The Local Eye - Issue 143 - September 17

The SEPTEMBER

Local EyeIssue 2017

143 Advertising For Local Businesses, Trades
and Community Information...

GETAN CARPETS, FLOORING,
BEDS & BEDROOM FURNITURE
EXTRA
PLUS! WE WILL BEAT ANY LIKE
FOR LIKE WRITTEN QUOTE!

% • OPEN 7 DAYS SPREA0%D THE COST WIT H
• FREE ESTIMATES
OFF • 100’S OF BIG BRANDS INTEREST
• HUGE RANGE OF
STOCK ITEMS MATTRESSES SUBJECT TO CONDITIONS
• 100’S OF RUGS
WITH THIS VOUCHER • DISPOSAL OF
OLD FLOORING & BEDS
L. EYE. Not to be used
 in conjunction with

any other offer

Flooring Superstore Nuffield Industrial Estate, btehed
Poole, BH17 0RR, Tel: 01202 723162 store

Ferndown Industrial Estate, The Bed Specialist
WIMBORNE BH21 7PE, Tel: 01202 872240

carpetsandbeds.com

2

D Learn To
A

N Dance Now
C

E

D Specialists in the following:
A
N *Ballroom

C *Latin

E *Junior Street
*Ballet & Modern
D *1st Wedding Dance
A
N *Adults

C *Juniors

E *Tiny Tots

D ANGLO DANCE STUDIOS
A 93a Chatsworth Road
N Bournemouth BH8 8SN
C Tel: 01202 514551
E www.anglodance.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

3

Nu Staff are a family run business, we are local, reliable and dependable.
We have over 48 years of experience providing care in the community

Nu Staff believe continuity of care is extremely important, we recognise
how intrusive our job can be on the individuals for which we provide care.

All our staff are PROUD TO say they CARE being both
friendly and approachable.

We ensure our carer’s receive the best training and support to deliver
the care you rightly demand.

Nu Staff fully support Bournemouth Borough Councils
PROUD TO CARE initiative.

01202 292870

Our services include:

• Assistance with personal care
• Help with medication
• Meal preparation
• Light domestic duties
• Laundry
• Waking or sleeping nights
• Companionship and outings
• Respite sits

Visit times can range from 15 minutes right up to 24 hours a day
We provide care in the Bournemouth and Poole areas, if you or a loved one need
support please give us a call to discuss your requirements or we can arrange for a

member of the team to come and meet with you in your own home

www.nustaffimageplan.co.uk

602 Wimborne Road Winton Bournemouth BH9 2EN

Please mention this magazine when responding to these adverts - Thank you

4
Welcome to the September issue of e Local Eye

is magazine is delivered free to an alternating selection of around
13,000 homes and businesses in Bournemouth, mainly through the
Charminster, Queens Park, Moordown, Ensbury Park, Redhill, Winton,

Muscliffe & Strouden Park districts.

It can also be picked up from:
e Bournemouth Life Centre in Moordown, Mike Stokes Tyres and

Johns Fish & Chips in Moordown, KwikFit Castle Lane,
e Hungry Wolf Cafe & AH Parfitt - Chiropodist/Podiatrist in Winton,

and Charminster & Winton libraries, Moordown Community Centre,
as well as several laundrettes in Charminster, Moordown & Winton.
More information on rates and ad copy submission as well as online
copies of the current and previous issues can be found on the website.

01202 255485 / 08000 430485
07801 474788

[email protected]
www.thelocaleye.com

Until next month..
Chris

The Moordown Traders Association are an enthusiastic group of business
owners from the Moordown community who have come together to promote

local trade and raise the profile of Moordown as a shopping and business
destination, to support local traders and enhance local businesses.

We meet regularly, work voluntarily and liaise closely with the Bournemouth
Chamber of Trade & Commerce (BCTC), Bournemouth Council, elected

Members and local media to ensure that the Moordown trading district is
represented in a positive light.

The Moordown Traders Association meet monthly between 6pm-8pm
upstairs at the Moordown Conservative Club in Balfour Road.

All Moordown traders & businesses are welcome.
Come along, air your views and meet other local business people.
Drinks available at the bar and sandwiches are provided for the peckish.

Next meeting date is:

Tuesday 19th September / Tuesday 17th October

For more information visit: www.more2moordown.com

Every effort has been made to ensure that the information contained within this publication was correct at the time of going to print. We
cannot be held responsible for any inaccuracies in advertisements, editorials or features nor for any consequences arising from these. We are
not to be held responsible for any errors, loss or damage to copy in printing. The Local Eye does not officially endorse any advertising material
included within this publication. It is the advertisers responsibility to ensure conformity with laws and/or acts relating to Trade Descriptions,
Sex Discrimination, Consumer Credit, Copyright etc. No part of this publication may be reproduced, stored in any retrieval systems or
transmitted in any form - electronic, mechanical, photocopying, recording or otherwise - without the prior permission of the publisher. The use
of this publication for canvassing, direct marketing or any other activity apart from sourcing local goods and services, is strictly prohibited.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

5
Please mention this magazine when responding to these adverts - Thank you

6 Zoe Bellamy

WINTON WOOL SHOP BSc.Pod.Med - M.Inst. Ch.Pod

CARLY‛S CRAFTS Chiropodist / Podiatrist

Stockists of:- CHIROPODY
HOME VISITING
NORO ~ DEBBIE BLISS
PATONS ~ RICO SERVICE
IN YOUR AREA
STYLECRAFT ~ SIRDAR
ROWAN ~ KING COLE For total footcare please call

Large selection of Patterns, 01202 309932
Needles and Accessories
24 HOUR ANSWERING SERVICE
Shop 1, 1a Cardigan Road

(road opposite Poundland)

Winton BH9 1BJ

01202 512106
Delivery Service available

Did you ever wonder why earrings became IYENGAR®
so popular with men?
Yoga Class
A man is at work one day when he notices his For Beginners
co-worker is wearing an earring. The man knows
Commences Monday 4th September
his co-worker to be a normally conservative 10.15 to 11.15 a.m.
fellow and is curious about his sudden change in
“fashion sense.” The man walks up to him and Ensbury Park Community Centre
Ensbury Avenue, Bmth, BH10 4HG
says, “I didn’t know you were into earrings.”
“Don’t make such a big deal, it’s only an earring,” Yoga has numerous benefits, such as relieving
he replies sheepishly. His friend falls silent for a stress, reducing and eliminating stiffness.
few minutes, but then his curiosity prods him to Yoga can relieve headaches, back ache and
ask, “So, how long have you been wearing one?” many other health conditions.

“Ever since my wife found it in my car.” For full details of this and other classes
.................. in Parkstone and Broadstone

I asked my wife if there is anything special she please contact Pauline Collison
would like for our 20th wedding anniversary. 07517 384848
She replied, “Nothing would make me happier
[email protected]
than diamonds darling” www.paulineyoga.com

So I got her nothing. Seems I misunderstood!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

7

FaRmunily

SINCE 1906

FOR ALL YOUR HOME COMFORTS

BEDS | BEDDING | CARPETS & RUGS | SOFAS
CURTAINS | FURNITURE | COOK SHOP | GIFTS

Winton Store Wimborne Store VISIT OUR
426 Wimborne Rd, 20 East Street, Wimborne,
Bournemouth, Dorset, BH9 2EZ Dorset, BH21 1DT CAFE
Tel: 01202 512345 Tel: 01202 883311
AT WINTON STORE
FREE PARKING www.sturtons.co.uk

Images - illustration purposes only

Please mention this magazine when responding to these adverts - Thank you

8

SUDOKU

How to Play

Fill in the grid so that every
row, every column,
and every 3x3 box
contains the digits
1 through 9,
with no repetition!

Simples!

You solve the puzzle with
reasoning and logic,

there’s no maths involved
and no adding up.
It’s challenging.
It’s addictive!
It’s fun.

(Solution on page 44)

SUDOKU TRIVIA

Sudoku stands for “suji wa dokushin ni kagiru” Sudoku, of course,
comes from Japanese, which means, “The numbers must occur once”
or “The numbers must be single”.

The first Sudoku puzzles that resembled magic squares developed
in France. Two newspapers, “Le Siecle” and “La France” began by
removing numbers from magic squares. Although arithmetic was a more
important factor than logic in these early puzzles, they were the beginning
of the Sudoku trend.

The placement of numbers in a Sudoku puzzle has more impact on the
difficulty than the quantity of the numbers. In fact, the addition of new
numbers would not be nearly as significant as simply moving some
numbers around. Of course, some additions would be more helpful than
others.

To seasoned puzzle solvers, it may be astonishing that no Sudoku grids
are repeated in the hundreds of books that have been released. This is
because there are approximately 5 billion possible permutations.
This number represents essentially different grids. The different
permutations for Sudoku answers that are correct tops out at over 6
sextillion, or 6 * 10^21!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

9

Garden Tidy Up
Hedge Cutting
Turfing
Lawn Treatment
Waste Recycled
Patio / Driveway Cleaning

For urgent jobs, one offs, or
regular fixed price service call:

01202 805 375

www.EdsGardenMaintenance.co.uk
Please mention this magazine when responding to these adverts - Thank you

10

My name is Hercules, and I am a handsome cross breed
looking for a new home. I am 4 years old. I love going out
on walks and having a good run around, I am a pretty active
little chap. Meeting some doggy pals out on my walks is good
fun too. I have lived with children, cats and other dogs so if
you have any of those we should get on great. I am a big dog
really, in a small dog’s body. After all that outdoors fun it’s
great to cuddle up with my human friends and have loads of
fuss and attention. I will keep you entertained and make your
days happy with me as your new best friend. If you think you
are the person or family for me, please contact the office on the number below.
We also currently have lots of rabbits and guinea pigs looking for their forever homes.
We have several fundraising events coming up.. Our main event is a
Variety Concert at Q. E. School Wimborne. on 9th Sept 2017.
Tickets for this event are available from Waggy Tales office. Come and support
Waggy Tails whilst enjoying the sounds of singers and bands from your local area.
For more information on Hercules or any of the other animals in our care or our future
events please contact us on 01202 875000,
e-mail: [email protected] or visit our website www.waggytails.org.uk
Waggy Tails Rescue is a registered charity based in Dorset;
we rescue and rehome dogs that have been abandoned, neglected or otherwise in need

of a new home.
We also find homes for other small furries that may be in our care. To find out more you

can contact us on the number above or send donations or letters to:

Waggy Tails Rescue, Helens House,
143 Magna Rd, Canford Magna
Wimborne, BH21 3AW

** These are not Waggy Tails animals, just very guilty ones!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

11

LFB MEATS

01202 533997
www.lfbmeats.com

THE BBQ SEASON IS UPON US!

BBQ PACKS £3.99 each

Pork Ribs, Chicken, Burgers, Flavoured Sausages

MULTIPACK SPECIALS

3 FOR £10

MATCH ANY 3 BLACK LABELS FOR £10

Also available a wide
selection of flavoured

sausages...
Pork & Leek, HoneyRoast,

Merguez, Hot Chilli,
Old English, Romany, British

Banger, Black Pepper, Beef
& Beer, Alabama, Stilton &
Chive, Sun Dried Tomato,

Pork & Apple.

(*all subject to availability)

Frozen Fish Fillets...

7-8oz Cod Loin Fillet - £2.50
6-7oz Haddock Fillet - £2.20
6-7oz Salmon Fillet -

£4.00 or 2 for £7.50

349-351 CHARMINSTER ROAD, BOURNEMOUTH. BH8 9QR
(Opposite Esso garage, lower Charminster)

Please mention this magazine when responding to these adverts - Thank you

12

Derek J.Rolls

Independent Estate Agents & Valuers

Ask The Agent

Q. I’ve just had a valuation, and as it was being done, the agents asked if they could
bring someone round to view my home straight away, even though I haven’t formally
appointed them yet. Advice, please!
A. I totally understand that at first glance, this might sound like brilliant news.
However, there are a couple of issues you might want to consider first..
To start with, there’s the little matter of the law. This states quite unequivocally that
you must be in possession of a signed agency agreement (which in any case entitles
you to a 14 day cooling-off period), and the agent must have commissioned an Energy
Performance Certificate for your home (unless it is exempt), before any marketing an
take place. If either of these two things have not been done. then both the agent and
you are breaking the law. And by the way, don’t believe this agent if they try to claim
that a quick advance viewing doesn’t constitute marketing, because It does!

Now, of course, this might not overly bother you. But just think: when it comes to
selling what is almost certainly your single most valuable asset, do you really want to
use an agent who’s apparently prepared to break the law - even if it’s in return for a
reduced fee? In any case, besides these little legal niceties, there are a couple of very
practical points to consider. If you give this one buyer - who is clearly on some kind
of inside track with the agent - the huge advantage of seeing your home before anyone
else. how can you be sure that the price they offer is really the best you could get? It
is often said that the first offer is the best one. But this is more applicable in a market
where buyers are spoiled for choice. That is certainly not the case in the current market,
where there is not enough stock to meet demand. Consequently, the last thing you
should be doing is jumping at the first offer that comes along. Besides which, even if
you like the offer that this alleged buyer is prepared to make, how can you be sure that
they are actually in the best position to complete the purchase within your chosen time
frame?

So, my advice is to politely decline this kind offer. take your time in choosing a
professional agent who sticks to the rules, and let them do what they are actually
paid to do - which is to market your home properly to the widest possible number of
potential buyers, using all their skills and all the tools at their disposal!

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

13

Derek J.Rolls

Independent Estate Agents & Valuers

NO SALE NO FEE. COMPETITITVE COMMISSION RATES

TAHLURLISERMSQGOOOUEFLRNFIDREITBCELYEDY!!

We believe that the housing market and prices are stronger than
ever so now is a great time to achieve the best price for your
property. Please call Derek or Martin on 01202 525778 or email
[email protected] for a free market valuation.

We have a combined 50 plus years of knowledge and experience
in selling homes in the area so truly do know what your property

should be worth in today’s market.

01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG

www.derekjrolls-estateagents.co.uk

Please mention this magazine when responding to these adverts - Thank you

14

Mount Pleasant Townswomens Afternoon Guild

We meet in the Bradpole Road Community Centre at 2pm on the 1st Wednesday of every
month for a social afternoon, when we have different activities including a speaker, and

we welcome visitors who we hope may join us and become members of TG.

Our other activities include Trampers & Eaters (when we visit nearby places of interest
and end up with lunch), skittles, a music afternoon (all sorts) and a Social Studies
afternoon when we reminisce and discuss any current subjects of interest.

Charminster Afternoon Townswomens Guild

Trinity URC Hall, Sutton Road - No meeting in August
Next meeting - 2pm Tuesday 26th September

Guest speaker - Pam Smith > McMillan Cancer Support

Come and meet us and make new friends, and find new interests!

Further details from our secretary,
Margaret, on 01202 512543

Redhill
Townswomens Guild

Hillview School, Hillview Road
7pm every 2nd & 4th Tuesday of each month.

We have a wide range of speakers and different social sections, choir,
craft group and a reading group.

This friendly group of ladies always welcome visitors and new members so
come along for a chat.

For more information please call: 01202 240815

THROOP FENCING
& DECKING

REGISTERED WASTE CARRIER
FULLY INSURED

Contact: TERRY

07866 540062

[email protected]
TWITTER.COM/THROOPFENCING

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

15

New Van! Same Great Service!

Extensions - Loft Conversions - Conservatories - Property Maintenance

07525 805091

Local Bournemouth Company - Established 25 Years

Previous Projects Available To View - Meet Our Happy Customers

Isn’t there
something you’d
rather be doing with
your spare time?
Could you use some help with your Cleaning, Ironing or Both?

• Regular hourly rate only £11 - £12 per hour
• One off spring cleans available - call for price details
• Times and hours to suit you - (minimum 2 hours per week)
• Reliable, honest, professional service
• Insurance provided

Call 0800 0925 773
Email: [email protected]

You deserve a rest... So be served by the best

Please mention this magazine when responding to these adverts - Thank you

16

VETERINARY CLINIC
144 Richmond Park Road
Bournemouth, BH8 8TW

Are you struggling with the costs of private vet care?
We offer affordable veterinary services for your pets

Consultations £15 Boosters from £22
Neutering from £30 for cats, £51 for dogs

You could be eligible if:
• Your household has a low income
• You are a pensioner
• You receive means tested benefits

For more information on how to register
Please call the clinic on 01202 526520
Monday – Friday 9.30am – 4pm

Registered Charity No. 205126

TRAVEL Picture Box

16 Seat Minibus Travel A simple question of say what you see?
For example the first one below is?
Special
Escorted GUESS

Tours GUESS

London Oxford Bath ‘Second Guess’ of course!

Feeling at home A
wherever you go M POOLE N

Events • Transfers • Tours WISH 1 - GLANCE
2-
Corporate/Business Functions • School Contracts 3 - GLANCE
Days Out • Airport • Sporting Events 4 - GLANCE

Theatre Trips • Race Days Out • Hen & Stag Events CHEEK CHEEK
Southampton/Portland Cruise Liners GO

Group & Social Activities • Wedding Functions (Answers on page 44)

Book your trip today

07751 442 321

[email protected]

www.arrowmakertravel.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

20%cushOiofnf 17

CUSHIONS REFILLEDHacluvoOesshtoyiomothunpershir? all
refills

FROM THIS FOAM - FABRICS - SUNDRIES
TO THIS All aspects of upholstery undertaken
890 Wimborne Road, Moordown, BH9 2DR
01202 516949 : [email protected]

Polishing in the Bournemouth area for over 30
years!

- Removal of water and heat marks
- Colour matching
- Free collection and delivery service

Why buy new when you can have your old quality
furniture restored as good as new?

For a free quotation please call JIM PRICE

Tel: 01202 529910 Mobile: 07855 044732

16 Victoria Avenue, Winton, Bournemouth, BH9 2RN

Please mention this magazine when responding to these adverts - Thank you

18

BOURNEMOUTH TATTOOISTS TURN TO NOVEL VISION

Bournemouth tattooists, Amy and Abigail, frustrated with
wearing glasses, have turned their sights to a novel form of
vision correction which leaves them with a superb eye for detail.
Amy Billing and Abigail Rawlings, who are both established
tattooists in the Bournemouth area, have been inspired to try an
overnight treatment called Ortho-k which works as they sleep.
Gently flattening the eye’s surface, it leaves them free of contact
lenses and glasses for the day ahead.

Ortho-k, is a non-surgical, and fully reversible form of vision
correction which Raxworthy Opticians in Christchurch
is providing for patients.

Amy, 22, who studied Fine Arts, had looked at other options to correct her sight but is
delighted with the results of Ortho-k and the tailor-made lenses –“I looked at laser but with
the cost it wasn’t an option. I saw this and thought it looked amazing.”
Amy, who has a prescription of -4.00 dioptres started using Ortho-k six months ago and had
immediate results -

“After the first night of wearing the lenses at night I was -1.00 dioptre in the morning, and
after a few nights I had perfect vision when I woke up. I can work all day and even if I am
out until 3am on a Saturday night I can put my lenses in late and still see well the next day.
“I hated wearing glasses as they always slipped down when I worked, and my contact
lenses used to dry out as I was staring at the same point for a long time when I work. I can
spend up to eight hours on a piece of work. It is literally the best thing I have done – to be
able to wake up in the morning and see – there were so many things that were awkward or
inconvenient with glasses.”

Abigail turned to Ortho-k when she saw Amy’s success –
“I decided to give it a go, even though my prescription is only -1.25 dioptres. I hated glasses
and had problems with wearing contact lenses during the day, but these lenses are fine at
night. Once my eye had moulded to them they go in perfectly. The results are brilliant for
my work, and I recently went travelling in South East Asia and the elephants were splashing
water in my face – I couldn’t have enjoyed that with contact lenses or glasses.”

Richard Taylor, the optometrist who looks after Amy and Abigail’s vision, explained that
Ortho-k moves the surface of the eye by less than half a hair’s width, and working much
like braces on teeth can help to ensure that short-sightedness does not progress –

“There have been a number of
international studies which indicate
that using Ortho-k to correct short-
sightedness in children and young
people can have significant long-term
benefits for eye health.”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

19

>r^=k^Zf h_'''

:G :EM>KG:MBO>MHE:L>KLNK@>KR

www.raxworthyopticians.co.ukppp'^r^]k^Zfe^gl^l'\h'ndu:ldpbmabg_hk_nkma^k]^mZbel

Ho^kgb`amOblbhg<hkk^\mbhg

LIMITED OFFER

Half-price Þtting fee until 31st December 2017
Contact us to see if you are suitable

01202 484888

51 Bargates, Christchurch, Dorset. BH23 1QE
Please mention this magazine when responding to these adverts - Thank you

20

“Bourne2Sing”
Male Voice Choir

”Bourne2Sing” Choir wishes to announce that we are seeking a
Deputy / Relief Pianist to deputise for and support our resident Accompanist.

Duties will include playing on Monday rehearsal evenings
and also playing at Concerts as and when necessary.

Applicants should possess first class sight reading, keyboard, piano and
accompanying skills. Remuneration will be agreed accordingly.

Candidates are requested to send a C.V. covering their musical background and
experience to our Musical Director via e-mail: [email protected]

Our Website www.bourne2singchoir.uk
provides a wealth of information about “Bourne2Sing”.
The Choir is fully booked for the remainder of 2017 with six Concerts to perform
and also fully booked for the year 2018 with eight Concerts in prospect.
The Choir sings at a variety of local venues for Charities and Good Causes and
since it’s inception on the 4th February 2013 has raised in excess of £15,000.
Our ethos is to have fun from music by singing tunes that are familiar and

pleasing for our audiences.

”Bourne2Sing” has grown hugely in popularity and our success can be gauged
from the continued number of repeat bookings that we receive.
In fact 50% of our Concerts for 2018 will be “Return Visits”.

Performances are given in two segments and presented by a Compere with a
Guest Artiste solo spot in each half of the Concert.

Our next Concert is scheduled for Verwood Methodist Church, Vicarage Road,
Verwood on Friday the 8th September 2017 commencing at 7.30 pm
where we shall be singing in aid of “Future Pillars ( Zambia )”
(www.futurepillarszambia.org.uk).

We know a guy who was so musically inept his teacher gave him two sticks and he became a
drummer but then he lost one and became a conductor.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

21

*LANDSCAPING *BUILDING SERVICES *PAINTING & DECORATING
*ROOF REFURBISHMENTS *CLEANING CONTRACTS

FOR A FREE NO OBLIGATION QUOTATION CALL US ON
01202 959162 / 07460 494418

www.facebook.com/bmthpropertyservices
www.bhpropertyservice.co.uk

Fully insured and references available

Stephens

Carpentry & Building

Kitchen Fitting General Building

*FLAiNttDeSdCAWPINaGrdro*bBUesILDING SERVICES *PAINRTIeNnGo&vDaEtCiOoRnAsTING

& Cu*RpObOoFaRrEdFsURBISHMENTS *CLEBArNiIcNkGlaCOyNinTgRA&CTSPlastering

Door Hanging, QUOTATION Patios
ArchitraFvOeR A&FSREkEirNtOinOgBLIGATION
CALL US ON
General Maintenance
Fencing, Decking, 0S1h20e2d9s59162 / 07460
494418

1st and 2wnwdwF.fiaxcebook.com/bmthpropertyservices

No Job too Small • Refewrewnwc.ebshpArvoapielratbysleerv•iFceu.lcloy.uInksured • Free Estimates

Fully insBurrediaanndSretfeerpenhceesnasvailable

Tel: 01202 525 445 Mob: 07921 525 424

[email protected] www.stephensbuilding.co.uk

26 Green Road Bournemouth BH9 1EA

Please mention this magazine when responding to these adverts - Thank you

22

Brain Power

1: Charlie really wanted to know how much money he would get from
grandpa for his birthday. But grandpa didn’t want to tell him. Instead he
said: “You get so much!” “But how much is so much?”, Charlie asked.
“If I gave you so much, plus so much, plus the half of so much, plus 1/4 of
so much, plus £1, you would have £100.
How much will Charlie get?

2: In a card trading game:
3 green cards have the same value as 5 blue cards.
2 red cards have the same value as 1 yellow card.
4 red cards have the same value as 3 green cards.
How many blue cards can you get for 8 yellow cards?

3: There were 100 children at community party. To save on cooking a bulk order
of fried chicken legs & thighs was delivered from a certain franchise. Some of the
children had only one leg. Half the rest had no legs. In total how many legs did the
100 children have?

4: Three brothers share a family sport:
A non-stop marathon, The oldest one is fat and short and trudges slowly on
The middle brother’s tall and slim and keeps a steady pace
The youngest runs just like the wind, speeding through the race
“He’s young in years, we let him run,” The other brothers say
“’Cause though he’s surely number one, He’s second, in a way.”

Who (or what) are they?

5: Bobby is sitting at his desk, being cool, when his younger brother Danny walks
up. Danny had recently been practicing his (fake) magical powers, trying to turn
cheese into more cheese, (he likes cheese), so he believes he can beat Bobby in
anything. He sets up a little competition, the first to get a pint of water to freeze,
will be proclaimed the coolest guy in their home.
They set up some rules, as follows:
-They must both only use water that comes out of their kitchen taps.
-They must both use identical containers
-They both must use the same freezer, at the same time.
Now, Bobby realises that if he were to lose, he would become less cool, he just
doesn’t roll like that.
So, how can Bobby have the best chance of winning over Danny? Answers on page 44

I don’t know why my brain has kept all the words to the ‘Fresh Prince
Of Bel Air’ theme song but has deleted everything about triangles and the

circumference of a circle.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

23

RR..JJ..HHuullll && CCoommppaannyy
CertiAfiecd PcroacutisningtaAcncotusntants

Accountants312 Charminster Road, Tel: 533370

312For moreCthahnwa2wr5wmy.erjaihnrsuslwltaeechcraovRuenobtaaenedtns,.acTsose.iuslkt:in5g3b3us3in7e0ss

people in the Charminster and surrounding areas with :-

pF∗∗oePSrooapmlreltoenTreiernrasttdhhheaieprnCaa3chc0cacyoromeuuannirnttsssstweer ahnadvesu∗∗brPTeraaeoyxnurnRaodsellistnuisgrtniansrgeabsuswinitehs:s-

∗ Limited Company accounts ∗ Bookkeeping & VAT

FSaoslte, eTfrfaicdieernatcpceorusnotns al serviceTaatxaRffeotrudranbsle fees
 Partnership accounts  Payroll
iPnlcelausdeeePnqayuriLoreillma, bBiootueotdkokuCereocpominmgppaalnentdeyVmaAacnTca,goaelulmnceotnmst psearnvyBicroeetofuokrrnkLs,eimaenipnteiudnalgcoac&mcpoVaunAniteTss, to
and

management advice on a fixed or variable fee basis

Fast, efficient personal service at affordable fees

Please enquire about our complete management service for Limited companies to
include Payroll, Bookkeeping and VAT, all company returns, annual accounts, and
management advice on a fixed or variable fee basis

Experienced, Honest and Reliable Multi-Skilled Handyman

Inside Outside

 Carpentry  Decking
 Plumbing  Patios
 Plastering  Gardening
 Tiling  Pressure Washing
 Painting and Decorating

Available for full or half day hire to catch up with all the little jobs you have
been meaning to do.

Phone David McDonald for free no obligation quote 07951738446 or e mail
[email protected]

Numerous references available.

Please mention this magazine when responding to these adverts - Thank you

24

Carpet Rugs Wood
Laminate Vinyl
Carpet Tiles
Luxury Vinyl Tiles
Commercial Flooring

Visit our new Karndean flooring showroom

01202 524052

www.cutwisecarpetsbournemouth.co.uk
39/41 Charminster Avenue, Bournemouth. BH9 1RR

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

25

Expert Advice with a Friendly Face

Please mention this magazine when responding to these adverts - Thank you

26

An alien walked into a shop and told the owner that he came from Mars and
wanted to buy a brain for research. ‘’How much is this one?’’ he asked.

‘’That one is a monkey brain, and it’s £20,’’ the owner explained. ‘’How much is that
one?’’ the alien asked. “That one is a female brain, and it’s £100,’’ the owner replied.
‘’And how much is that one?’’ the alien asked. ‘’That one is a male’s brain and it is

£500’’ the owner explained. ‘’Why so expensive?’’ the alien asked.
The owner answered,’’Well, it’s hardly been used!’’

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

27

Maths & English Tuition

KS3, GCSE, Preparation for the Grammar 11+, ESOL

I live in the Bournemouth area and can provide tuition
within my home or am willing to travel locally.

I am also able to provide Skype/e-mail tuition for students.

£20/Hour (£25/Hour in your home)

For more information please contact

HOME SCHOOL TUTORING BOURNEMOUTH

07928 824080

http://homeschooltutoringbournemouth.com

BA(Hons). PGCE. MSc. MPhil. ESOL. DRB.

VETERINARY CLINIC Dog Walkers
144 Richmond Park Road &
Bournemouth, BH8 8TW
Home Visitors
Are you on a low income? In The
Do you receive benefits?
Bournemouth Area
Are you a pensioner?
Tailored to you and your dogs needs, we
We offer affordable veterinary provide a bespoke dog walking and care
services for your pets service. For your peace of mind, we have
had years of experience with dogs and
Consultations only £15 are also fully insured.

01202 526520 Tel: 01202 468978
Mbl: 07775 905263
Mon-Fri 9.30am-4pm Email: [email protected]

Charity No. 205126 www.howlinggoodwalkies.uk

Please mention this magazine when responding to these adverts - Thank you

28

A man goes to the dentist. When the dentist leans over to begin to work, he
feels a tight grip on his manhood. The dentist says, “Sir, could please explain just

exactly what you are doing??.”
The man answers, “Yes. We’re going to be careful not to hurt each other, aren’t we.”

................
“Open wider.” requested the dentist, as he began his examination of the patient.
“Good God !” he said startled. “You’ve got the biggest cavity I’ve ever seen - the
biggest cavity I’ve ever seen.” “OK Doc !” replied the patient. “I’m scared enough

without you saying something like that twice.” “I didn’t !” said the dentist.
“That was an echo.”
...................

“I came in to make an appointment with the dentist.” said the man to the
receptionist.” “I’m sorry sir.” she replied. “She’s out right now, but...”
“Thank you.” interrupted the obviously nervous prospective patient.
“When will she be out again ?”
..................

A dinner speaker was in such a hurry to get to the hotel that when he arrived and
sat down at the head table, he suddenly realised that he had forgotten to get his
false teeth. Turning to the man next to him he said, “I forgot my teeth.” The man
said, “No problem.” With that he reached into his pocket and pulled out a pair
of false teeth. “Try these,” he said. The speaker tried them. “Too loose,” he said.
The man then said, “I have another pair...try these.” The speaker tried them and
responded, “Too tight.” The man was not taken back at all. He then said, “I have

one more pair...try them.” The speaker said, “They fit perfectly.” With that he ate his
meal and gave his address.

After the dinner meeting was over, the speaker went over to thank the man who
had helped him. “I want to thank you for coming to my aid. Where is your office?

I’ve been looking for a good dentist.” The man replied,
“I’m not a dentist. I’m the local undertaker.”

WANTED!!!

ELECTRICIANS, TATTOOISTS, FLORISTS,
BEAUTY SALONS, GARAGES, TAXI FIRMS,
DRIVING INSTRUCTORS, RESTAURANTS & BARS,
DOUBLE GLAZING, PET GROOMERS, ETC.
We are looking for more new trades & businesses

to advertise in this magazine.
Contact us now for more information.
Special discounts may be available for new bookings.

01202 255485 <> 08000 430485 <> 07801 474788
[email protected] <> www.thelocaleye.com

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

29

854 Dental Health

Professional, Friendly, Effective
Private Dentistry

01202 512967

Do you wish you had nicer or trouble free teeth ?
It is never too late to get help.
If you have dental problems and have been putting
off a visit, why not call us or pop in for a chat.
Modern dentistry can work wonders.

RICHARD J HULL B.D.S & ANGELOS SIDERIS Dip.D.S.

854 Wimborne Road, Moordown, Bournemouth, BH9 2DS
www.854dentalhealth.com [email protected]

Established 1972

Ply, MDF, Pegboard
Hardboard, Chipboard
No need to buy a full sheet Timber & Sheet Material
Cut to your requirements Large selection of Offcuts

Architectural Over 2000 items of Plastic
Mouldings Hardware & Tracking
DIY Products

Timber, Floorboards, Skirting, Dado & Architraves
Machined to your specific size and profile

Small items of Purpose Made Joinery undertaken

936 Wimborne Road, Moordown, Bournemouth. BH9 2DH
Tel: 01202 516225 <> www.builtindiy.co.uk
Email: [email protected]

Please mention this magazine when responding to these adverts - Thank you

30 T ra vel Feature -

A Little Bit Of Romsnce...

By Mags Addison

We all love a bit of romance! And the world of travel is no
exception. We are in a such a privileged position in the travel
business to help make those magical experiences for special
people.
It’s amazing how many of our bespoke holidays factor around
weddings, honeymoons, and even proposals. And that’s
without the stag and hen weekends, and special anniversaries
to consider also. Some of these arrangements are made 12
months in advance – so they are a long time in the planning.
And they are tailored very carefully to make it the best
experience possible for our clients. It is personal for us at Travel Counsellors, so going that extra mile
is so worth it. Especially when it’s a romantic occasion or celebration.
And it’s certainly been a busy romantic summer this year for some of my clients. I did a special tailor
made trip to India for one local couple that took place this August – despite an accident that meant it
nearly didn’t happen. The clients wanted a private tour of the Golden Triangle, Delhi, Agra and Jaipur
- with specific instructions from the male partner for a sunset visit to the Taj Mahal to be factored in
and I was told privately why this was so important. The tour operator I went too, worked in in so it
fitted in just right for them. The local guides on these tailored private tours often go beyond the call of
duty here, so would’ve also been in on the secret. It’s just the bride-to-be didn’t know what was planned
– so I was pleased to receive the pictures emailed to me from the happy couple taken at the Taj Mahal
– and showing the proposal – which thankfully was accepted. Success!
I’ve had another lovely couple who went on their honeymoon to Sandal’s Barbados in June. They are
regular clients from Nottingham and came to me when sorting a stag weekend for another of their
group a few years ago, so their own honeymoon was a natural follow on. We started this enquiry
twelve months ago, and as soon as the flights slotted into range, we grabbed seats for early on the
Monday after the big family wedding on the Saturday, direct from London Gatwick. Sandals were also
having a massive sale at the time, which meant the lucky couple could upgrade to make it special. They
had an amazing time, full of special memories.
And I recently put together a three centre dream honeymoon in California for next May for another
young couple from the North East who are thrilled, after
months of waiting for the flights to slot into range. They
knew exactly what they wanted, San Francisco, Losa Angeles
and ending up in Las Vegas. They specifically wanted to
drive a mustang between LA and Vegas, just to experience
a bit of a Road Trip in there. And several choices of hotel
later, they feel we have now put together the perfect,
memorable honeymoon experience. They can’t wait for next
year to come.
It’s a cliché I know - but it’s a pleasure making dreams come
true. As we all say in our profession ... I just love my job!

Beach holidays, City breaks, Honeymoons, Weddings abroad, Adventure holidays, Ski,
Cruise, Tailormade trips, Flight only, Car hire, Airport hotels and parking and much more...

Contact Travel Counsellor

Mags Addison

018240520598017389102 Travel Counsellors ensures complete
financial protection on every booking
[email protected]
www.travelcounsellors.co.uk/margaret.addison

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

31

DISCOMBOBULATED...

by your PC
or laptop?
Let us make
I•T•

Computer or Looking for a new Are you a business
Laptop problems? PC or Laptop? on a budget?

Local, knowledgeable and affordable. All backed up with fantastic service!

EZ Computers Repair Centre have nus OPENING TIMES
been operating in the Winton
area since the early 1990’s. national union of students Monday - Friday 9:00am - 7:00pm
Initially started as a retail store, Saturday 9:30am - 5:00pm
EZ Computers swiftly branched 10% DISCOUNT Sunday & Public Holidays CLOSED
out into offering repair services ON LABOUR FOR
to the local community on NUS MEMBERS
a NO FIX NO FEE basis.
EZ Computer Repair Centre
The current EZ team has over 80 years
of combined experience in technical 606 Wimborne Road • Winton • Bournemouth • BH9 2EN
support, repairs and servicing, and PC
sales. EZ Computers also offers online Tel: 01202 267267 & 01202 268268
gaming, internet access and printing Email: [email protected]
facilities. Whatever your computer
needs, our friendly and knowledgeable www.facebook.com/EzComputersRepairCentre/
staff will find the right solution for both
your situation and your budget.

Please mention this magazine when responding to these adverts - Thank you

32

Do You Know About Raw Food For Cats & Dogs?

For generations, dog owners have been buying bags and/or
tins of pet food. Many people still do this today. Some pet food
brands are more expensive than others and there are several
foods today that claim to be all natural. Over the past few years,
more and more owners have been switching their dogs and cats
to a raw food diet.

Dogs, unlike cats, also need a mix of vegatables with their meat. We can supply these in addition
to the raw foods or you can also choose from a selection of premixed meat/vegetable packs.

Benefits of a Raw Food Diet:

Owners who take their dogs for a walk in public areas are required to clean up the dog’s poop
after he goes. If you find that your dog’s pooh is soft and sometimes runny, it can make cleaning
up after him a very disgusting job. If you start your dog on a raw dog food diet, you will notice
that his stools are firmer and much easier to clean up.(It’s a lot less smelly too!)

It is not uncommon for dogs to have digestion issues when they eat bagged or canned dog food.
Some dogs get very gassy, which can be pretty bad for anyone who is in the room with the dog.
Some dogs vomit after a big meal. If you start your dog on a raw dog food diet, he will get a
daily supplement of probiotics, making digestion easier.

If you have ever seen a wolf or a wild dog, you know that they often have beautiful, shiny coats.
This is because they are eating a raw dog food diet on their own. This diet will give your dog all
the vitamins and minerals that he needs to keep his coat and his skin healthy.

Many dogs have yellow teeth, infected gums, and very bad breath. This can due to the fact that
they don’t brush and floss every day and because they are eating manafactured dog food.
When you switch your dog to a raw food diet, his teeth and gums will be healthier and his breath
will smell much better.

The carbs in bagged dog food can give your dog a huge spike of energy, only to have him crash
later. The additives in commercial dog food can have the same effect. If your dog is overly hyper
for a while after eating and then strangely lethargic shortly after, you should switch him to a raw
food diet. Raw food will keep your dog’s energy level at an even keel.

It is not uncommon for dogs who are fed commercial
dog food to become overweight.
This is not the case on a raw food diet. This diet
is very high in protein, making it the most weight-
friendly option.

Still unsure? Come in to see us, we have a very wide
range of raw foods for cats & dogs and can help you
decide what to start on depending on your pet.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

33
Please mention this magazine when responding to these adverts - Thank you

34

live happy!

Slimwimth ing World

MONDAY TUESDAY

Charminster Iford

Bournemouth Moose Centre, Iford URC Church
117-119 Malmesbury Park Road Ropley Road
7.00pm 9.30am
Val 07971 106169
Shelley: 07832 277318

Wallisdown Springbourne

Talbot View Community Centre, Springbourne Christian
(opp Sainsbury) Alder Road Centre
7.30pm Curzon Road
Shirley 07912 574059 5.30pm & 7.30pm
Val 07971 106169
TUESDAY
WEDNESDAY
Bourne Valley
Charminster
Church of the Good Shepherd
Stanfield Road St Francis Church Hall
5.30pm & 7.30pm Charminster Road
Shirley 07912 574059 9.00am & 11.00am
Debbie: 07931 480464

Charminster Kinson

Bournemouth Moose Centre, Kinson Methodist Church Hall
117-119 Malmesbury Park Road Wimborne Road
9.30am, 5.30pm & 7.30pm 9am, 11am, 5pm, 7pm
Shelley: 07832 277318 Pet: 01202 524657

Charminster Ensbury Park

Bournemouth School for Girls The Bourne Academy
The Drama Block, East Way Hadow Road
6.30pm 7.30pm
Debbie: 07931 480464 Louise: 01202 874037

slimmingworld.co.uk

0344 897 8000

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

35

live happy!

Slimwimth ing World

THURSDAY FRIDAY

Bournemouth Moordown

Bournemouth Friends Bournemouth Life Centre
Meeting House 713 Wimborne Road
Wharncliffe Road 9.00am, 11.00am & 1pm
9.30am Sadie: 07545 379045
Val 07971 106169

Redhill Winton (St Luke’s)

St Thomas Church, St Luke’s Church Hall
Western Avenue St Luke’s Road
5.30pm & 7.30pm 5.30pm & 7.30pm
Louise: 01202 874037 Charlotte: 01202 510359

Moordown SATURDAY

* New Venue & Consultant Winton (St Luke’s)

From 7th September St Luke’s Church Hall
Bournemouth Life Centre St Luke’s Road
713 Wimborne Road 8.30am & 10.30am
7.30pm Charlotte: 01202 510359
Sadie: 07545 379045

slimmingworld.co.uk

0344 897 8000

Please mention this magazine when responding to these adverts - Thank you

36

Project Indigo

One boy’s adventure through time and space!

Hi, I’m Tom, a local Doctor Who blogger & I write about my adventures online at

anadventurethroughtimeandspace.com

Project Indigo is my special blog where I travel the
world visiting places associated with Doctor Who.
Sadly Series 10 of Doctor Who has just drawn to a
close. For me it has been a good series as I think
Nardole is a really cool companion and I am very sad
that he has left the show. Peter Capaldi is leaving too
- he has been my favourite New Who Doctor and

I have really enjoyed watching all his episodes. You
may have heard the news that the Thirteenth Doctor
is a woman - Jodie Whittaker from Broadchurch will be the first female to play the Doctor.
This will be exciting to watch - I don’t know what to expect!

Today we are travelling through time and space just down the road to Lulworth Cove in
Dorset. We are here to see the filming location for the Classic Doctor Who story The Curse
of Fenric which was aired in 1989. Lulworth Cove took the place of fictional Maiden’s Point
in Northumberland. The story was set during World War 2 and the Seventh Doctor and
his companion Ace have to defeat the Haemovores, humans who have been transformed
into vampiric creatures. I have been lucky enough to meet Sylvester McCoy (The Seventh
Doctor) and Sophie Aldred (Ace) and they both told me that Lulworth Cove was their
favourite Doctor Who filming location!

Recently I went to Lulworth Cove with my school to learn about the geology of the area.
It is on the Jurassic Coast near the village of West Lulworth on the Isle of Purbeck and is
a World Heritage Site and Area of Outstanding Natural Beauty. The area is made up lots of
different types of rock, the oldest Portland limestones were formed 160 million years ago in
the age of the dinosaurs and their footprints have been found in several places nearby. The
youngest rock is chalk, which is only 97 million years older than all of us!

In Doctor Who there was a secret Naval base nearby
but in real life there is a British Army base, Lulworth
Camp, and if you see red flags flying on the hill it
means there are firing tests taking place so you are
not safe to explore. The beautiful cove has been used
for centuries for fishing and smuggling but nowadays
it is a popular tourist spot with people coming from all
over the world to look at its beauty.
I hope you have enjoyed reading about Lulworth
Cove, I recommend going there and checking out the
amazing Visitor’s Centre to learn more. !f you would
like to read about other Doctor Who locations I have visited please check out my blog.
Thanks for reading, goodbye!

Tom Project Indigo -- anadventurethroughtimeandspace.com

Two old men were holding up the queue outside the turnstyle before the game,
while one of them hunted for his ticket. He looked in his coat pockets and his

waistcoat pockets and his trouser pockets, all to no avail...
“Hang on a minute...,” said the gateman, “...what’s that in your mouth?”

“It’s the missing ticket!”As they moved inside his mate said...
“Crikey, Cyril! You must be getting senile in your old age. Fancy having your ticket

in your mouth and forgetting about it!”
“‘I’m not that stupid...,” said old Cyril, “...I was chewing last week’s date off it.”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

37

Berry Hill Farm
Local Vegetables for local people

GUARANTEED FRESH SEASONAL VEGETABLES
DELIVERED TO YOUR DOOR IN HOURS

Grown locally in 1-2 people - £9.00
Bournemouth for approx 6 servings

local people, 2-4 people - £14.00
using only approx 10 servings
traditional
4-6 people - £19.00
farming methods. approx 14 servings

SELECT A BOX TO SUIT All boxes contain a selection of fresh seasonal vegetables
YOU AND WE DELIVER IT
For example: Potatoes, Cauli, Bunched Carrots, Cabbage, Brussel Sprouts, Purple
FRESH TO YOUR DOOR
Sprouting Broccolo, Leeks, Swede, Parsnips, Celeriac, Runner Beans, Broad Beans,

Marrows, Courgettes, Peas in Pod, Bunch Beetroot, Sweetcorn, Kale, Seasonal Salads.

Tel. 07971 795740 Berry Hill Farm, 185 Muscliffe Lane, Throop,

www.berryhill-farm.co.uk Bournemouth BH9 3NH Email. [email protected]

BOURNEMOUTH FC - THE POPPIES
PARTY AT THE POPPIES

Club House Available For Hire

Large Car Park - Family Friendly
Drinks At Club Prices - Dance Floor

An Ideal Local Venue
For All Your Family Functions

For more information and details of our extremely
competitive rates please call us on

01202 515123 / 07887 477547
A warm welcome is always assured!
Victoria Park, Namu Road, Bournemouth BH9 2RA

Please mention this magazine when responding to these adverts - Thank you

O

2

n

38 O
Catering & events t
www.adamandevesfood.webs.com H
S

Catering & Events Waldorf SaladIngredients

430800mg lDbTroieaildisntcgyouw&sa-cteeoaruswsyithcoounes-ocrous

more vegetable stock cubes
Good sluMgeothf oOdlive Oil
HandfuBl oofilctahpeerws ater and add stock cubes. P
One lemaosnp-lcahsohpopfedthien ochilu-nskesparate with a for
www.adamandevesfood.webs.com
[email protected] 2n0ig0hgtCachnaf‘clidcuotkfocef-okypro.ektiahnesrdgos.oua&gkhe’ed. Svoevepeanr-rtaste again with a
gsa-c&mouaesnvednetvsesfIonogrde.dwieentbss.comaepddarsattoeckwcIitfuhtbhaeeBMIfba‘aTASocdlfaBIAMBIAaTafabSaIAf‘TTSM‘M‘bBsecccdddullledaroofdw.13HHSeeuuueesdedeaaaoooooodddoraeeeeesssfpdoiPrrdscatavoaaffflpppfddoooiiiaaTrsdddssstttaaavvntlll4HOSHnGm3tO2hfffkylaS(MIAlrkeotltnnttthhhnnakkkoyyylllotytnoelee0bd0ttt8lllisio.aaahloooyyyeyaatttnnglllu.hddssoooo...cmhhhdttlsa0&wryyysi00hhhdietttttrsssoh,hheeaww‘hnn&kxffrrfeddddiipeee0thhh,,,svhhhhhmL&&&yffeeeggeaduuliotdderoPwye7ltmtlllo‘oiiePeerrrceoiooCwwCCw1ewwwmyyeeellbtmttnrooohfflhalvooonDooocoa9esvafeorrhhuueagmtua/oooaaaeeeocrleiihfffbenstttuuuaaa4u2ubacnlvrhaeerpetaaamllumsstvlhwwwuudgtnvvvhhheiaaadgotttidemmi8yoh’hllgggggtttscederpooeerciisoehhhitrhp,eeeeeeeittteeebkccinoesssteeauehhhrppldyeffyerotscc4poswwweeieee)ateee’srrryyyeerrrr’hT--nanaf.,nmroaaad’’’ofccarroa9aeebfpoaa...ppoccddbla eoooscaaaeenghaSooohiottrrrlalllupbei4...hfcccoepeOnSSSriehnpttrelllvl,oiiiffeaoelpknnniiitsaaaodwiiipovvlll0,,oooldodsuw-eeeeelllpdaidtttoajceehi5lpipnnnr----upeendddanllaaacci2eehhhp,susopppzrruuuhes.odddvs egaceneordp-roahhts..ealrsss4ggesrmennneeespgggdaaaoegosnessh,tcaaayeteeesssfdud.-e eelroaaadpodfeeodddseeon---euecrrrifthpppdddalfffncdOfieeoasfgcttdaaaralllo‘udaocccanase&&&rg mmmbscooaaadddtaaataalaaaksslfekhseur iooofswltttvrisebeleeernsoluiarvvvesrrrlubbcllleeeasetnnsadomcsssllluuuoetlaltwaaalinraaahetooonayadooettteeellctputoysooustttyaaareehc-tttooohdsss‘’leeuuuohdsqrrlghhhetbc,nnnhltneeedvvvrsso,gggeotacccd oen,srrrkulaeeesoooeoguwhvrikkkwllnaaaosssn,teeedddwww1kiioinso‘nnitatrntejekkeymbooocnsiiitttiu/aouhhetetscccnnntirnnnrkiiieeedwu4ooooleettttetttii.hpbcth-iuuu’iiettwhhh.ssohhhesoccbshcwwwetttvvvee.sssatsssccbbbomokdeeee.raoee11Leoooe.sssisrnoo.S‘IBbTMAafaEaaaooateeeeeeiii.rrrucaddr,.lwsaaatttde’htwuueiTu.wwsedefsss?anook.sdhhhonraiii.eesfffssstokkk...wr(nnnnrrpa.fgPpt‘doooboianaggdgsWnnitavowgglPPPrfuiaaangggfff.tHSOonlteshrrreknyliiidekor..r2InInO23O344mOGHHO2HSnmOGIt43tHOmHGtHSSeltloeencannnooooooekkkoooypftrrroilnnneteooosot.hatneee000u000.888fffiiiyosmetteeeamhuauoooohtwttsaaaaaannnnnnggghuuu...tnwoooooommmddaaaoooi000eooogggettnhf,e000hhr000hrddd&tlooofeseveeeeeehhhennnnnnLrrreearrr1rrrdrabiskasssdovvvlmmmLLLsiorrrerggggggeeeaaatdddreowiiikkkewdddttteyddddddeoootpesso’,/ltltttlleeeoooonfheeefeeeLeeefrmeee,,h4nstttnvoonnnorahhhtteffffffuaaaaplllivvvoDDDfcccsssnnnitvvviuaooorrrttt...hsuuuuuuaaahdddmmmaoooSabIAnrfusllllteeiiiiiiwhhhbbbuleeelvhnnnnaavroooduuulctmwwwnnnrrrttteeeeeedrrrlrgtesllllllennnovvverrgsntprdeiiiiiiiodddggghoooiiikdddsssdleeeuoooieekggggggsssccc,ceorrrseeesooooooeee,hwpgeariiieeekkkr,,,afoooeeeemiiigwdeesckkkrnnnyggeps.aaardeaeeelllvdddlffffffoooocmcccnnnccca’fhooosssrniiinihtttioeeefcllna.------dnnnufffhhhnonnnovooonnnenmiiaeoofffeccccccolaaaaohofffolitpppoootttbbbvvccc.deeetccccaulSstopggglahaahhgiiioootttopreigydddafyaaaruuu.bbbnihhhhoooosssappptOOOfvl,ooppprrreeeeewe...elsetnoooipupppkkks,rhjYosss-m5lllgooossspuuudwwwfe-spppraaaacaehssrjjjYYYpeeecrdommm555lllupppdn---eeeeeeelaaaienceaeiiicccpppahossspj....yeseeeeosssgtrvvvneaaacccaamuaocoooddddppp---rrriuaoooosssnesrrrrniccchmmmanpppuexedddoaiiiaooosssseeesssuetccttceodtttsn-nntuuu...xxxeeeritupduuufooonaoooooodeseeeeeeedoooiuciduuutvhefalsooocldmdddnddOOOliiimcaaainsfffadcccsssndaidddrrrallluuuasinnnencccessesssgotiiicfacsekkk‘oskkkpssssugggmmmaiiivpcccfffssswwwaaarrwbelecssseooorelllcuuuhiiiaaas)rrrluneeattaeeeooonnnnearhhheonoccctnnnaeeelhtttttoduiiihnnnotot.snnneaedddttt.touuuuuu-splhhoootttussshdrlohoccctl---nhhhseiefdyshhhdddlllgcpbbbvlsss,eehhhdddmyyyreooopetorh.rklasoooeaeeecdrrehuuuwhhh...vvvrrrriipne’kehoiiirnnnsss.itgnnneeeneeeeeeeec.nrisedoeeeetetrrrirrrkkkebddddudhthfbbb---hewvtsssslsoooscboeasssaasoorrruaoeeeirvbatlulwlsdhiofsolk.nrteonnugrPhagfs’ri.G43InHOmH2StOtreneookornolse008fitieonaanngu.oomkoao0ogtt00doeehnnreroretsvmiLrggeadikdtddtohslteoeeese,stcnhffalveDcsnovort.uuadmoooliihbenrouwnrteearllnuvrwiidgoidsoggiscreooekienkr,oeiknganeldffogcncosigtel--infhnon.iofcca
arate again witabhdeaadnfosotrihfkeyrtooSsuleikcepeerhedeopfwvecermo.gueutscahcbodluiefsfselrieknececoounregleittttleesw, oorrdocliavnesmaankde.other
Serve with meat, c“hSeheesteolodrhoimn itthsaotwshne. loved him”.
.........
nd all the ot‘Qothuseeoruaeikn’ g-inrperodovnieeonrutnnscigaedhntd‘k. yYmoooiux’. lTcigaakhnetsly5. letters when we only actually use just the first.
flavours
.........
etables like‘Bcoowu’r-gseetvteersa, lomr oealinviensgsananddoptrhoenrounced differently depending on context. What

was your first thought? Don’t forget ‘bough’, same sound as one of those of ‘bow’ yet

eese or on its own. means something completely different.
.........

‘Laid’ is pronounced like ‘paid’ but not ‘said’ and ‘said’ is pronounced like ‘bread’ but

not like ‘bead’ yet ‘bead’ is pronounced like ‘lead’ and not ‘lead’ if you follow me!

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

39
Please mention this magazine when responding to these adverts - Thank you

40

Bournemouth Electric Bowls Club

Short Mat returns from 4th October
Each Wednesday from 1:00pm.
All welcome.

For more information contact:

Keith: 07593 559103
Ron: 01202 252291

www.hugofox.com/community/bournemouth-electric-bowls-club-8744

Fruit & Veg Box Winners!

Another happy winner of the monthly prize
crossword.

The July winner, Paticia Warhurst, receives
her prize, here being presented with a
lovely box of flowers, fruit and vegetables
by Roger Oates on behalf of the North
Bournemouth Allotment Society who very
kindly donated the prize.

See page 43 for this months prize
crossword, your chance to win
3 bottles of wine!

The Queen and the visiting American President rode in an open 17th
century coach hitched to six magnificent white horses. As they travelled toward
Buckingham Palace, each looking to their side and waving to the thousands of
cheering tourists lining the streets, all was going well.This was indeed a glorious
display of pageantry and dignity.Suddenly the scene was shattered when the right

rear horse let rip the most horrendous, eye-smarting blast of flatulence, albeit
silent, and the coach immediately filled with noxious fumes. Uncomfortable, but
maintaining control, the two dignitaries did their best to ignore the whole incident,
but then the Queen decided that was a ridiculous manner with which to handle a

most embarrassing situation. She turned to the President and explained,
“Mr. President, please accept my regrets. I’m sure you understand that there are

some things even a Queen cannot control.”
The President, ever thegentleman, replied, “Your Majesty, please don’t give the
matter another thought. You know, if you hadn’t said something I would have

assumed it was one of the horses.”

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

41

FOOT PAIN IS NOT NORMAL...

We should’nt put up with painful feet. Pain is an indication that something is wrong.
Many foot problems are related to wearing incorrect footwear.

When patients complain of foot pain,
I examine their feet and listen to what
they are saying .But my eyes are always
diverted down to look at the shoes
which very often are the cause of the
problem. When I express concern
about the footwear I am immediately
told “But you must be wrong as they
have worn this style of shoe for many
years AND THEY DON’T HURT!!”

An elderly Italian lady who’s problems
directly related to wearing ridiculous
fashion shoes was affronted when I suggested wearing trainers.
I thought she would probably not return but a year later she did wearing a trainer style
shoe I cut her nails we chatted about her family she didn’t mention any pain I didn’t
comment on her footwear.

So shoes are so important to healthy feet. It’s not just the style its how well the shoes fit.
There should be ½ an inch space beyond the longest toe and the end of the shoe. Feel
across the width of the shoe with the hand to make sure it’s not too tight. Lastly the heel
should fit in the back of the shoe and not slide up and down when walking.

I prefer a shoe with a Velcro strap or a lace up as they
give more support and they’re adjustable. Lace ups
when fastened should have a gap between the laces of
½ an inch. Most feet swell during the day so it’s better
to buy shoes in the afternoon. Shoes are so important,
do not impulse buy, shoes bought in the sales cannot
be returned so they not always the best choice.

So to reiterate...

FOOT PAIN IS NOT NORMAL! SEE A PODIATRIST

A H PARFITT CHIROPODIST / PODIATRIST
533-535 WIMBORNE ROAD
M.Ch.S., D.Pod.M. WINTON BH9 2AP

STATE REGISTERED

HPC REGISTERED

Tel: 01202 528942

Please mention this magazine when responding to these adverts - Thank you

42

There is no beating the taste of truly fresh
fruit and veg especially, when it’s yours!

Gardening Tips for September

The days are becoming shorter in September and the rich harvesting of your fruit, vegetables and cut
flowers is reducing too. However there is always something positive to do for the keen gardener or

allotment holder.
Lawn Care:
Now is the time to sow a new lawn or make repairs to your worn out patches. There are of plenty
of patch repair kits in the shops and garden centres to choose from, many include a fertiliser. Doo
remember to ensure the seed is in contact with the soil and sprinkle with potting compost to conceal it
from greedy pigeons.
Fruit Care :
If you have Autumn fruiting Blackberries and Raspberries do keep them netted to prevent bird damage
and loss of fruit. It is important to check daily in case any birds have become trapped. There are still
juvenile birds around at this time of year. As a result of our experience on the allotment we now leave a
narrow opening at floor level to allow any trapped birds to escape.
Flower Care:
If you intend to grow Sweet Peas next year, later this month is a good time to soak the seeds to chit prior
to sowing indoors or an unheated greenhouse. Once sown in the ground next March or April, you will be
rewarded with an early flurry of colour and sweet perfume.
As the last of the Rose blooms fade a clear dead heading should be carried out. Any taller stems can be
reduced to minimise the risk of wind damage.

Gardening Tips for October

Our crops have given us mixed results again this year. Everything
seemed to be ready early and was over almost too soon to get the full

enjoyment of them. Although, I always say we get far more out of
the garden and gardening than the effort we put in. It is now time to

tidy up and prepare for next year.
Lawn Care :
If moss is a problem, now is the time to feed and treat the lawn with
a mixed Autumn dressing containing ferrous sulphate to kill off the moss.
Kitchen Garden :
Begin planting Garlic in rich soil containing well-rotted organic matter. Single cloves, up to 4” / 10cm
deep & 7” /18cm apart. Clear away old leaves around Strawberries to prevent a build-up of pests and
diseases. Complete any earlier planting of Onion sets. Plant out Spring Cabbage plants. Harvest any
remaining Squashes and Pumpkins, curing them indoors in the warm for 10 days or so to harden off the
skins.
Flower Garden :
Sow next year’s Sweet Peas. Here is how…make a nick in the seed skin with a knife then rub with
sandpaper before leaving the seeds overnight on some damp kitchen roll ( Do not Soak Them). This
should give you an early start. My wife uses Root Trainers for sowing, before placing them in our
unheated greenhouse. You could use the window ledge of an unheated room in the house.
Lift Gladioli and Dahlias, keeping the in a cool dry place to over winter.
Plant up your Spring flowering Narcisi bulbs either in the borders or in pots. To avoid Tulip fire wait
until November before planting Tulips. Tulip fire is so called because it resembles fire damage, it is a
fungal infection similar to the Botrytis that so quickly annihilates Potato crops.

North Bournemouth Allotment Society, Cornelia Road, BH10 4FG
www.northbournemouthallotmentsociety.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

On The Road 43

123 456 7 Prize Crossword

89

10

11 12

13

14 15

16 17

18 19 20

21 22

23 24

25

26 27

28 29 Enter this month to win
3 bottles of wine
© Chett - August 2017

s Across and be on receiving endDoof wa n Down
1. Go wrong 1. Nudge cockney lass off protection at the

loud bang (8) fairground (6)
wrong and5.bTeraonnsproerctedirvivinegr oennhdoolifdaay which1re. aNlluy dge2c.oHcokldnecyloslaesasndofcfypclreootencftoior ngeaatr change (11)
bang (8) isn’t a break (6) the fairgr3o.uWnadrn(6er) Brothers rooster warns shipping
mnbsirpneoaartktiod(n6rs)ic1(8v5hf.0eo,uI.r6rlrTl)couhghnmroo(lihf5wne)aorttlshiiodetnaobsyadflowlrriihnvgteiocolhffmoerrrisnweeataolbrlyddefrsoivree ft2c3ohhr..ewaHWanoragdlrdesn(ce1la4r5ro1ow..Bsa)FMaedreyeol(ati(tn3hn6he)o)dedwrcosayftrccsohlueoepsrpotionserrtcfiaonwurgaggtrhrentoasuinrsethrse
11. Ted has his wits about him, thougshhipping rainwgaryoa(6d)(7) middle of the
on American

hrow the bdaildlni’nt tdorivmeisnterabigehfot roen t(h6)e 4. Feline 6w.aAtdcdhseorniesncaamueghtot pirnovthidee some direction
h (5) shtirsa1o1giwgno43hiic..nteTMtsgamooakatnoberoorsro(eu6usonIp)utdosthraattihindmtedh(,laa7otrt)aohcnuaoncmuadger(haf7rg)oamintahnisdrA5mraa.mciiydMseeddresliitnechaoonfd(7d95te..rho)isSDnfechoegsodrnurgorttpyoal(yapd8mddo)a(er3n(vt7)oien)elogupvtrnreooitusaeskeefrossrfipovienlowtsitrhapsiodme
d has
drive
kes out th1e6.loYaoun mcaigrhat greaginretatnhdisrFariesnecsh road6.(3A)dds osntreainna(m7)e to provide some
more I said17(7. M) inimum horse power required tdoimreocvteion 1(52.) It’s really tough or hard to get directly
oautroomruisngpdhotratrn2s1uetdo81nghm..draaeePTetrtrhooocewttufwahyentmiosrhsdter(eeeF3e(csf7)rrlrtue)ootbnhrmseecrmhvtteheorhmiotsihacblerdeearflos(ca3ny(t)7ctd)oaiuknersgei97dvwee..intsSDhcbhoeiodlnlrgttyl(y8t1(1mh765)de)..aerPTnevaueotlthkleotiuhaspbrvwoornuaeuoygtithst(ahe7oke,n4efoaes)trshfppilveaietlcioecwtsseiaqtrnhuadippcmihdeenctk htheesaid
nimum horirgshet?p(o7w) er required to move some strakinnow(7le) dge learning (8)
two (3) 23. Drive the Spanish around to com1e 2u.pIt's re1a9l.lyI tsowuegrvheotor ahvaoridd tthoegoentlookers (7)
howefyetrhstereeceslrtuotbrws22hesu65eirpt..mhvpMPtoeotueihhrstmttetihoac(bguk5eloeete)forntlosodlaynstd(o7(rtcuy7)aor)koulpeeriesngreiiyovwnseoniotnnhbghieloltvsebracrc1dhak5iefrto.esnTcataildylk(t7ah222r)ub420eb...robeYOTuehouttreuhtt(dyihn7’osle)eloewbradedattihyfsooplu(ell7anaty,iyd4csaw)eomiqftahurnaispwoinmmhsioeedrndestresipvooeuwrrsceeorno(f6t)yre
(7) track (11) 16. Put thcoruorusgeh(5o)nes paces and check
rive the Sp2a8n. iBsehlieavreosuwnidthtooutcdoomubetuthpat FordtMhoedkenl ow2le7d. gIne slehaorrtntirnegat(m8e) nt for Ernie’s stock on
uhteoguototdosd(2cr7oy9)r.roRopodiaendsiso(6nn)oot ntohrnovuperbcyratwftisters (8)1290.. I swerflvoeatto(3a)void the onlookers (7)
rt (5) You need to lay a man inside source
stakenly leePrlyeassoenmgeenttsiobnatchkisomn agazin2oef2wt.yOhreeuntrdureobsobpreodrnid(s7ipn) lgaytos
our tohfersaewadhvoerrtsse-pTowhaenrk you

(11) (6)

44

PRIZE CROSSWORD ENTRY FORM

Send your completed entries to:
September Prize Crossword, The Local Eye,
22 Oswald Road, Moordown, Bournemouth. BH9 2TQ

Name: ________________________________ Tel:____________________

Address:______________________________________________________

Address:______________________________________________________

Closing date for entries is Tuesday 19th September

Congratulations to Mrs P Warhurst of Mortimer Road who won
a box of locally grown seasonal vegetables courtesy of
North Bournemouth Allotment Society.
Enter this month for your chance to 3 bottles of wine

July Solution Brain Power

Solution > Beastly Business 1: £36 : 36+36+18+9+1=100

1C O 2P Y 3C A T 4S 5H O 6P O F 7F 2: You can get 20 blue cards for 8 yellow cards.
1 yellow = 2 red, 8 yellow = 16 red, 4 red = 3 green,
ARY I EE I 16 red = 12 green, 3 green = 5 blue, 12 green = 20 blue
T A 8C O 9T T O N T A I L S
1P0 H I A L O 3: 100. The group with one leg each averages one leg per person. The rest
CL H are split into 2 equal groups. One group has no legs, so the other group
A R O O 1D1 O E S 1K2 I N must have 2 legs each, meaning these 2 groups average one leg per child.
1W3 H I P P E T O I E Therefore, overall, the average is one leg per child, therefore there is a
E S 1R4 E 1D5 P O L L T total of 100 legs.
1T6 O W 1L7 E S
UE 4: The hands on a clock (hour, minute, and second).
A 1O8 A T 1M9 E A L 2A0 E
A 2O1 X C A R T 2S2 5: All Bobby has to do in order to be the winner is use hot water.
BL Danny, being less cool than Bobby, didn’t know that water with a hot
2B3 U F 2F4 A L O U C W U average temperature freezes faster than water that is at room temperature.
Y E L S 2U5 S H E R The phenomenon that hot water may freeze faster than cold is often called
2C6 H I M P A N 2Z7 E E S A F the Mpemba effect.

A URO E L E Picture Box Answers
2T8 A R R E D 2O9 V E R B E A R
1. Tripod
August Solution 2. Man about town
Solution > Plant Life 3. Wish upon a star
4. Without a 2nd glance
1S 2S 3S 4E 5P 6C 5. Turn the other cheek
7H A W T H O R N S 8O A T H S 6. Go up in smoke
L R Y Z 9S P E
1M0 A H O G A N Y 1T1 H I R S T

D V BMA L T
1H2 E B E 1E3 G G P L A N T
1K4 A S O U
1G5 I N 1S6 E N G 1A7 1C8 O N I T E
1C9 A
WA S
2V0 I C T O 2R1 I A 2P2 E 2A3 T
F S E T S S 2F4
2G5 R O U N D 2T6 H I S T L E S

UMSAC E N
2L7 I L A C 2L8 I Q U O R I C E

TS LMNE

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

45

ft

MKEcCVAIRNTHY
THROUGH THE CAKEHOLE BBC1
SATURDAY NIGHT LIVE ITV1 Support from:
“The Ad Lib Expert” The Stage

FRIDAY 29th
SEPTEMBER 2017
BOX OFFICE
0w1w2w.0co2as3ta1lc6om3e1d6y.com

Advanced tickets £12 Sean
Doors open 7.15pm
£16 on the door. Show starts 8.30pm McLoughlin
Hotel Celebrity

‘BEST NIGHT OUT’47 Gervis Road

Bournemouth
BH1 3DD
Over 18’s only Adrienne Coles

Acts may change due Also online at:

to TV commitments

Please mention this magazine when responding to these adverts - Thank you

46
Dorset Driver Gold (DDG) at SafeWise Bournemouth

eWise road safety initiative dates for publication

Driving skills and confidence sessions helping people aged 65+ drive

safely for longer. The theory session costs just £10 per person and

orset DriverlGasotlsdu(pDDtoG3) ahtoSuarsfe, WbreisaeksBoaundrnreemfroesuhtmh eanntds SaarefeiWncilsuedWede–ymthoeuntehxt
ving skills andtchoenofirdyendcaetseesssairoenslihsetlepdingbepleoowpl:e aged 65+ drive safely for
nger. The theor•y session coSstasfjeuWst £is1e0 Bpeoruprenrseomnoaundthlasts up to 3 houMrs,obnredaakys a2nndd October – 1.30pm

reshments are• included – tShaefneeWxtitsheeBoroyudranteesmaroeultishted below: Thursday 7th December – 1.30pm

• SafeWisTe hWeeypmraocuttihcal session coMsotsnd£a4y515ptehrMpaeyrs–o1n0aamnd lasts up to 90 minutes. Once your booking form

• SafeWisaenBdoupranyemmoeuntht have beenMroencdeaiyv5etdhyJuonue w– 1il.3l 0bpemgiven details to arrange your drive directly with one

• SafeWisoefWoeuyrmDouotrhset Driver GMolodnAdapyp1r0otvheJudlyD–r1iv0ainmg Instructors (ADIs).
• SafeWisIefByoouurnteamkoeutuhp a practicTauleasndadyt1hsetoAruygussets–si1o.3n0pthme cost is just £50
• SafeWise Weymouth Tuesday 12th September – 1.30pm

• SafeWisFe oBroumrnoermeoiuntfhormation pMleoansdeayv2isnidt OthcetoDbeorr–s1e.t3D0prmiver Gold webpage
• SafeWis(esWafeeywmiosuet.horg/dorset-drTivueesrd-gayo1ld4/t)h oNrovceomnbtaecr t–t1h0eamDDG Administrator on [email protected] ,
• SafeWisreinBoguornretmexout t0h7713 499 T7h7u7rs(dwaye7wthilDlecceamllbyeoru– 1b.a3c0kpm)

e practical sesosironlecaovstes a£4m5 peesrsapgeresoant aSnadfelaWstsisuep htoe9a0dmoifnfiucteeso. Onn0ce12yo0u2r 5bo9o1k3in3g0f.orm and payment have been received

u will be given details to arrange your drive directly with one of our Dorset Driver Gold Approved Driving Instructors (ADIs).

you take up a pLraicftiecaDl arnidvtehetohryesoesrsiyonstehesscoiostnissjuastt£5S0afeWise Bournemouth

LifeDrive is designed to reduce accidents by helping younger drivers to understand why collisions
rmicmeinooirsnetr0ian1tf2oo0rr2mon5aha9tdna1idodp3gnp3p@0per.lnsaeaacafsteniewcdvaisihlseiost.oewtrhsgest,ioDorionanrgsvs.eootirdDtertixhvtee0rm7G7,o1dl3de4wv9ee9blo7p7pa7gine(wg(setahwfeeiwlilricssaekl.loiylrolgsu/dabonardcske)et-oxdrprlieevreairve-egnoacledm/we)soistrahcgoefnrateatecStaptfohesWetD-istDeeGshtetahdeory

This FREE scheme is open to all young people aged between 17 and 25 who live in Dorset and

eDrive theohrayvseespsaisosnesdattheSiarfedWrivisinegBtoeustrnweimthoinutthhe–pvaasrtiofouusrdyaetaerss.
eDrive is desigAnedFRtoEreEdu£c5e0acAcimdeanztos nbyvhoeulpcinhgeryoiusnggievrednrivteorsetvoeurnydoenrestathndatwchoymcopllliesitoenss thhaeppceonuarnsde!how to avoid them,
veloping their Tskhilels nanedxtexLpiefreieDncrievweitdhaftreese aporest:-test theory and practical sessions. This FREE scheme is open to all young

ople aged betw• een 17 andT2u5ewsdhoayliv1e9inthDSorespeteamndbhearv2e0p1as7sed their driving test within the past four years.

FREE £50 Amaz•o n voucherWis egdivnenestdoaeyve1ry8otnheOthcattocboemrp2le0t1es7the course! The next LifeDrive dates are:
• Tuesday•1 9th SeptemTbheurr2s0d1a7y 23rd November 2017
• Wednes•d ay 18th OcTtohbuerrs2d0a1y7 7th December 2017

• Thursday 23rd November 2017

• ThursdaFy o7trhmDoecreeminbefor 2rm01a7tion, look at our LifeDrive page (safewise.org/education/life-drive/)

r more information, look at our LifeDrive page (safewise.org/education/life-drive/)

ScootWise, Mobility Scooter Training at SafeWise Bournemouth –

ootWise, MSoabfieliWtyiSsecoaorteewr TorrakiinnignginaptaSratnfeeWrshisiep BwoiuthrntheemDouotrshe–t C21lisnticJualnCe o2m01m7issioning Group to deliver
feWise are worskainfegtiyn paawrtanreernsheispswcitohutrhseesDofrosretmColinbiiclailtyCosmcmooistseiornuinsgerGsroiunpDtoodrseelitv.eTr shaefestyesaswiaornesneasrsecoduerssiegsnfoerdmfoobriltihtyose
ooter users in Daolrreseatd. yThuessiensgsioanms aorebidleitsyignsecdofootretrhosrethaloresaedtyhuastinagrae mlooobkiliitnygsctoootbeuryorathmosoebtihlaityarsecloookteinrg. Ttohbeusyeassions

obility scooter.cTohsets£e1ss0iopnsercopset r£s1o0np.eAr pllersseosns.iAolnl ssemssiuosnts bmeusptrbee-bporeo-kboeodkeddudeuteotolimlimititeedd pllaacceessavaavilaaibllaeb. Tleh.e next
ootWise datesTarhee: next ScootWise dates are:

• Wednes•d ay 21st JunFer–id1a0y301h3rsthtoO13c0to0hbresr – 1030hrs to 1300hrs
• WednesFdaoyr 9mthoAreugiunsfto–rm10a3t0ihorns,toin1c3l0u0dhirns g booking instructions please look at our ScootWise page
• Friday 1(3sthaOfecwtoibseer.–or1g0/3e0dhursctaoti1o3n0/0shcrosotwise/)

more informatioIn’,minclnuoditngsaboyoikningg linestt’rsucgtioonskpillelaaselllotohkeatsotuurpSciodotpWeiosepplaeg.eI(’samfewjuisset.osrga/yedinucgatlioent/’sscoroetmwisoev/)e all

keability at SafeWise Weymotuhteh –wBi2kae7ratnbhiilnMityga! Hylao&wbe2‘alnwsdeasJounmndee‘lwe.ot..u.tl.hd..ei.t.bperiof yboluermchilwd coorukld itself out. bike

e CYCLING seriously: don’t miss out on learn about basic
ntenance, road safety, signalling aGndomnaenoaeruevrtinhgeskdillas yinsanwahmeanzingg iorultsdocoor orokadedsafleitky ecenthtreeiarndmToHEtNheprust .the skills they’ve
rnt into practice by venturing out onto the roads suNrrouwndtinhgetyhedsarfientykcelniktre?tWhehaitr’sfmatohree, rasll.of this for FREE!

...............

more information, inIcldudeicngidbeoodkitnog icnhstarunctgioenscpallelaisnegloothk eat bouartBhirkoeaobmilitythpaegeJo(shafnewaisned.orrge/endaumcateiodn/ibtiktehaebilJitiym/).
aces are allocated on a ‘first comIef,efierslt sseorvemd’ubcashis.bTehettdeary syoauyricnhigld Iis walloecnattetdowtilhl bee Jdiempentdhenist omn aogren/aibnilgity. and

mbers.

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com

47

*** LOWEST PRICE MATCH PROMISE ***

Surewise.com

Mobility Scooter
ISnusreuwrisae.ncocme

Are you covered?

• Damage to Scooter • Theft • Accidents
• Property Damage • Breakdown • Puncture

Underwritten by 01268 200 020
The Salvation Army General Insurance Corporation

www.surewise.com

*** NO HIDDEN FEES ***

Please mention this magazine when responding to these adverts - Thank you

48

Horizon Live-in Care provides professional, To learn more about our
fully qualified and experienced 24-hour live-in care services,
live-in care services across Dorset, please contact us on
Hampshire, Wiltshire and Surrey for a wide
range of people including the elderly, the 01202 737456
infirm and those with mental health needs.
HORIZON LIVE-IN CARE
Your Horizon Live-in carer enables you to 1430a Wimborne Road,
continue to live your life in as much comfort Bournemouth BH10 7AS
and freedom as your condition allows. It [email protected]
means you can stay in your own surroundings,
maintain contact with neighbours and
retain beloved pets. Our live-in carers are
homemakers too; they are all as house proud
as the people whose homes they share and, as
well as performing day-to-day chores, provide
continual companionship and reassurance
through difficult times.

www.horizonliveincare.co.uk

To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com