fruit to protect from bird damage.
Pot up any rooted runners from Strawberries clearing away any dead leaves.

Flower garden.

Stake and tie plantss.<> Pinch out the tops of Chrysanthemums <> Water and feed sweet peas
Take cuttings <> Re-pot pot plants if required.

Annual Summer Show.

You are warmly invited to visit our allotments

Saturday 5th. August - 11am to 3pm

All are welcome to see the best of our fare.
We will have Flowers, Fruit & Veg show.
Stalls, Ploughman’s lunches, Teas, Cakes, Entertainment
and a scale model Traction Engine offering rides.

North Bournemouth Allotment Society, Cornelia Road, BH10 4FG
www.northbournemouthallotmentsociety.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 38 23/06/2017 12:48:42

Beastly Business 39

123 456 7 Prize Crossword

89

10

11 12

13

14 15

16 17

18 19 20

21 22

23 24

26 25 Win a box of locally grown
27 seasonal vegetables
28 courtesy of
© Chett - June 17 29 North Bournemouth
Allotment Society

Across Across Down Down

1. Imitators crib from cool dudes (8) 1. Agreement made to a western pussy foot

Across 5. Joey is ordered to depart from the1.bAogarteem(e3n,t3m) ade to a western pussy
(3,3) foot (3,3) 2. Possibly capture a prowler if I look for the

1. Imitators c8r.iFbofuronmd incotohledsutdateison(8c)olt mixes w2it.hPossiblycocyaoptteu(r1e1a)prowler if I look
5. Joey is ordseormeed rtaobdbeitpsa(r1t 1fr)om the boat for the coy3o.tMe y(1th1i)cal beast who could be king in the
(3,3) 10. Young Phillip brings in a glass co3n. tMaiyntehricalal nbdeaosfttwhehoblcinodul(d7)be king in
lf(8111re5aa301.as)b...FttbheEYCoireuotnrsruu(nq7(en(du)81lgi)1irwneP)aht1g1111(lpwyeh5iao34617lhaet)lt.....itofehpIERCShasttetnhseer(ub’anut3slrqeslretec)rsu(iiabrlnooi8ifaar(nudwag)enc7rsmrakca)awvyiogigntolhlhyetttfeoaeeohmrtreahlfgaeoinctelvxaahricreenrseossfngssumaheowmrcdoramaoiorlitognllsgehyffeefittsashnrotaoioaaocnlfgmcohvtetionehnre(geg7so)cmdmat4W5769bohane.....geonealCWCIHlonsltsl(hooodoais3trtsohfntho)rterpodeloulucfuocoo(tsn5tts4W569t71ufeaioo)e.....2odntoluh(nIWCHC.mlodu3onneWhou(o)pdiotsdo5rotsbobhmetrhne)ieptrlenoobdiuhecnbtfouuecnoehtt(ondsthtau3teaaeaieadelon,r(tr47rme(ouknddcey)3)urpihaotoi)tsbllosmihianlctnerpeabkeetbtstfehnegtorhternretoaaaeaaermcwrthwterckdyhehooeliMaetesuinldhcrasniscrkeespb(eeeet8ssygtfhne()rrr7leoaaehw)wmrtoghloueeMensrniescs(eets8(ha7h)e)obrnelilss
14. Russian 1v8ot.eGfroinrdsmupalal mfinecahl t(o7)make from grhaoinrn(7is) sopurneddeadto(r3,(46),5)
16. It's a dra2g1f.oHr othrseehleosrssetraanlosnpgorctasnpaulllpeadthby 2132. We hea1l5.kCrillelaanttoauctkethdebbyulgasrgferosmeaessence of life in
(3) perhaps? (7) predator (6th,5e)river (7)
17. Sell back2t3h. eItl’esasrpnleernodfifdttootuhnefamiralyn t(a3c)kle th1e5.biCsloenan 1o6u.tMthoeggbiueggseftrsoamriedsesewnicthe toafxi driver
18. Grind up(7a)meal to make from grain (7) life in the wriveeari(n7g) Yorkshiremans hat (8)
21. Horseless25t.raDnrsupgodretsalpeur ldlerdopbsyfi2rs3t as an esc1o6r.t M(5o)ggie19g.etDsuackriidsefowuinthd taatxtihdersivheorpping centre by
perhaps? (7)26. Apes who could really have fun awteaartienag Yothrkesrhoiardem(7a)ns hat (8)
23. It's splenpdaidrtyto(1u1n)fairly tackle the bison 19. Duck i2s0f.oOunnedpaotinthtiengshthopepfiinngger has a mission for
(7) 28. Darted right round animal on thecernotarde by tthhee Rrooamda(n7)Catholic (7)
25. Drug deasluerrfadcreop(s6)first as an escort (5) 20. One po2i2n.tIin’mg tphoesiftiinvgeefrahthaesrawas a wave riding
p26ar.tAyp(e1s1)who2gr9ci.zoBzulelydo(rp8ep)arlelysshivaevehafuvningatnao tleoave lef2rm2ti24dfio..sinsrLI'igmeogndpubfoodo2w2dsrneiu74iett(td..ih6hvheALe)eeebn(Rlfgui6damoc)btmkbhaosylenahrcelnoiewfthneCae(tamrs3ledt)huaaborwtydlitaeclhirvf(eeee7re)m(n5ud)rodferaellrl(e5tt)ers
28. Darted right round animal on the road hit
surface (6)
29. Be oppressive having no love left for 27. Animal centre at the end of all
grizzly (8) Please mention this magazilneettewrshehnitrwesipthonbduicnkgshtootth(3e)se adverts - Thank you

LE July (44).indd 39 23/06/2017 12:48:43

40

PRIZE CROSSWORD ENTRY FORM

Send your completed entries to:
July Prize Crossword, The Local Eye,
22 Oswald Road, Moordown, Bournemouth. BH9 2TQ

Name: ________________________________ Tel:____________________

Address:______________________________________________________

Address:______________________________________________________

Closing date for entries is Tuesday 25th July

Congratulations to Richard Quain of Portland Road who won
a box of locally grown seasonal vegetables courtesy of
North Bournemouth Allotment Society.
Enter this month for your chance to win one too!

May Solution Brain Power
Solution – Scary Stuff

1H 2T 3M 4H 5G 6E 1: Batman, The Hulk, Superman, Cat Woman, Spiderman, Wonder Woman
7C A R R Y A W A Y 8G R A V E Wolverine, Iron Man, The Thing, The Invisible Woman
C O N U 9A U I
1S0 K E L E T O N 1C1 H E L L O

SLR THSS 2: Squares = 11 Triangles = 24
1A2 S I A 1E3 Y E T O O T H
Picture Box1C4 P D M A
1N5 T 1C6 E 17I 1N8 AS si3m: p8l0e tEeastchofnusmaybewr hisaat ysqouuarseeem?inus 1 :
U A A S 19T O T E A R 1x1-1, 2x2-1 etc
B E
2A0 21T 2V2 23L For example the first one below is?
2S5 B D U C O O R E I O E 2E4 SHi4tt:in1g5beealcohwofth2ep,b2e0ltp,o5f0cpoaunrdse£!1
Y A L O W I M P I R E
H D 2V6 A

ORN I BTR (Answers on page 40)
2B7 L O O D 2D8 A R E D E V I L

EN LRRE

June Solution Belt Picture Box Answers
Solution > Working Life Hitting 1. Over night stay
2. Blueberry pie
1C O 2M E 3B A C 4K 5T R 6A D E 7D 3. A stitch in time saves

RAE I AS A nine
I S 8L A 9M P L I G H T E R 4. Drainpipe
1T0 O T A L Y 5. Second guess
LE K 6. Washington
I E B A 1B1 O U N 1C2 E R
1C3 A R P O O L R R O
A Y 1G4 U 1M5 S H O E O
1T6 O T 1M7 U M STAY
IA
H 1S8 E A 1S9 A L T 2C0 A
H 2C1 H A R T E 2D2
AE
2T3 E A 2C4 H E R H T O E
C U A E 2E5 A R N S
2H6 A I R D R E 2S7 S E R I
I

E EEA EUG
2R8 E A D E R 2D9 A I R Y M A N

9

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 40 23/06/2017 12:48:43

41

ft

BAANRGNELEAS
MOCK THE WEEK BBC2
RUSSELL HOWARD’S GOOD NEWS BBC2
“Brilliantly Funny” Sarah Millican

FRIDAY 28th
JULY 2017
BOX OFFICE

0w1w2w.0co2as3ta1lc6om3e1d6y.com Support from:

Advanced tickets £12
Doors open 7.15pm
£16 on the door. Show starts 8.30pm
Phil Reid
Hotel Celebrity
‘BEST NIGHT OUT’47 Gervis Road
Bournemouth Adrienne Coles
BH1 3DD
Over 18’s only
Also online at:
Acts may change due

to TV commitments

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 41 23/06/2017 12:48:44

Han
One
200
nigh
One

42 tom

Han
Sea

Fireslaw!!

Tasty & easy cous-cous

Catering & Events Method

Boil the water and add stock cubes. Pou

wawdwa.madaawCnmdaweatvnweedsre.fvoaineodsdgf@aoo&mgdm.waeaenivlb.edcso.cnemotvmsesfood.waf‘cluoesfpofbkyla.stshh.crooofutmghhe’.oSiel-psaerpaatreaategawinithwaithfoarkf.o
Cwawtwer.aindga&maenvednetvsesfood.webs.comor call 07948 494024 for a quoteIngrediAedndtsthe other oil and all the other ingred

300g DrIieddeacolluys,-lceoauvse all the flavours to soak in o
480ml boaidlindgowthaeter rslwiciethdovneegoertables like courgett
Ingredients more vegbeetaanbsleifstyoocuk pcurebfeesr.

1/4 of a red cabba43g08e00mg lDbroieildincgo2uw5s0a-gcteoyruo2HOGswg0oaniht0oenhugdd1Ilronef/cstg4numlhuroeoleiSogcfordoekanifoermr--rcnvefpcatdaheOsepcoyalaweiposvbrpnibsestoaeahOgadiesmkilieenedocarhotFuv,minerceirkhx-ssel!aewse! or on its own.
2 medium organicmcoarrervoetgsetabSleasstoncknOtiocnguehtbta12tehsalmsatinreedgddeuioucosmofrigonaoakgrnjgea;icadrsnr.ewiocdfceoasenurtrinoocnt-shdriilelidsauce, Catering & event
For catering & events...
now taking
1 large organic red onion cayenne pepper, chilli flakes, paprikaGood slug of Olive Oiltoma1tsomas,llsrnedipppeepdper bookings for 2010
1 small red pepper or just fresh chilli snippets!Handful of capers Hand2f5u0lgromf cyohgohpuprteodr mfraeysohnahieserbors mix! send your ideas and

SeasoSneainsogn to taste using; sweet chilli sauce, requirements to
[email protected]
or call 07948494024 for a qu

One lemon-chopped in chjuusntkfrsesh chilli snippets!
200g chick-peas soaked over-
‘AMfTaBcluaoodesfpoidstlfthkyltaSGACSyto.hhtsllhdderiihh&eccaodrweeotoopeedftuarfinharetCgntheedeesheasearyrl’sor.tyoaiorlncSnyiniroloielg-eodtaapuSnOHtsdntsonneaiaesoangcmddac-rrpdhehnaatecsadaatadoeumbtottvnshrfalenbosluuateoiitnknreetaalntosvddhgsyeogg-cl,ieyfnoeckasswt,nofcgthoirhcynitoiatepethupolkhhmpewjesbpueaeepad-peonirrrdtis.evemghocif.nddioeifPneaignrsxfprgkourrtfeeeua.notbwsdphl-rrhLildikpehgeoethreinovbitacteeroegteehrvdSGCSsbertullemkhriitatasccocenetheepfneoiroekdfirenCdue!nprersddaeasrm5lot-lrwyclAoenycotirmidoisoaexsutdndncuehidhsdlcrncsiueraegUcdemsntbvasoikhsberostoeynnaiuvotenglnfsidlygrsensty,eygstrst.loehihepmnetu-Carongsmoevgtdreiieixnanp-gntaetdhlpwbleepihtrgeositrptgcoeihecgmtuihaenierrkdnrtsdihwsleehitbsheedctttreieors!nsing
IdealUlys,elefarevsehaCll otrhieanfldaevroutorsgtaorsnoiashk in over night. You can
add other sliced vegetables like courgettes, or olives and other

ty & easy cousbS-eecraovneus swifiythoumperaetf,ecrh. eese or on its own.

A man had been driving all night and by morning was still far from his

hod destination. He decided to stop at the next town he came to, and park somewhere

the water anqduiaetdsdoshteocckoucludbgeest.aPnohuoruor voer rtwcoouosf-scloeueps.aAnsdluck would have it, the quiet place
lash of the oilh-esechpoasreahteapwpeitnhedatfoorbke.oLneoanveeoffothre5tmowinnss tmoajor jogging routes. No sooner had
Sheaenpdsaerstaatlwteedaabjgaocagkginetorwrsuintnohnoaiznegfowirnhkepntlaotcheke.er“eeYpecasc?mo”eu“Esaxckconuuosseckmineg, on his window. He looked out
k through’. sir,” the jogger said, “do you

y. have the time?” The man looked at the car clock and answered, “8:15”. The jogger

the other oislaaidndthaanllktshaendotlhefet.r Tinhgermedainensettstalenddbamckixalgigahint,lya.nd was just dozing off when there
ally, leave all wthaes aflnaovtoheurrskntoocskoaonktihneowvienrdonwigahntd. Yaonuothcearnjogger. “Excuse me, sir, do you have
vetjhogegegtteaimrbselep?”as sl“is8ki:ne2g5cb!o”yuTarhgneedjtohtgeegsk,enorerswaoilidtivtwehasasnakonsndlayonadthmleeafrtt.teNroowf the man could see other
other sliced time before another one

ns if you prefedri.sturbed him. To avoid the problem, he got out a pen and paper and put a sign in

e with meath,ischweiendseoworsaoyninitgs, o“Iwdno. not know the time!” Once again he settled back to sleep. He
was just dozing off when there was another knock on the window. “Excuse me sir,

but I thought you would like to know Its 8:45!.”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 42 23/06/2017 12:48:45

43

BRING THE

WORLD 15OPS_HF_Recruitment_Flyer_A5.indd 1
into your

HOME

And host an International24/10/14 18:05 Student!

We are looking for couples, singles & families to host students from across the globe.

Being a host family is as rewarding for you as it is for your students.

You learn about another culture and provide a once-in-a-lifetime experience.

Homestay accommodation required all year round.

15OPS_HF_Recruitment_Flyer_A5.indd 1 24/10/14 18:05

Guaranteed weekly payments

24 hour staff support

50 years experience in language education CONTACT24/10/14 18:05

World’s largest private15OPS_HF_Recruitment_Flyer_A5.indd 1 education company
Friendly & supportive team

01202Accommodation required all year round
832830EF International Language Centre
11 Poole Road, Bournemouth, BH2 5QR

[email protected]
www.ef.com/host

Please mention this magazine when responding to these adverts - Thank you

LE July (44).indd 43 23/06/2017 12:48:45

44

Horizon Live-in Care provides professional, To learn more about our
fully qualified and experienced 24-hour live-in care services,
live-in care services across Dorset, please contact us on
Hampshire, Wiltshire and Surrey for a wide
range of people including the elderly, the 01202 737456
infirm and those with mental health needs.
HORIZON LIVE-IN CARE
Your Horizon Live-in carer enables you to 1430a Wimborne Road,
continue to live your life in as much comfort Bournemouth BH10 7AS
and freedom as your condition allows. It [email protected]
means you can stay in your own surroundings,
maintain contact with neighbours and
retain beloved pets. Our live-in carers are
homemakers too; they are all as house proud
as the people whose homes they share and, as
well as performing day-to-day chores, provide
continual companionship and reassurance
through difficult times.

www.horizonliveincare.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

LE July (44).indd 44 23/06/2017 12:48:45