The AUGUST
Local EyeIssue 2017
142 Advertising For Local Businesses, Trades
and Community Information...
Carpet Rugs Wood
Laminate Vinyl
Carpet Tiles
Luxury Vinyl Tiles
Commercial Flooring
Visit our new Karndean flooring showroom
01202 524052
www.cutwisecarpetsbournemouth.co.uk
39/41 Charminster Avenue, Bournemouth. BH9 1RR
2
D Learn To
A
N Dance Now
C
E
D Specialists in the following:
A
N *Ballroom
C *Latin
E *Junior Street
*Ballet & Modern
D *1st Wedding Dance
A
N *Adults
C *Juniors
E *Tiny Tots
D ANGLO DANCE STUDIOS
A 93a Chatsworth Road
N Bournemouth BH8 8SN
C Tel: 01202 514551
E www.anglodance.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
3
Nu Staff are a family run business, we are local, reliable and dependable.
We have over 48 years of experience providing care in the community
Nu Staff believe continuity of care is extremely important, we recognise
how intrusive our job can be on the individuals for which we provide care.
All our staff are PROUD TO say they CARE being both
friendly and approachable.
We ensure our carer’s receive the best training and support to deliver
the care you rightly demand.
Nu Staff fully support Bournemouth Borough Councils
PROUD TO CARE initiative.
01202 292870
Our services include:
• Assistance with personal care
• Help with medication
• Meal preparation
• Light domestic duties
• Laundry
• Waking or sleeping nights
• Companionship and outings
• Respite sits
Visit times can range from 15 minutes right up to 24 hours a day
We provide care in the Bournemouth and Poole areas, if you or a loved one need
support please give us a call to discuss your requirements or we can arrange for a
member of the team to come and meet with you in your own home
www.nustaffimageplan.co.uk
602 Wimborne Road Winton Bournemouth BH9 2EN
Please mention this magazine when responding to these adverts - Thank you
4
Welcome to the August issue of e Local Eye
is magazine is delivered free to an alternating selection of around
13,000 homes and businesses in Bournemouth, mainly through the
Charminster, Queens Park, Moordown, Ensbury Park, Redhill, Winton,
Muscliffe & Strouden Park districts.
It can also be picked up from:
e Bournemouth Life Centre in Moordown, Mike Stokes Tyres and
Johns Fish & Chips in Moordown, KwikFit Castle Lane,
e Hungry Wolf Cafe & AH Parfitt - Chiropodist/Podiatrist in Winton,
and Charminster & Winton libraries, Moordown Community Centre,
as well as several laundrettes in Charminster, Moordown & Winton.
More information on rates and ad copy submission as well as online
copies of the current and previous issues can be found on the website.
01202 255485 / 08000 430485
07801 474788
[email protected]
www.thelocaleye.com
Until next month..
Chris
The Moordown Traders Association are an enthusiastic group of business
owners from the Moordown community who have come together to promote
local trade and raise the profile of Moordown as a shopping and business
destination, to support local traders and enhance local businesses.
We meet regularly, work voluntarily and liaise closely with the Bournemouth
Chamber of Trade & Commerce (BCTC), Bournemouth Council, elected
Members and local media to ensure that the Moordown trading district is
represented in a positive light.
The Moordown Traders Association meet monthly between 6pm-8pm
upstairs at the Moordown Conservative Club in Balfour Road.
All Moordown traders & businesses are welcome.
Come along, air your views and meet other local business people.
Drinks available at the bar and sandwiches are provided for the peckish.
Next meeting date is:
Tuesday 19th September (No meeting in August)
For more information visit: www.more2moordown.com
Every effort has been made to ensure that the information contained within this publication was correct at the time of going to print. We
cannot be held responsible for any inaccuracies in advertisements, editorials or features nor for any consequences arising from these. We are
not to be held responsible for any errors, loss or damage to copy in printing. The Local Eye does not officially endorse any advertising material
included within this publication. It is the advertisers responsibility to ensure conformity with laws and/or acts relating to Trade Descriptions,
Sex Discrimination, Consumer Credit, Copyright etc. No part of this publication may be reproduced, stored in any retrieval systems or
transmitted in any form - electronic, mechanical, photocopying, recording or otherwise - without the prior permission of the publisher. The use
of this publication for canvassing, direct marketing or any other activity apart from sourcing local goods and services, is strictly prohibited.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
5
Please mention this magazine when responding to these adverts - Thank you
6 Zoe Bellamy
WINTON WOOL SHOP BSc.Pod.Med - M.Inst. Ch.Pod
CARLY‛S CRAFTS Chiropodist / Podiatrist
Stockists of:- CHIROPODY
HOME VISITING
NORO ~ DEBBIE BLISS
PATONS ~ RICO SERVICE
IN YOUR AREA
STYLECRAFT ~ SIRDAR
ROWAN ~ KING COLE For total footcare please call
Large selection of Patterns, 01202 309932
Needles and Accessories
24 HOUR ANSWERING SERVICE
Shop 1, 1a Cardigan Road
(road opposite Poundland)
Winton BH9 1BJ
01202 512106
Delivery Service available
Disney Crafting Hour
at Charminster Library
Saturdays > Fornightly > 10-11am
Drop in sessions to make & take crafts based on Disney Characters
Contact the library for more information on dates and themes
Tel: 01202 510379 Email: [email protected]
A piece of yarn walks into a bar and orders a beer, but the bartender snarls, “We don’t serve your kind
here!”. The yarn is forced to leave. While sitting on the curb feeling sorry for himself, the yarn is suddenly hit
with a brilliant idea. Working quickly, he ties himself into a knot and unravels his ends. Taking a deep breath, the
yarn marches back into the bar and orders a beer. “Hey!” says the bartender. “Ain’t you that piece of yarn I just
threw outta here?” “Nope,” replies the yarn, “I’m a frayed knot.”
..........................
Why did the hog farmer give up knitting? He didn’t want to cast his purls before swine!
...........................
How do knitters travel in San Fansisco? By cable car!
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
7
GET AN
EXTRA
%
OFF
STOCK ITEMS
WITH THIS VOUCHER
L. EYE. Not to be used D THE COST WIT
in conjunction with
0%
any other offer
INTEREST
SPREA H
SUBJECT TO CONDITIONS
CARPETS, FLOORING, • OPEN 7 DAYS
BEDS & BEDROOM FURNITURE • FREE ESTIMATES
• 100’S OF BIG BRANDS
PLUS!WE WILL BEAT ANY LIKE • HUGE RANGE OF MATTRESSES
FOR LIKE WRITTEN QUOTE! • 100’S OF RUGS
• DISPOSAL OF OLD FLOORING & BEDS
Nuffield Industrial Estate, btehed
Poole, BH17 0RR, Tel: 01202 723162 store
Ferndown Industrial Estate,
WIMBORNE BH21 7PE, Tel: 01202 872240
www.carpetsandbeds.com
Please mention this magPaozoilneN,euBfwHfi1eh7lde0nIRnRdr,ueTssetprl:ioa0l1nE2ds0ti2ant7ge2,3t1o62these adverts - Thank you
Ferndown Industrial Estate,
8
SUDOKU
How to Play
Fill in the grid so that every
row, every column,
and every 3x3 box
contains the digits
1 through 9,
with no repetition!
Simples!
You solve the puzzle with
reasoning and logic,
there’s no maths involved
and no adding up.
It’s challenging.
It’s addictive!
It’s fun.
(Solution on page 44)
SUDOKU TRIVIA
Sudoku stands for “suji wa dokushin ni kagiru” Sudoku, of course,
comes from Japanese, which means, “The numbers must occur once”
or “The numbers must be single”.
The first Sudoku puzzles that resembled magic squares developed
in France. Two newspapers, “Le Siecle” and “La France” began by
removing numbers from magic squares. Although arithmetic was a more
important factor than logic in these early puzzles, they were the beginning
of the Sudoku trend.
The placement of numbers in a Sudoku puzzle has more impact on the
difficulty than the quantity of the numbers. In fact, the addition of new
numbers would not be nearly as significant as simply moving some
numbers around. Of course, some additions would be more helpful than
others.
To seasoned puzzle solvers, it may be astonishing that no Sudoku grids
are repeated in the hundreds of books that have been released. This is
because there are approximately 5 billion possible permutations.
This number represents essentially different grids. The different
permutations for Sudoku answers that are correct tops out at over 6
sextillion, or 6 * 10^21!
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
9
Garden Tidy Up
Hedge Cutting
Turfing
Lawn Treatment
Waste Recycled
Patio / Driveway Cleaning
For urgent jobs, one offs, or
regular fixed price service call:
01202 805 375
www.EdsGardenMaintenance.co.uk
Please mention this magazine when responding to these adverts - Thank you
10
Hi, My name is Smokey and I am an 18 mth old Staffie.
I am very bouncy and playfull. I love my walks and also my
cuddles. I do get very excited. I will need an experienced
home. I would also benefit from attending training classes. If
you think you are the person or family for me, please contact
the office on the number below.
We also currently have lots of rabbits and guinea pigs
looking for their forever homes.
Waggy Tails has several events in the coming months. Please support us so we can
continue to help these animals. They all deserve our love and their forever home.
Are you a singer or Musician?.
Waggy Tails Rescue is holding a Variety Concert at Q. E. School Wimborne on 9th Sept.
We are looking for acts to appear to help raise much needed funds.
Please call us on 01202875000
For more information on Smokey or any of the other animals in our care please contact
us on 01202 875000, e-mail: [email protected]
or visit our website www.waggytails.org.uk
Waggy Tails Rescue is a registered charity based in Dorset; we rescue
and rehome dogs that have been abandoned, neglected or otherwise in need of a new
home.
We also find homes for other small furries that may be in our care. To find out more you
can contact us on the number above or send donations or letters to:
Waggy Tails Rescue, Helens House,
143 Magna Rd, Canford Magna
Wimborne, BH21 3AW
** These are not Waggy Tails animals, just very guilty ones!
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
11
50% off available on selected lines only, 0% finance available on items over £600, subject to terms and conditions
OUR LONG AWAITED SUMMER
UPTO
BEDS | BEDDING|CARPETS&RUGS | SOFAS | CURTAINS | FURNITURE | COOKSHOP|GIFTS
HELSINKI 135cm bed frame with slats.
BEDROOM COLLECTION Was £1125 NOW £559
NOW AT 3 drawer night table.
HALF Was £315 NOW £155
PRICE! 2 door wardrobe with drawer.
Was £1575 NOW £785
5 drawer tall chest with mirror.
Was £1125 NOW £559
HURRY! SALE ENDS 26TH AUGUST 0%
STURTONS & TAPPERS INTEREST FREE FINANCE
Winton - 426 Wimborne Rd, Bournemouth, Dorset, BH9 2EZ AVAILABLE
Tel: 01202 512345
Wimborne - 20 East Street, Wimborne, Dorset, BH21 1DT
Tel: 01202 883311
www.sturtons.co.uk FREE PARKING
FREE Delivery within 30 mile radius of our stores.
Please mention this magazine when responding to these adverts - Thank you
12
Derek J.Rolls
Independent Estate Agents & Valuers
Ask The Agent
Q. I’ve just had a valuation, and as it was being done, the agents asked if they could
bring someone round to view my home straight away, even though I haven’t formally
appointed them yet. Advice, please!
A. I totally understand that at first glance, this might sound like brilliant news.
However, there are a couple of issues you might want to consider first..
To start with, there’s the little matter of the law. This states quite unequivocally that
you must be in possession of a signed agency agreement (which in any case entitles
you to a 14 day cooling-off period), and the agent must have commissioned an Energy
Performance Certificate for your home (unless it is exempt), before any marketing an
take place. If either of these two things have not been done. then both the agent and
you are breaking the law. And by the way, don’t believe this agent if they try to claim
that a quick advance viewing doesn’t constitute marketing, because It does!
Now, of course, this might not overly bother you. But just think: when it comes to
selling what is almost certainly your single most valuable asset, do you really want to
use an agent who’s apparently prepared to break the law - even if it’s in return for a
reduced fee? In any case, besides these little legal niceties, there are a couple of very
practical points to consider. If you give this one buyer - who is clearly on some kind
of inside track with the agent - the huge advantage of seeing your home before anyone
else. how can you be sure that the price they offer is really the best you could get? It
is often said that the first offer is the best one. But this is more applicable in a market
where buyers are spoiled for choice. That is certainly not the case in the current market,
where there is not enough stock to meet demand. Consequently, the last thing you
should be doing is jumping at the first offer that comes along. Besides which, even if
you like the offer that this alleged buyer is prepared to make, how can you be sure that
they are actually in the best position to complete the purchase within your chosen time
frame?
So, my advice is to politely decline this kind offer. take your time in choosing a
professional agent who sticks to the rules, and let them do what they are actually
paid to do - which is to market your home properly to the widest possible number of
potential buyers, using all their skills and all the tools at their disposal!
01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG
www.derekjrolls-estateagents.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
13
Derek J.Rolls
Independent Estate Agents & Valuers
NO SALE NO FEE. COMPETITITVE COMMISSION RATES
TAHLURLISERMSQGOOOUEFLRNFIDREITBCELYEDY!!
We believe that the housing market and prices are stronger than
ever so now is a great time to achieve the best price for your
property. Please call Derek or Martin on 01202 525778 or email
[email protected] for a free market valuation.
We have a combined 50 plus years of knowledge and experience
in selling homes in the area so truly do know what your property
should be worth in today’s market.
01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG
www.derekjrolls-estateagents.co.uk
Please mention this magazine when responding to these adverts - Thank you
14
“Bourne2Sing”
Male Voice Choir
Future Concerts are: (Fridays - Performances commence 7.30pm)
8th SEPTEMBER VERWOOD METHODIST CHURCH, VERWOOD
22nd SEPTEMBER SHELLEY THEATRE, BOURNEMOUTH
13th OCTOBER ST MARY’S CHURCH, FERNDOWN
17th NOVEMBER VICTORIA SCHOOL, POOLE
More information on Bourne2Sing and further Concerts can be found at:
www.bourne2singchoir.uk
Charminster Afternoon Townswomens Guild
Trinity URC Hall, Sutton Road - No meeting in August
Next meeting - 2pm Tuesday 28th September
Come and meet us and make new friends, and find new interests!
Further details from our secretary,
Margaret, on 01202 512543
Redhill
Townswomens Guild
Hillview School, Hillview Road
7pm every 2nd & 4th Tuesday of each month.
We have a wide range of speakers and different social sections, choir,
craft group and a reading group.
This friendly group of ladies always welcome visitors and new members so
come along for a chat.
For more information please call: 01202 240815
A wife was making a breakfast of fried eggs for her husband. Suddenly, her husband burst into the kitchen.
‘Careful,’ he said, ‘CAREFUL! Put in some more butter! Oh my God! You’re cooking too many at once. TOO
MANY! Turn them! TURN THEM NOW! We need more butter. For goodness sake! WHERE are we going to get
MORE BUTTER? They’re going to STICK! Careful. CAREFUL! I said be CAREFUL! You NEVER listen to me
when you’re cooking! Never! Turn them! Hurry up! Are you CRAZY? Have you LOST your mind? Don’t forget to
salt them. You know you always forget to salt them. Use the salt. USE THE SALT! THE SALT!’
The wife stared at him. ‘What in the world is wrong with you? You think I don’t know how to fry a couple of eggs?’
The husband calmly replied, ‘I just wanted to show you what it feels like when I’m driving.’
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
15
New Van! Same Great Service!
Extensions - Loft Conversions - Conservatories - Property Maintenance
07525 805091
Local Bournemouth Company - Established 25 Years
Previous Projects Available To View - Meet Our Happy Customers
Isn’t there
something you’d
rather be doing with
your spare time?
Could you use some help with your Cleaning, Ironing or Both?
• Regular hourly rate only £11 - £12 per hour
• One off spring cleans available - call for price details
• Times and hours to suit you - (minimum 2 hours per week)
• Reliable, honest, professional service
• Insurance provided
Call 0800 0925 773
Email: [email protected]
You deserve a rest... So be served by the best
Please mention this magazine when responding to these adverts - Thank you
16
VETERINARY CLINIC
144 Richmond Park Road
Bournemouth, BH8 8TW
Are you struggling with the costs of private vet care?
We offer affordable veterinary services for your pets
Consultations £15 Boosters from £22
Neutering from £30 for cats, £51 for dogs
You could be eligible if:
• Your household has a low income
• You are a pensioner
• You receive means tested benefits
For more information on how to register
Please call the clinic on 01202 526520
Monday – Friday 9.30am – 4pm
Registered Charity No. 205126
A woman took her parrot to the vet Picture Box
which appeared stiff and lifeless.
A simple question of say what you see?
“I’m sorry madam, but the parrot is dead” For example the first one below is?
the vet announced. “How can you tell so
quickly, are you sure?” replied the woman. So GUESS
the vet whistled and a large black Labrador
Retriever walked into the examining room. GUESS
The Labrador sniffed around the parrot for
a moment, shook his head, barked twice ‘Second Guess’ of course!
and left the room. “A dog shakes its head
and I’m supposed to believe that?!” cried the TIME 1/2
woman. “You’re going to have to do more to
prove that my poor parrot is dead!” So the 12.45PM
vet brought in a grey Siamese and put it on
the table beside the parrot. The cat looked VIT _ MIN Oh dear!
closely at the parrot, walked around it,
sniffed it a bit, then shook his head, meowed C OFFEE +
and jumped off the table. The vet turned to
(Answers on page 44)
the woman and said,
“There it is, confirmed proof ”.
The woman finally is convinced.
As she turned for the door, the vet
announced that the fee would be £250.
“How on earth could it be that much just to
tell me my parrot is dead?”
“Well, it would have been a lot cheaper, but
with that lab report and cat scan...”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
20%cushOiofnf 17
CUSHIONS REFILLEDHacluvoOesshtoyiomothunpershir? all
refills
FROM THIS FOAM - FABRICS - SUNDRIES
TO THIS All aspects of upholstery undertaken
890 Wimborne Road, Moordown, BH9 2DR
01202 516949 : [email protected]
Polishing in the Bournemouth area for over 30
years!
- Removal of water and heat marks
- Colour matching
- Free collection and delivery service
Why buy new when you can have your old quality
furniture restored as good as new?
For a free quotation please call JIM PRICE
Tel: 01202 529910 Mobile: 07855 044732
16 Victoria Avenue, Winton, Bournemouth, BH9 2RN
Please mention this magazine when responding to these adverts - Thank you
18
BOURNEMOUTH TATTOOISTS TURN TO NOVEL VISION
Bournemouth tattooists, Amy and Abigail, frustrated with
wearing glasses, have turned their sights to a novel form of
vision correction which leaves them with a superb eye for detail.
Amy Billing and Abigail Rawlings, who are both established
tattooists in the Bournemouth area, have been inspired to try an
overnight treatment called Ortho-k which works as they sleep.
Gently flattening the eye’s surface, it leaves them free of contact
lenses and glasses for the day ahead.
Ortho-k, is a non-surgical, and fully reversible form of vision
correction which Raxworthy Opticians in Christchurch
is providing for patients.
Amy, 22, who studied Fine Arts, had looked at other options to correct her sight but is
delighted with the results of Ortho-k and the tailor-made lenses –“I looked at laser but with
the cost it wasn’t an option. I saw this and thought it looked amazing.”
Amy, who has a prescription of -4.00 dioptres started using Ortho-k six months ago and had
immediate results -
“After the first night of wearing the lenses at night I was -1.00 dioptre in the morning, and
after a few nights I had perfect vision when I woke up. I can work all day and even if I am
out until 3am on a Saturday night I can put my lenses in late and still see well the next day.
“I hated wearing glasses as they always slipped down when I worked, and my contact
lenses used to dry out as I was staring at the same point for a long time when I work. I can
spend up to eight hours on a piece of work. It is literally the best thing I have done – to be
able to wake up in the morning and see – there were so many things that were awkward or
inconvenient with glasses.”
Abigail turned to Ortho-k when she saw Amy’s success –
“I decided to give it a go, even though my prescription is only -1.25 dioptres. I hated glasses
and had problems with wearing contact lenses during the day, but these lenses are fine at
night. Once my eye had moulded to them they go in perfectly. The results are brilliant for
my work, and I recently went travelling in South East Asia and the elephants were splashing
water in my face – I couldn’t have enjoyed that with contact lenses or glasses.”
Richard Taylor, the optometrist who looks after Amy and Abigail’s vision, explained that
Ortho-k moves the surface of the eye by less than half a hair’s width, and working much
like braces on teeth can help to ensure that short-sightedness does not progress –
“There have been a number of
international studies which indicate
that using Ortho-k to correct short-
sightedness in children and young
people can have significant long-term
benefits for eye health.”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
19
>r^=k^Zf h_'''
:G :EM>KG:MBO>MHE:L>KLNK@>KR
www.raxworthyopticians.co.ukppp'^r^]k^Zfe^gl^l'\h'ndu:ldpbmabg_hk_nkma^k]^mZbel
Ho^kgb`amOblbhg<hkk^\mbhg
LIMITED OFFER
Half-price Þtting fee until 31st December 2017
Contact us to see if you are suitable
01202 484888
51 Bargates, Christchurch, Dorset. BH23 1QE
Please mention this magazine when responding to these adverts - Thank you
20
Contact The Elderly - Volunteer Drivers & Afternoon Hosts Required
Once a month on a Sunday afternoon local elderly people, who are without family in the area, are taken out
by volunteer car drivers for a little ride before going to the homes of volunteer hosts and hostesses for Sunday
afternoon tea.
We only ask our volunteer hosts to entertain up to six elderly people and two
drivers or one driver with up to three elderly people once or twice a year.
A downstairs cloakroom is a must.
Reserve drivers are always wanted when the regulars are unavailable.
This would be possibly two or three times a year.
Elderly people who would like to take part in one of these afternoons are
welcome to join the group but must be able to get in and out of a car, as we are
unable to take zimmers or wheelchairs. There is no charge.
For more details phone Carolyn Dennis 01202 424482
Autumn Trivia
Autumn 2017 in the UK will begin on Friday 22nd September.
The first day of autumn is known as the autumnal equinox. On this day, the number of hours
of daylight and darkness are equal. This is because the sun is aligned with the center of the
Earth between the north and south of the planet. The other equinox occurs in the spring,
which arrives in the third week of March in the Northern Hemisphere.
In Greek mythology, autumn was the time
when Persephone, the daughter of Demeter,
was abducted by Hades, the god-king of the
underworld. During this time, Demeter, the
goddess of the harvest, was distraught and the
ground grew sparse and cold. When Persephone
returned in the springtime, plants and life bloomed
anew because of Demeter’s happiness.
Those who live closest to the equator, which is the
center of the planet, never experience the season
of autumn. Around the equator, the temperature
remains consistently warm.
Yellow, orange and variations thereof always reside in the pigmentation of tree leaves, but
they are overpowered by the abundance of green from the chlorophyll in the leaves. Come
autumn, when the sun weakens and days grow shorter, the amount of chlorophyll in leaves
diminishes, allowing the other pigments in the leaves to show through. Red and purple leaves
are actually caused by the presence of sugars from sap that is trapped inside of the leaves.
Contrary to popular belief, squirrels who have spent the entire autumn collecting acorns and
other foods do not hibernate for the winter. Rather, they spend the majority of their time in
nests they built to shelter them from harsh weather. When squirrels do come out in winter,
they are usually tunneling under the snow to find the food they buried during the fall.
Several cultures have ancient traditions that coincide with autumn. For example, the Chinese
celebrate the Moon Festival to give thanks for a successful summer harvest.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
21
Stephens
Carpentry & Building
Kitchen Fitting General Building
Renovations
Fitted Wardrobes
& Cupboards Bricklaying & Plastering
Patios
Door Hanging,
Architrave & Skirting General Maintenance
Fencing, Decking, Sheds
1st and 2nd Fix
No Job too Small • References Available • Fully Insured • Free Estimates
Brian Stephens
Tel: 01202 525 445 Mob: 07921 525 424
[email protected] www.stephensbuilding.co.uk
26 Green Road Bournemouth BH9 1EA
Please mention this magazine when responding to these adverts - Thank you
22
Brain Power
1: “I’ve come to you for advice” said a young woman to the Private
Investigator, Dan Topham “I met this guy, Dr. Howard, a few months
ago. He’s an archaeological expert, specialising in sun rituals in ancient
times. A few days ago he approached me and said that he had found a
beautiful vase which had pictures on it celebrating the Summer Equinox.
He said that it’s a rare find, but that if I give him £2000, he’ll give me a
half share in any proceeds he gets when he sells the vase. I was wondering
whether you could find out some more about him for me, to make sure
I’m not going to be handing over money to a fraud.”
A week later he called the woman to say “The vase may well be a genuine
artifact, but I’d be careful of this guy ‘Howard’ - he’s a fraud.”
What made the Private Eye so sure?
2: A doctor and a bus driver are both in love with the same woman, an attractive
girl with the unusual name of Pibbles. The bus driver had to go on a long bus trip
that would last a week. Before he left, he gave Pibbles seven apples. Why?
3: One hundred feet in the air, it lies with its back on the ground. What is it?
4: The tour guide was finishing the tour at Beethoven’s grave and told everyone
that if they listened very carefully, they could hear actual music coming from the
grave. Everyone immediately fell silent and, sure enough, symphony music could
be distinctly heard coming from the ground although it sounded as if it were being
played backwards. What could possibly explain this?
5: Jack who had never won a game of chess with his friend Matt, one day bet him
that he could simultaneously play two chess games with him, and either win one
of the games or draw both of them. He made only one stipulation, which was that
they alternate their moves on two separate chess boards and that on one board he
got to play black while on the other board he got to play white. He said that he was
so confident that he would win this bet that he would let his friend play first. Matt
accepted the challenge. How was Jack able to win this bet? Answers on page 40
One day a man went to an auction. While there, he bid on a parrot. He really
wanted this bird, so he got caught up in the bidding. He kept on bidding, but
kept getting outbid, so he bid higher and higher and higher. Finally, after he bid
way more than he intended, he won the bid - the parrot was his at last!
As he was paying for the parrot, he said to the auctioneer, “I sure hope this parrot
can talk. I would hate to have paid this much for it, only to find out that he can’t
talk!” “Don’t worry,” said the auctioneer, “He can talk,
who do you think kept bidding against you?”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
23
RR..JJ..HHuullll && CCoommppaannyy
CertiAfiecd PcroacutisningtaAcncotusntants
Accountants312 Charminster Road, Tel: 533370
312For moreCthahnwa2wr5wmy.erjaihnrsuslwltaeechcraovRuenobtaaenedtns,.acTsose.iuslkt:in5g3b3us3in7e0ss
people in the Charminster and surrounding areas with :-
pF∗∗oePSrooapmlreltoenTreiernrasttdhhheaieprnCaa3chc0cacyoromeuuannirnttsssstweer ahnadvesu∗∗brPTeraaeoyxnurnRaodsellistnuisgrtniansrgeabsuswinitehs:s-
∗ Limited Company accounts ∗ Bookkeeping & VAT
FSaoslte, eTfrfaicdieernatcpceorusnotns al serviceTaatxaRffeotrudranbsle fees
Partnership accounts Payroll
iPnlcelausdeeePnqayuriLoreillma, bBiootueotdkokuCereocpominmgppaalnentdeyVmaAacnTca,goaelulmnceotnmst psearnvyBicroeetofuokrrnkLs,eimaenipnteiudnalgcoac&mcpoVaunAniteTss, to
and
management advice on a fixed or variable fee basis
Fast, efficient personal service at affordable fees
Please enquire about our complete management service for Limited companies to
include Payroll, Bookkeeping and VAT, all company returns, annual accounts, and
management advice on a fixed or variable fee basis
Experienced, Honest and Reliable Multi-Skilled Handyman
Inside Outside
Carpentry Decking
Plumbing Patios
Plastering Gardening
Tiling Pressure Washing
Painting and Decorating
Available for full or half day hire to catch up with all the little jobs you have
been meaning to do.
Phone David McDonald for free no obligation quote 07951738446 or e mail
[email protected]
Numerous references available.
Please mention this magazine when responding to these adverts - Thank you
24
DISCOMBOBULATED...
by your PC
or laptop?
Let us make
I•T•
Computer or Looking for a new Are you a business
Laptop problems? PC or Laptop? on a budget?
Local, knowledgeable and affordable. All backed up with fantastic service!
EZ Computers Repair Centre have nus OPENING TIMES
been operating in the Winton
area since the early 1990’s. national union of students Monday - Friday 9:00am - 7:00pm
Initially started as a retail store, Saturday 9:30am - 5:00pm
EZ Computers swiftly branched 10% DISCOUNT Sunday & Public Holidays CLOSED
out into offering repair services ON LABOUR FOR
to the local community on NUS MEMBERS
a NO FIX NO FEE basis.
EZ Computer Repair Centre
The current EZ team has over 80 years
of combined experience in technical 606 Wimborne Road • Winton • Bournemouth • BH9 2EN
support, repairs and servicing, and PC
sales. EZ Computers also offers online Tel: 01202 267267 & 01202 268268
gaming, internet access and printing Email: [email protected]
facilities. Whatever your computer
needs, our friendly and knowledgeable www.facebook.com/EzComputersRepairCentre/
staff will find the right solution for both
your situation and your budget.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
25
LFB MEATS
01202 533997
www.lfbmeats.com
THE BBQ SEASON IS UPON US!
BBQ PACKS £3.99 each
Pork Ribs, Chicken, Burgers, Flavoured Sausages
MULTIPACK SPECIALS
3 FOR £10
MATCH ANY 3 BLACK LABELS FOR £10
Also available a wide
selection of flavoured
sausages...
Pork & Leek, HoneyRoast,
Merguez, Hot Chilli,
Old English, Romany, British
Banger, Black Pepper, Beef
& Beer, Alabama, Stilton &
Chive, Sun Dried Tomato,
Pork & Apple.
(*all subject to availability)
Frozen Fish Fillets...
7-8oz Cod Loin Fillet - £2.50
6-7oz Haddock Fillet - £2.20
6-7oz Salmon Fillet -
£4.00 or 2 for £7.50
349-351 CHARMINSTER ROAD, BOURNEMOUTH. BH8 9QR
(Opposite Esso garage, lower Charminster)
Please mention this magazine when responding to these adverts - Thank you
26
Take care of your feet... Wearing sandals
Summer is here and we have cast off our winter shoes
and are into sandals again. Will last years sandals do
another season or do they look rather tired and worn?
Perhaps a trip to buy some new cool sandals is in order.
Choose a shoe shop that has trained staff who
understand shoe fitting to get the correct style and size
for your feet. Remember not to wear them out f the
shop, but to take them home and wear them indoors to
ensure they are comfortable and a good fit. Most stores
will allow you to exchange footwear if it has only been
worn indoors, but it is best to always check when purchasing.
The style of sandals is obviously a personal choice, but there
are features that can make a difference. If they are to be worn
for long periods then they should have a closed in back to
prevent calluses forming, and splits in the heels which can
be very painful.
The worst style for your feet is the wooden soled sandal that
only has a strap across the fore foot to keep it on, and the
wearer has to ‘claw’ their toes to keep them on.
The golden mule is the more closed in type of sandal, giving more support to your feet
which means at the end of the day you are less likely to have tired, aching feet. Sandals
provide ventilation helping to reduce perspiration and odour and make the feet feel more
comfortable.
Cotton socks, which are more absorbent than man-made materials, make all footwear
more comfortable by reducing rubbing and friction. Thank goodness wearing ‘trainer’
socks in sandals is not such a taboo anymore.
Foot Facts.
1. Each foot produces on average an egg cup full of
perspiration every day
2. 70% of foot problems are a direct result of ill fitting shoes
3. Leonardo da Vinci was absolutely spot on when he
described the foot as a masterpiece of engineering.
A H PARFITT CHIROPODIST / PODIATRIST
533-535 WIMBORNE ROAD
STATE REGISTERED WINTON BH9 2AP
HPC REGISTERED
Tel: 01202 528942
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
27
BOURNEMOUTH FC - THE POPPIES
PARTY AT THE POPPIES
Club House Available For Hire
Large Car Park - Family Friendly
Drinks At Club Prices - Dance Floor
An Ideal Local Venue
For All Your Family Functions
For more information and details of our extremely
competitive rates please call us on
01202 515123 / 07887 477547
A warm welcome is always assured!
Victoria Park, Namu Road, Bournemouth BH9 2RA
VETERINARY CLINIC Dog Walkers
144 Richmond Park Road &
Bournemouth, BH8 8TW
Home Visitors
Are you on a low income? In The
Do you receive benefits?
Bournemouth Area
Are you a pensioner?
Tailored to you and your dogs needs, we
We offer affordable veterinary provide a bespoke dog walking and care
services for your pets service. For your peace of mind, we have
had years of experience with dogs and
Consultations only £15 are also fully insured.
01202 526520 Tel: 01202 468978
Mbl: 07775 905263
Mon-Fri 9.30am-4pm Email: [email protected]
Charity No. 205126 www.howlinggoodwalkies.uk
Please mention this magazine when responding to these adverts - Thank you
28
Good Communication, Patience and Trust Can Reduce
Mountains To Molehills !
I recently treated a very nervous patient with severe phobia of injections. Although happy to
have dental examinations and treatment that did not need local anaesthetic they refused any
type of injection. Numerous hospital visits when younger had unfortunately overwhelmed my
patient with needle anxiety.
Dental treatment options were obviously restricted and therefore teeth that could be saved
were potentially having to be extracted under general anaesthetic instead, clearly not ideal !
However this bright person with a very supportive family decided not to bury their head in the
sand and to try and overcome the problem instead.
We had open and frank discussions about their phobia including details of their concern and we
set about finding a solution.
We used simple relaxation and distraction techniques together with numbing gel and
desensitisation procedures with the goal of being able to administer a local anaesthetic.
After a few visits, including various mock injection appointments, we succeeded and I am now
able to provide the normal range of dental treatments.
My patient has overcome a significant barrier and has put themselves in a much better position
for life as a result.
854 Wimborne Road, Moordown, Bournemouth, BH9 2DS
www.854dentalhealth.com 01202 512967
WANTED!!!
ELECTRICIANS, TATTOOISTS, FLORISTS,
BEAUTY SALONS, GARAGES, TAXI FIRMS,
DRIVING INSTRUCTORS, RESTAURANTS & BARS,
DOUBLE GLAZING, PET GROOMERS, ETC.
We are looking for more new trades & businesses
to advertise in this magazine.
Contact us now for more information.
Special discounts may be available for new bookings.
01202 255485 <> 08000 430485 <> 07801 474788
[email protected] <> www.thelocaleye.com
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
29
854 Dental Health
Professional, Friendly, Effective
Private Dentistry
01202 512967
Do you wish you had nicer or trouble free teeth ?
It is never too late to get help.
If you have dental problems and have been putting
off a visit, why not call us or pop in for a chat.
Modern dentistry can work wonders.
RICHARD J HULL B.D.S & ANGELOS SIDERIS Dip.D.S.
854 Wimborne Road, Moordown, Bournemouth, BH9 2DS
www.854dentalhealth.com [email protected]
Established 1972
Ply, MDF, Pegboard
Hardboard, Chipboard
No need to buy a full sheet Timber & Sheet Material
Cut to your requirements Large selection of Offcuts
Architectural Over 2000 items of Plastic
Mouldings Hardware & Tracking
DIY Products
Timber, Floorboards, Skirting, Dado & Architraves
Machined to your specific size and profile
Small items of Purpose Made Joinery undertaken
936 Wimborne Road, Moordown, Bournemouth. BH9 2DH
Tel: 01202 516225 <> www.builtindiy.co.uk
Email: [email protected]
Please mention this magazine when responding to these adverts - Thank you
30
Legal Eye…… Employment Law
Legal Eye…… Employment Law
A look at some of the questions asked by members of the public regarding
tAhetlhoireoeikrmeapmtlopsoylommymeeneotnfrtetrhleaeltaioqtinousenhssihtpiiop.n. s asked by members of the public regarding
“I w“oI wrkoinrkaincaacrearheohmoem, eI a, Imamthteheonolynlpy epresorsnonononshsihftiftoovveernrnigighhttaaltlhthoouugghhIIaammaalllloowweedd ttoo sslleeeepp wwhheennIIaamm
notnbout sbyu,sbyu, bt uI ot Inolynrlyecreeciveeivae afixfeixdedamamouonutnot fomf moonneeyyfofor rththisisshshifitf.t.AAmmIIeennttiittlleedd ttoo tthhee Nationaall MMiinnimimuumm
WaWgeagfoerfnoirgnhigtshhtisfthsi?ft”s?”
Possibly yes, this area of law is fast changing and there have been a number of recent decisions from the
CoPuortsssitbolysuyepsp,othrtistahreeafaocftlathwatisnfaigsht ctshhaifntsgcinagnaantdtrathcetrtehheanvaetbioeneanl ma innuimmubmerwofargeec.eInt twdilel cdiesiponesnfdroomntthhee
facCtsooufrtes atochsuipnpdoivritdtuhael fcaacstet,hbaut tniifgyhotsuhiaftrsecuannaabtlteratcotlethaevneatthioenparlemminisiemsudmurwinaggyeo. uItrwshillifdt;eitpies ndecoenssthaery
for fraecgtus loaftoeraycrheiansdoivnisdufoarl cyoauser ,ebmupt ilfoyyoeur atorehuanvaebale ptoelresoanveotnhethperepmreismesisdeusrianngdyothuer srehifits; ait nis naedceeqsusaartye
degforer eregouf lraetsopryonresiabsiloitnysdfuorrinygoutrheemnpiglohytsehrifttothheanveit ais ppeorsssoibnleonthtahteyporuemmiaseys baendenthtietleredistoanbeadpeaqiduathtee
natdioengarel emionfimreusmpownsaibgileitygdouinrigngfotrhweanrdigahtnsdhifpt othsseibnlyit fios rpsoosmsibeleofthtahet ynoiguhmtsahyiftbs ealreenatidtleydwtoorkbeed.paid the
“I hnaavteionbaelemnineimmupmloyweadgefogr ojuinstgofoverwr aardyeaanrd, mpoysseibmlypflooryseormheasodf tishmeisnsiegdhtsmhieftsbaulrtehaadsynwootrtkoeldd. me why.
Can they do this?”
“I have been employed for just over a year, my employer has dismissed me but has not told me why.
wThiethCifnairns1t4tihsdseuayeydstoootfhbyieos?ue”rsdtaisbmliisshsaeldtoisretoqufinedst out what the reason was for the dismissal. You have the right
reasons for your dismissal in writing. Once you know the reason
for dismissal, it is worth considering whether the dismissal was unfair. A claim for unfair dismissal normally
reqTuhierefsirtswt iossuyeeatros cboenetisntauboulisshseedrviiscteo, fhinodweouvet rw, hthaetrethearreeasosomnewcairscufomr stthaencdeisms wisshael.reYothuehlaavwecthoensriidgehtrs
dismwitshsainl 1o4f daanyesmofpyloyuer deiswmitishsaulntoderer qtwueostyreeaarso’ nses rfvoircyeotuor dbiesmuisnsfaaliirn. Fworritingst.aOncnec,eifyaoun kenmopwlothye ereraasiosens
an fiossrudeisambisosault, iht eisawltohrtahncdosnasfideetyriningtwhehewthoerkrpthlaecdeisamnisdsatlhweay saurenfadiirs.mAiscseladimasfoar urensfualitr,dthisemilsaswal snaoyrms tahlalyt
thisrewqouuirledsbtweoauyetoamrsactoicnatilnlyuuonusfasier.rvice, however, there are some circumstances where the law considers
“I sduifsfmeriswsaitlhofdaenpreemsspiolonyaenedwaithnxuientdyear ntwdofiynedairts’dsifefircvuicltettootbeell wunofrakirt.hFaotr Iincstaannncoet, aiftatennedm. Mployyeemepraloisyeesr
waannts itsosudeisacbipoluintehmeaelthfoar nthdis,sawfehatyt icnathneI dwoo?rk”place and they are dismissed as a result, the law says that
this would be automatically unfair.
If your condition affects your normal day to day activities, such as going to work, sleeping, concentrating,
syAooccutw“i.rIaacsTliunhsoiftenfnsegttErroaqawcduniattidshucliattidhyplealdAinptuceratetimefspfseslei.aocMncftoeaiarssntnmhaydiosdp,arewuentohxtyhipaeoalttenyncseaamumnnfifdnIpeodrlfoirionn,y?gdteh”rweitsridtetohififsmdicaeaupplktreoetosrssesitbiaoeislnlliotwysntotarhurbkagletgthylaeaodtutojIuhcskataemvneeenponrigittnshatrtotesteguhnunedldlap.erMyrcotyohuneectmaEacqprrtluoywayoleiiuttrhyt
their employer. Employers will often implement their sickness reporting policies quite rigidly and employee
ofteIfnyosuufrfceor nwditithionnoapffaecytos ryoduisrcnipolrimnaarlydparyotcoedeadyinagcstiavsitiaesr,esusuclht. aHsogwoeinvgert,othwios riks,oslneeepairnega, cwohnecreenitrwatoinugld,
besroecaiasolisninagbalendtothmaat kaeffeacnt ias dmjuosrtemtheannt tmointhoar,tthreepreoirstiangpopsrsoibcileityduthreattyoohuehlpavteherigehmts pulnodyeerethaenEdqauavolitiyd
dlinisecAimcptlai.nnaTahryegesEarqnaucbatoliitouyntAsmcfoat rpkuilnangcaeausdtahjuodsrutismteyedonnatsbetsmheapntlcoaeyr.eerEssmutoitpamlobaylekeeeforsersabhsoootunhladpbadleristicaeuds.sjus swtmithentthsetoir HheRlpdeyopuacrtamrerynotuotr
your contractual duties. Many people suffering with depression struggle to keep in regular contact with
their employer. Employers will often implement their sickness reporting policies quite rigidly and employee
often suffer with no pay or disciplinary proceedings as a result. However, this is one area where it would
be reasonable to make an adjustment to that reporting procedure to help the employee and avoid
disciplinary sanctions for unauthorised absence. Employees should discuss with their HR department or
line manager about making adjustments that are suitable for both parties.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
31
Expert Advice with a Friendly Face
Please mention this magazine when responding to these adverts - Thank you
32
Do You Know About Raw Food For Cats & Dogs?
For generations, dog owners have been buying bags and/or
tins of pet food. Many people still do this today. Some pet food
brands are more expensive than others and there are several
foods today that claim to be all natural. Over the past few years,
more and more owners have been switching their dogs and cats
to a raw food diet.
Dogs, unlike cats, also need a mix of vegatables with their meat. We can supply these in addition
to the raw foods or you can also choose from a selection of premixed meat/vegetable packs.
Benefits of a Raw Food Diet:
Owners who take their dogs for a walk in public areas are required to clean up the dog’s poop
after he goes. If you find that your dog’s pooh is soft and sometimes runny, it can make cleaning
up after him a very disgusting job. If you start your dog on a raw dog food diet, you will notice
that his stools are firmer and much easier to clean up.(It’s a lot less smelly too!)
It is not uncommon for dogs to have digestion issues when they eat bagged or canned dog food.
Some dogs get very gassy, which can be pretty bad for anyone who is in the room with the dog.
Some dogs vomit after a big meal. If you start your dog on a raw dog food diet, he will get a
daily supplement of probiotics, making digestion easier.
If you have ever seen a wolf or a wild dog, you know that they often have beautiful, shiny coats.
This is because they are eating a raw dog food diet on their own. This diet will give your dog all
the vitamins and minerals that he needs to keep his coat and his skin healthy.
Many dogs have yellow teeth, infected gums, and very bad breath. This can due to the fact that
they don’t brush and floss every day and because they are eating manafactured dog food.
When you switch your dog to a raw food diet, his teeth and gums will be healthier and his breath
will smell much better.
The carbs in bagged dog food can give your dog a huge spike of energy, only to have him crash
later. The additives in commercial dog food can have the same effect. If your dog is overly hyper
for a while after eating and then strangely lethargic shortly after, you should switch him to a raw
food diet. Raw food will keep your dog’s energy level at an even keel.
It is not uncommon for dogs who are fed commercial
dog food to become overweight.
This is not the case on a raw food diet. This diet
is very high in protein, making it the most weight-
friendly option.
Still unsure? Come in to see us, we have a very wide
range of raw foods for cats & dogs and can help you
decide what to start on depending on your pet.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
33
Please mention this magazine when responding to these adverts - Thank you
34
Pilates
Fridays 7.00pm to 8.00pm
Beginners to Improvers Welcome Moordown Community Centre
Coronation Avenue, BH9 1TW
Jan: 01202 391468
Mount Pleasant Townswomens Afternoon Guild
We meet in the Bradpole Road Community Centre at 2pm on the 1st Wednesday of every
month for a social afternoon, when we have different activities including a speaker, and
we welcome visitors who we hope may join us and become members of TG.
Our other activities include Trampers & Eaters (when we visit nearby places of interest
and end up with lunch), skittles, a music afternoon (all sorts) and a Social Studies
afternoon when we reminisce and discuss any current subjects of interest.
EnPaLS supports Ensbury Park Library and is busy fund raising to provide better
community facilities at your library.
If you are on-line follow the EnPaLS Facebook for all the latest news and forthcoming
events and dates of the monthly open meetings .
Pop in the library every Friday afternoon for
tea and biscuits and meet the regulars
or Thursday mornings for the
Parent & Toddler sessions.
You will receive a warm welcome.
01202 536397
31 Columbia Rd, Bournemouth BH10 4DZ
Farmer Pickman goes to the vet and says, “My horse is constipated.”
The vet says, “Take one of these pills, put it in a long tube, stick the other end in
the horse’s rear, and blow the pill up there.”
Farmer Pickman comes back the next day, and he looks very sick.
The vet says, “What happened?”
Farmer Pickman says, “The horse blew first.”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
35
ELEASSEoroptimists Poole
Urge GPs twitter - @SoroptPoole
To Ask The
Question! facebook - Soroptimist International Poole
Linkedin - Soroptimist International Poole
Email - [email protected]
Soroptimist International of Poole (SI Poole) welcomed Rhianon Greenslade of Safer
SoroptPiomoleisPatrstneursrhgipeat GthePirsJunteomAeestinkg atththee SQaluterenssHtiootenl in! Poole to hear about her
latest initiative, the IRIS Project. (www.poole.gov.uk/IRIS).
IRIS stands for Identification and Referral to Improve Safety and is a GP based domestic
violence and abuse programme. It is taking place only in Poole and started a year ago.
It has secured funding for three more years.
ernational of Poole (SI Poole) welcomed Rhianon Greenslade of Safer
hipeaIRt tIhSePirhRseroJhormviujaieennc?ceoe”tsn.maTe(nxwhedpiewslaatgwiiknniev.egpyedsooahtobthojletweehcp.et8gai0vtoSi%eevani.soutltftpkeowe/rIrenoRmnsmcIiSsoeHsun)ioro.iantngetealosivnttiaaolfPklfeotnaobtoaorleesukltattttohhioeehnirqsehucaieiprrsctsauioembenoks“tIuahstneeclhvpeeesfr.rryotmhinhgeaolkthat
dentificapHtoiooowrneqvuaeanrl,idtiyf Rvreiecstpfiemonrsrsaed,oldtduoiescItmlooslpaecrakobovufseetrStaoiantfihneegti.ryIGnaPnp,adtrhteinsreerasishGiepvPwidbietnhacspeeraodcftadicnoeimtneaeapmsptsrio,cpanriaItReI,S
use prograadmvomcaete. wiIltl issuptapkorint pgrapcltaicceestoanffl,yinicnluPdoinoglerecaenpdtiosntiastrst,esdo atheyyeparrovaigdoe .inIftormation
ding for tahnrdeesumppoortefoyrepaartsie.nts experiencing domestic abuse.
ed hoobjwec8tSbAi0evIn%iePnootgihoosielnfretowamagopaerojmneoserciedtosinoitudoniernstaotuogapleepthvaoesvirottepalRerifomhfnjiemttaocnreteodainslisaagatkteinivoldtyihnnhiesgfehrtiqhnitpueeforaeesrmsmeitseaaiodstkinaomnh“nugIesacelbhrpe.oavufsretothrhmyoetwyhhcitneoangablaetonhskdafateotautrhgoemtheeiarnd
ey
ves the paGtPiesnutrgpeerirems tiossigonnutpottoatlhkeainbiotiauttivteh.eir circumstances.
ms do disScolroospetimaibstussweotroldwthideeiraGrePw,otrhkeinrgetoisraeivseidaewnacreeneosfsaonf dinomapesptircoapbruiasete. S, IpPoooorle has
e, due to lsaucpkpoortfetdrathine ilnogca.lIRnepfuagretnfoerrsmhainpywyeitahrsp. ractice teams, an IRIS
pport praActbicoeutstSaofrf,oipntcimluidsitnIgnrteercneapttiioonnaisltosf, Psoootlhee: y provide information and
nts expeSrioernocptinimgisdt oInmteernsatticionaabluosf eP.oole is the local branch of Soroptimist International, a
global volunteer movement with over 80,000 club members in 127 countries. Its primary
odnetotolethaevaainenipmtderimoriinnsjaemttetocireotnindmaiastiiplaogrltneoeivavvlleyeinlotigtrhfhgeataihntlniefeivsodreareustmicooiasfnateswtd,iaooaenmnmndegpabnoeybwaror.neuudrntanghniinrdolgswecgnalatomobblpeabaloeliygpnspbsoayraftletuoanbaiblttoyiechisnaoglf,mognroaewtviaeoormnnnadmelnaenanndtsd girls.
to suppoLlorotccaRallhclyoiamSnomoruonnptiaitmyn.disthIentretrenaatmionaalsPmooulechimapslemtheenytscparonjeacntsdfotrothuergbeetttehrmeiernGt oPf our
n up to the initiative.
rldwide are For more information about SI Poole has
cal Refuge fwoorrmkianngytoyeraairssCe. oanwtaarecnte:sHs eolfednomoens0tic12ab0u2se8.4S2I7P9o5ole
email [email protected] www.sigbi.org/poole
Please mention this magazine when responding to these advertEs -NTDh.a/n/k you
36
Project Indigo
One boy’s adventure through time and space!
Hi, I’m Tom, a local Doctor Who blogger & I write about my adventures online at
anadventurethroughtimeandspace.com
Project Indigo is my special blog where I travel the
world visiting places associated with Doctor Who.
Sadly Series 10 of Doctor Who has just drawn to a
close. For me it has been a good series as I think
Nardole is a really cool companion and I am very sad
that he has left the show. Peter Capaldi is leaving too -
he has been my favourite New Who Doctor and
I have really enjoyed watching all his episodes. You
may have heard the news that the Thirteenth Doctor
is a woman - Jodie Whittaker from Broadchurch will be
the first female to play the Doctor. This will be exciting
to watch - I don’t know what to expect!
Today we are travelling through time and space just down the road to Lulworth Cove in
Dorset. We are here to see the filming location for the Classic Doctor Who story The Curse
of Fenric which was aired in 1989. Lulworth Cove took the place of fictional Maiden’s Point
in Northumberland. The story was set during World War 2 and the Seventh Doctor and
his companion Ace have to defeat the Haemovores, humans who have been transformed
into vampiric creatures. I have been lucky enough to meet Sylvester McCoy (The Seventh
Doctor) and Sophie Aldred (Ace) and they both told me that Lulworth Cove was their
favourite Doctor Who filming location!
Recently I went to Lulworth Cove with my school to learn about the geology of the area.
It is on the Jurassic Coast near the village of West Lulworth on the Isle of Purbeck and is
a World Heritage Site and Area of Outstanding Natural Beauty. The area is made up lots of
different types of rock, the oldest Portland limestones were formed 160 million years ago in
the age of the dinosaurs and their footprints have been found in several places nearby. The
youngest rock is chalk, which is only 97 million years older than all of us!
In Doctor Who there was a secret Naval base nearby
but in real life there is a British Army base, Lulworth
Camp, and if you see red flags flying on the hill it
means there are firing tests taking place so you are
not safe to explore. The beautiful cove has been used
for centuries for fishing and smuggling but nowadays
it is a popular tourist spot with people coming from all
over the world to look at its beauty.
I hope you have enjoyed reading about Lulworth
Cove, I recommend going there and checking out the
amazing Visitor’s Centre to learn more. !f you would
like to read about other Doctor Who locations I have
visited please check out my blog.
Thanks for reading, goodbye!
Tom Project Indigo -- anadventurethroughtimeandspace.com
What is the definition of “accountant”? >>> Someone who solves a problem
you didn’t know you had in a way you don’t understand..
....
What is the definition of a good tax accountant?
Someone who has a loophole named after him.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
37
Berry Hill Farm
Local Vegetables for local people
GUARANTEED FRESH SEASONAL VEGETABLES
DELIVERED TO YOUR DOOR IN HOURS
Grown locally in 1-2 people - £9.00
Bournemouth for approx 6 servings
local people, 2-4 people - £14.00
using only approx 10 servings
traditional
4-6 people - £19.00
farming methods. approx 14 servings
SELECT A BOX TO SUIT All boxes contain a selection of fresh seasonal vegetables
YOU AND WE DELIVER IT
For example: Potatoes, Cauli, Bunched Carrots, Cabbage, Brussel Sprouts, Purple
FRESH TO YOUR DOOR
Sprouting Broccolo, Leeks, Swede, Parsnips, Celeriac, Runner Beans, Broad Beans,
Marrows, Courgettes, Peas in Pod, Bunch Beetroot, Sweetcorn, Kale, Seasonal Salads.
Tel. 07971 795740 Berry Hill Farm, 185 Muscliffe Lane, Throop,
www.berryhill-farm.co.uk Bournemouth BH9 3NH Email. [email protected]
THROOP FENCING
& DECKING
REGISTERED WASTE CARRIER
FULLY INSURED
Contact: TERRY
07866 540062
[email protected]
TWITTER.COM/THROOPFENCING
Please mention this magazine when responding to these adverts - Thank you
O
2
n
38 O
Catering & events t
www.adamandevesfood.webs.com H
S
Catering & Events Waldorf SaladIngredients
430800mg lDbTroieaildisntcgyouw&sa-cteeoaruswsyithcoounes-ocrous
more vegetable stock cubes
Good sluMgeothf oOdlive Oil
HandfuBl oofilctahpeerws ater and add stock cubes. P
One lemaosnp-lcahsohpopfedthien ochilu-nskesparate with a for
www.adamandevesfood.webs.com
[email protected] 2n0ig0hgtCachnaf‘clidcuotkfocef-okypro.ektiahnesrdgos.oua&gkhe’ed. Svoevepeanr-rtaste again with a
gsa-c&mouaesnvednetvsesfIonogrde.dwieentbss.comaepddarsattoeckwcIitfuhtbhaeeBMIfba‘aTASocdlfaBIAMBIAaTafabSaIAf‘TTSM‘M‘bBsecccdddullledaroofdw.13HHSeeuuueesdedeaaaoooooodddoraeeeeesssfpdoiPrrdscatavoaaffflpppfddoooiiiaaTrsdddssstttaaavvntlll4HOSHnGm3tO2hfffkylaS(MIAlrkeotltnnttthhhnnakkkoyyylllotytnoelee0bd0ttt8lllisio.aaahloooyyyeyaatttnnglllu.hddssoooo...cmhhhdttlsa0&wryyysi00hhhdietttttrsssoh,hheeaww‘hnn&kxffrrfeddddiipeee0thhh,,,svhhhhhmL&&&yffeeeggeaduuliotdderoPwye7ltmtlllo‘oiiePeerrrceoiooCwwCCw1ewwwmyyeeellbtmttnrooohfflhalvooonDooocoa9esvafeorrhhuueagmtua/oooaaaeeeocrleiihfffbenstttuuuaaa4u2ubacnlvrhaeerpetaaamllumsstvlhwwwuudgtnvvvhhheiaaadgotttidemmi8yoh’hllgggggtttscederpooeerciisoehhhitrhp,eeeeeeeittteeebkccinoesssteeauehhhrppldyeffyerotscc4poswwweeieee)ateee’srrryyyeerrrr’hT--nanaf.,nmroaaad’’’ofccarroa9aeebfpoaa...ppoccddbla eoooscaaaeenghaSooohiottrrrlalllupbei4...hfcccoepeOnSSSriehnpttrelllvl,oiiiffeaoelpknnniiitsaaaodwiiipovvlll0,,oooldodsuw-eeeeelllpdaidtttoajceehi5lpipnnnr----upeendddanllaaacci2eehhhp,susopppzrruuuhes.odddvs egaceneordp-roahhts..ealrsss4ggesrmennneeespgggdaaaoegosnessh,tcaaayeteeesssfdud.-e eelroaaadpodfeeodddseeon---euecrrrifthpppdddalfffncdOfieeoasfgcttdaaaralllo‘udaocccanase&&&rg mmmbscooaaadddtaaataalaaaksslfekhseur iooofswltttvrisebeleeernsoluiarvvvesrrrlubbcllleeeasetnnsadomcsssllluuuoetlaltwaaalinraaahetooonayadooettteeellctputoysooustttyaaareehc-tttooohdsss‘’leeuuuohdsqrrlghhhetbc,nnnhltneeedvvvrsso,gggeotacccd oen,srrrkulaeeesoooeoguwhvrikkkwllnaaaosssn,teeedddwww1kiioinso‘nnitatrntejekkeymbooocnsiiitttiu/aouhhetetscccnnntirnnnrkiiieeedwu4ooooleettttetttii.hpbcth-iuuu’iiettwhhh.ssohhhesoccbshcwwwetttvvvee.sssatsssccbbbomokdeeee.raoee11Leoooe.sssisrnoo.S‘IBbTMAafaEaaaooateeeeeeiii.rrrucaddr,.lwsaaatttde’htwuueiTu.wwsedefsss?anook.sdhhhonraiii.eesfffssstokkk...wr(nnnnrrpa.fgPpt‘doooboianaggdgsWnnitavowgglPPPrfuiaaangggfff.tHSOonlteshrrreknyliiidekor..r2InInO23O344mOGHHO2HSnmOGIt43tHOmHGtHSSeltloeencannnooooooekkkoooypftrrroilnnneteooosot.hatneee000u000.888fffiiiyosmetteeeamhuauoooohtwttsaaaaaannnnnnggghuuu...tnwoooooommmddaaaoooi000eooogggettnhf,e000hhr000hrddd&tlooofeseveeeeeehhhennnnnnLrrreearrr1rrrdrabiskasssdovvvlmmmLLLsiorrrerggggggeeeaaatdddreowiiikkkewdddttteyddddddeoootpesso’,/ltltttlleeeoooonfheeefeeeLeeefrmeee,,h4nstttnvoonnnorahhhtteffffffuaaaaplllivvvoDDDfcccsssnnnitvvviuaooorrrttt...hsuuuuuuaaahdddmmmaoooSabIAnrfusllllteeiiiiiiwhhhbbbuleeelvhnnnnaavroooduuulctmwwwnnnrrrttteeeeeedrrrlrgtesllllllennnovvverrgsntprdeiiiiiiiodddggghoooiiikdddsssdleeeuoooieekggggggsssccc,ceorrrseeesooooooeee,hwpgeariiieeekkkr,,,afoooeeeemiiigwdeesckkkrnnnyggeps.aaardeaeeelllvdddlffffffoooocmcccnnnccca’fhooosssrniiinihtttioeeefcllna.------dnnnufffhhhnonnnovooonnnenmiiaeoofffeccccccolaaaaohofffolitpppoootttbbbvvccc.deeetccccaulSstopggglahaahhgiiioootttopreigydddafyaaaruuu.bbbnihhhhoooosssappptOOOfvl,ooppprrreeeeewe...elsetnoooipupppkkks,rhjYosss-m5lllgooossspuuudwwwfe-spppraaaacaehssrjjjYYYpeeecrdommm555lllupppdn---eeeeeeelaaaienceaeiiicccpppahossspj....yeseeeeosssgtrvvvneaaacccaamuaocoooddddppp---rrriuaoooosssnesrrrrniccchmmmanpppuexedddoaiiiaooosssseeesssuetccttceodtttsn-nntuuu...xxxeeeritupduuufooonaoooooodeseeeeeeedoooiuciduuutvhefalsooocldmdddnddOOOliiimcaaainsfffadcccsssndaidddrrrallluuuasinnnencccessesssgotiiicfacsekkk‘oskkkpssssugggmmmaiiivpcccfffssswwwaaarrwbelecssseooorelllcuuuhiiiaaas)rrrluneeattaeeeooonnnnearhhheonoccctnnnaeeelhtttttoduiiihnnnotot.snnneaedddttt.touuuuuu-splhhoootttussshdrlohoccctl---nhhhseiefdyshhhdddlllgcpbbbvlsss,eehhhdddmyyyreooopetorh.rklasoooeaeeecdrrehuuuwhhh...vvvrrrriipne’kehoiiirnnnsss.itgnnneeeneeeeeeeec.nrisedoeeeetetrrrirrrkkkebddddudhthfbbb---hewvtsssslsoooscboeasssaasoorrruaoeeeirvbatlulwlsdhiofsolk.nrteonnugrPhagfs’ri.G43InHOmH2StOtreneookornolse008fitieonaanngu.oomkoao0ogtt00doeehnnreroretsvmiLrggeadikdtddtohslteoeeese,stcnhffalveDcsnovort.uuadmoooliihbenrouwnrteearllnuvrwiidgoidsoggiscreooekienkr,oeiknganeldffogcncosigtel--infhnon.iofcca
arate again witabhdeaadnfosotrihfkeyrtooSsuleikcepeerhedeopfwvecermo.gueutscahcbodluiefsfselrieknececoounregleittttleesw, oorrdocliavnesmaankde.other
Serve with meat, c“hSeheesteolodrhoimn itthsaotwshne. loved him”.
.........
nd all the ot‘Qothuseeoruaeikn’ g-inrperodovnieeonrutnnscigaedhntd‘k. yYmoooiux’. lTcigaakhnetsly5. letters when we only actually use just the first.
flavours
.........
etables like‘Bcoowu’r-gseetvteersa, lomr oealinviensgsananddoptrhoenrounced differently depending on context. What
was your first thought? Don’t forget ‘bough’, same sound as one of those of ‘bow’ yet
eese or on its own. means something completely different.
.........
‘Laid’ is pronounced like ‘paid’ but not ‘said’ and ‘said’ is pronounced like ‘bread’ but
not like ‘bead’ yet ‘bead’ is pronounced like ‘lead’ and not ‘lead’ if you follow me!
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
39
BRING THE
WORLD 15OPS_HF_Recruitment_Flyer_A5.indd 1
into your
HOME
And host an International24/10/14 18:05 Student!
We are looking for couples, singles & families to host students from across the globe.
Being a host family is as rewarding for you as it is for your students.
You learn about another culture and provide a once-in-a-lifetime experience.
Homestay accommodation required all year round.
15OPS_HF_Recruitment_Flyer_A5.indd 1 24/10/14 18:05
Guaranteed weekly payments
24 hour staff support
50 years experience in language education CONTACT24/10/14 18:05
World’s largest private15OPS_HF_Recruitment_Flyer_A5.indd 1 education company
Friendly & supportive team
01202Accommodation required all year round
832830EF International Language Centre
11 Poole Road, Bournemouth, BH2 5QR
[email protected]
www.ef.com/host
Please mention this magazine when responding to these adverts - Thank you
40
Bournemouth Electric Bowls Club
Short Mat returns from 4th October
Each Wednesday from 1:00pm.
All welcome.
For more information contact:
Keith: 07593 559103
Ron: 01202 252291
www.hugofox.com/community/bournemouth-electric-bowls-club-8744
Fruit & Veg Box Winners!
It just goes to show that it can be
worth entering the crossword prize
draw available in this magazine
each month.
The June winner, Richard Quain,
is shown here being presented
with a lovely box of flowers, fruit
and vegetables by Roger Oates on
behalf of the North Bournemouth
Allotment Society who very kindly
donated the prize.
See page 43 for this months prize crossword, your chance to win 3 bottles of wine!
A man on holiday in Spain thought he would email his sister back in England. But
he made a typo, so instead of sending it to Joan Foster, he sent it to Jean Foster, the
wife of a recently deceased priest. When she read it, she fainted. It read: “Arrived
safely, but it sure is hot down here.”
................
Doing the rounds of his barns in a remote part of Wales, a farmer came across a
parachutist who had landed in hay. “What happened?” asked the farmer. “My chute
failed to open.” replied parachutist. “Ah, well, if you’d asked the locals before making
your jump, you would’ve known that nothing around here opens on a Sunday.”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
41
T ra vel Feature - Five Lands
Cinque Terre – The
By Mags Addison
I was lucky to visit this beautiful coastal part of Liguria in Italy
only last month. Collectively known as the five villages – the name
Cinque Terre in Italian mean the five lands – and they all cling
precariously to the cliffs along this area just up the coast from
the city of La Spezia. And this beautiful region is still relatively
unknown to British Tourists. But is full of other nationalities who
have discovered it such as American, German, Canadian, and
Australians.
To get there, we flew to Pisa and caught the train up to La Spezia
only about an hour away - and then we hopped on the local train service, the 5 Terre Express, which
connects the five villages of the Cinque Terre region, taking only minutes between each one. So, it’s
easy to get there and move around on local transport. A warning though, for those who have walking
difficulties – the whole area is extremely hilly - hence the views everywhere.
Each village has its own personality, its own level of gradient – and towering around and above each
are these steep terraces of practically vertical lush green hillsides – where they have somehow managed
to devised a way to grow grapes and harvest them in an amazing engineering feat. Boats ply between
them all, and these days, tourism is also a major industry.
From La Sepzia in the South, the villages are in order along the coast:
Riomaggiore – where we stayed, steeply hilly – busy and noisy with a bustling waterfront.
Manarola - the next village - is quieter, and popular for those on the hiking trails.
Corniglia – is the only one not on the water, it’s a bus ride, or long walk to the top of the cliff.
Vernazza – has a pretty waterfront square – with the church on the edge and a marina.
Monterosso al Mare – is bigger than the others, more of a resort with two big sandy beaches.
Our rented apartment- in the heart of hilly Riomaggiore - had a huge terrace with wonderful views
towards the sea, and the colourful houses of this lively village just tumbled all around us. The resort
is bustling, vibrant with both tourists and locals, and lots of eateries. At night, everyone gathers at
vantage points within the village, and at the rocky water’s edge to watch the fiery sunset. Picnics of
pizza, wine, and bottles of the local Limoncino were quite common as they perched waiting. Dinning al
fresco, and celebrating the end of another glorious day with their companions.
This is hiking country and all 5 villages are close enough to hike between over a matter of hours, some
require more fitness levels than others. But the views they give
are breath taking along the coast. Cinque Terre is now a
National Park and is an UNESCO Heritage site, so you need a
Pass to hike between some of the towns. Unfortunately for me,
the easiest two trails are closed due to heavy rock fall. Some
of the longer ones went up high, way up into the hills. But I
managed to go up far enough, to see and photograph those
glorious views.
Naturally, I took far too many photos. But everything was so
vivid to the senses, you felt you wanted to capture it. Now if I
could only bottle that!
Beach holidays, City breaks, Honeymoons, Weddings abroad, Adventure holidays, Ski,
Cruise, Tailormade trips, Flight only, Car hire, Airport hotels and parking and much more...
Contact Travel Counsellor
Mags Addison
018240520598017389102 Travel Counsellors ensures complete
financial protection on every booking
[email protected]
www.travelcounsellors.co.uk/margaret.addison
Please mention this magazine when responding to these adverts - Thank you
42
There is no beating the taste of truly fresh
fruit and veg especially, when it’s yours!
Gardening Tips for August
Well here we are again in August. If you are going on holiday, do remember to make arrangements to
keep your plants watered. We could have the Sun here too whilst you are away. Before going away
gather up your outdoor pots together in a shady area, make sure your plants are well watered, by using
an automatic watering system or by asking a friendly neighbour. Keep feeding plants with a quick acting
fertilizer like Growmore or Phostrogen to keep them producing.
Greenhouse.
If you have not done so already pinch out the tops of Tomato plants once they have 4 sets of trusses to
prevent them from growing too tall and will improve quality of the harvest.
Fruit garden.
Prune cordon and espalier apples <> Water trees if need be, especially young plants less than 3 years.
Cover ripening fruit to protect from bird damage.
Pot up any rooted runners from Strawberries clearing away any dead leaves.
Flower garden.
Stake and tie plantss.<> Pinch out the tops of Chrysanthemums <> Water and feed sweet peas
Take cuttings <> Re-pot pot plants if required.
Annual Summer Show - Saturday 5th.
August - 11am to 3pm
You are warmly invited to visit our allotments
We will have Flowers, Fruit & Veg show. Stalls,
Ploughman’s lunches, Teas, Cakes, Entertainment and a
scale model Traction Engine offering rides.
Gardening Tips for September
The days are becoming shorter in September and the rich harvesting of your fruit, vegetables and cut
flowers is reducing too. However there is always something positive to do for the keen gardener or
allotment holder.
Lawn Care:
Now is the time to sow a new lawn or make repairs to your worn out patches. There are of plenty
of patch repair kits in the shops and garden centres to choose from, many include a fertiliser. Doo
remember to ensure the seed is in contact with the soil and sprinkle with potting compost to conceal it
from greedy pigeons.
Fruit Care :
If you have Autumn fruiting Blackberries and Raspberries do keep them netted to prevent bird damage
and loss of fruit. It is important to check daily in case any birds have become trapped. There are still
juvenile birds around at this time of year. As a result of our experience on the allotment we now leave a
narrow opening at floor level to allow any trapped birds to escape.
Flower Care:
If you intend to grow Sweet Peas next year, later this month is a good time to soak the seeds to chit prior
to sowing indoors or an unheated greenhouse. Once sown in the ground next March or April, you will be
rewarded with an early flurry of colour and sweet perfume.
As the last of the Rose blooms fade a clear dead heading should be carried out. Any taller stems can be
reduced to minimise the risk of wind damage.
North Bournemouth Allotment Society, Cornelia Road, BH10 4FG
www.northbournemouthallotmentsociety.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
Plant Life 56 43
1234 Prize Crossword
78
9
10 11
12 13
14
15 16 17 18
19
20 21 22 23
24
25 26
27 28 Enter this month to win
3 bottles of wine
(c) Chett July 2017
Across Across Down Down
h18a7r0..oos.PCuprTonoihltomdaeulri(rse9(f5e')sus)ha87lmmr..osoahsCPaunprordunyoiletobdmaatulog(iprsa(9feie5rgu)ads)ltcesamwnhrehavrreeduadhebtaitngosoutatothresdhraioedatwnerwdnehr ehaatsotuh(12i3n5tr...s)soSATiiwddrosieeuneadt(nh6eh)Aabfror32(1diy8c...ta)wSTAonroogsiuubeealtodtndhyaeheAecaabnfotrorjodoiayckytaveswoernagogrbeuilegteolathadyrftaiyeeacannmotjeooaakylveseragreliegtahafrtyiianmnseiodapelt(i(o56n))
wood (8) 10. There’s many a pig carved intoophtiaornd(8) 4. Foes receive final letter detailing catalyst
11. I'd give wmoyosdhi(r8t )for a tea in need of a 4. Foes recepivreomfinpatl (le7t)ter detailing
drink (6) 11. I’d give my shirt for a tea in nceaetdalyosftapro5m.pDta(7d)takes a tablet on finding toy dog (8)
12. The madnreinxkist(s6f)or a hosta (4) 5. Dad take6s.aHtoarbsleet dornofpinpdininggs tgoeytdaogroasting at
13. Aubergi1n2e.fTouhnedminansheexlilsatnsdfopruat ihnotosta (4)(8)
Christmas (9)
l1g1oirnt57to..liuetPHnoE(e7dians)l(ogt8lnha)oyn1t1guodar53sdo..l(ipd7uHAtil)nttauelidenvbaetle(Ets8rbhneg)rygeiinnlsaageadnsdfdtmooit(upoi7vntf)heldyeebirnrsrirnsrouhguiesnnldlmtoaontdhep9hC16ru4..uhst.GHnrriFitoasunelrrteirtmsdnsoe(eh4andys) rbp(o9i(19etrp44.)eopf)tG.drlieonFuamlgcruesdtnseNfgchrneooeytvmwbpeaerrAZreeoosdetdailaaebuslnytacuitnncdnldfgeicrmeooa(rt9vbme)errAesdiabnycdliemebr ehruonrteisr
20. A real p1lu7m. PfoaivsoounroituesfoprlaHnetr sMeaejsesatyto(8p) flyoerr is it from1N6e.wFrZueiatlganivde(n9)to solvers of a maths
22. Fuel durgouupndfroomn itth(e7b)og for the man I 16. Fruit givpernobtolesmolvinersscohfoaoml eaxthasms (8)
hear (4) 20. A real plum favourite for Her Mpraojbelsetmy in s1c8h.oSowl eexeatmcshi(l8li) pepper is kept under hat
25. Made co(f8fe)e from beans of the earth (6) 18. Sweet chwiilltihpueppbeer aist kmeupst iucn(d8e)r
26. This let2s 2th. eFueemlbdleumg ubpe pfricokmedthfoer bog for thhaet mwiathn up1b9e.aRt emeudsimc a(8c)e cut to provide one ninth of
S2r(25o78c)oo..ttCAl(ad9an)dlldiicn(8eo2IS2()tn6c56ohe)o..edtMTbarlaahirancnid(kskd4eltf)e(ooc8trows)fffaltoeshwheeefdreromowwmibnnleebsmtieniackbnsoyesnpogfi?ctkhee2o212fdof3194erfs....aoMhSSRCrritehaeophlenlislopdouUwbfmrfthasdtaiM222schpdckhf134aeaee(i...dnn3epscCSSpa-sstuU4heeoois(tw)rltll4iyelopdt)thnoouhtbifoffrappgaasantrnc(thordshk3tdvehee-ie(ddnee4n4saeop))ctidreoaostinrrhyvlneeitdt(nah6oneta)irgiotnnah(nt5rhtes)dhneeoncradthrivn(iad6te)ior n(s5)for
27. Call in one back for flower wine in
song? (5)
28. Add ice to drink to wash down sticky
root (9)
Please mention this magazine when responding to these adverts - Thank you
44
PRIZE CROSSWORD ENTRY FORM
Send your completed entries to:
August Prize Crossword, The Local Eye,
22 Oswald Road, Moordown, Bournemouth. BH9 2TQ
Name: ________________________________ Tel:____________________
Address:______________________________________________________
Address:______________________________________________________
Closing date for entries is Tuesday 22nd August
Congratulations to Richard Quain of Portland Road who won
a box of locally grown seasonal vegetables courtesy of
North Bournemouth Allotment Society.
Enter this month for your chance to 3 bottles of wine
June Solution Brain Power
Solution > Working Life
1: The times of change in spring and autumn are always known as
1C O 2M E 3B A C 4K 5T R 6A D E 7D equinoxes, and those in summer and winter are always solstices. An expert
in ancient sun rituals wouldn’t have made the mistake describing a scene
RAE I AS A celebrating a summer equinox.
I S 8L A 9M P L I G H T E R 2: An apple a day keeps the doctor away.
1T0 O T A L Y 3: It`s a dead centipede.
LE K 4: Beethoven was de-composing.
I E B A 1B1 O U N 1C2 E R 5: Matt opened with a white move on the first board. Jack then made
1C3 A R P O O L R R O the same opening move with white on the second board. Matt made his
A Y 1G4 U 1M5 S H O E O answering black move on board two. Jack then made this same answering
1T6 O T 1M7 U M move with black on board one. They played back and forth with Jack
IA always using Matt’s moves on one board as his own moves on the other
H 1S8 E A 1S9 A L T 2C0 A board. This meant that Matt was playing himself and that if he won one
H 2C1 H A R T E 2D2 of the games he would lose the other game, or he could draw both games.
AE But, in no way could he win both of the games!
2T3 E A 2C4 H E R H T O E
C U A E 2E5 A R N S Picture Box Answers
2H6 A I R D R E 2S7 S E R I
I 1. Time and half
overtime
E EEA EUG
2R8 E A D E R 2D9 A I R Y M A N 2. High chair
3. Vitamin A deficiency
July SolutionSolution > Beastly Business 4. Bridge over troubled
1C O 2P Y 3C A T 4S 5H O 6P O F 7F water
5. Coffee break
ARY I EE I 6. Double agent
T A 8C O 9T T O N T A I L S
1P0 H I A L O
CL H
A R O O 1D1 O E S 1K2 I N
1W3 H I P P E T O I E
E S 1R4 E 1D5 P O L L T
1T6 O W 1L7 E S
UE
A 1O8 A T 1M9 E A L 2A0 E
A 2O1 X C A R T 2S2
BL
2B3 U F 2F4 A L O U C W U
Y E L S 2U5 S H E R
2C6 H I M P A N 2Z7 E E S A F
A URO E L E
2T8 A R R E D 2O9 V E R B E A R
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
45
ft
MKEcCVAIRNTHY
THROUGH THE CAKEHOLE BBC1
SATURDAY NIGHT LIVE ITV1 Support from:
“The Ad Lib Expert” The Stage
FRIDAY 29th
SEPTEMBER 2017
BOX OFFICE
0w1w2w.0co2as3ta1lc6om3e1d6y.com
Advanced tickets £12 Sean
Doors open 7.15pm
£16 on the door. Show starts 8.30pm McLoughlin
Hotel Celebrity
‘BEST NIGHT OUT’47 Gervis Road
Bournemouth
BH1 3DD
Over 18’s only Adrienne Coles
Acts may change due Also online at:
to TV commitments
Please mention this magazine when responding to these adverts - Thank you
46
Dorset Driver Gold (DDG) at SafeWise Bournemouth
eWise road safety initiative dates for publication
Driving skills and confidence sessions helping people aged 65+ drive
safely for longer. The theory session costs just £10 per person and
orset DriverlGasotlsdu(pDDtoG3) ahtoSuarsfe, WbreisaeksBoaundrnreemfroesuhtmh eanntds SaarefeiWncilsuedWede–ymthoeuntehxt
ving skills andtchoenofirdyendcaetseesssairoenslihsetlepdingbepleoowpl:e aged 65+ drive safely for
nger. The theor•y session coSstasfjeuWst £is1e0 Bpeoruprenrseomnoaundthlasts up to 3 houTrsu, bersedaakys a1nsdt August – 1.30pm
reshments are• included – tShaefneeWxtitsheeBoroyudranteesmaroeultishted below: Monday 2nd October – 1.30pm
• SafeWis•e WeymouthSafeWise BoMuronnedmayo1u5tthh May – 10am Thursday 7th December – 1.30pm
• SafeWisTe hBoeuprnraemctoicuathl session coMsotsnd£a4y55tpheJrunpee–rs1o.3n0apnmd lasts up to 90 minutes. Once your booking form
• SafeWisaenWdepymayomutehnt have beenMroencdeaiyv1e0dthyoJuulyw– i1l0labme given details to arrange your drive directly with one
• SafeWisoefBoouurrnDemoorusteht Driver GTouldesAdapyp1rsot vAeudguDstr–iv1i.3n0gpmInstructors (ADIs).
• SafeWisIefWyeoyumtoaukteh up a practicTauleasndadyt1h2etohrSyepsteesmsiboenr –th1e.30cpomst is just £50
• SafeWise Bournemouth Monday 2nd October – 1.30pm
• SafeWisFe oWremymooruethinformation pTlueeassdeayv1is4itthtNhoevDemobresre–t D10raimver Gold webpage
• SafeWis(esBaofeuwrniesmeo.ourtgh/dorset-drTivhuerrs-dgaoyld7t/h) Doercceomnbtearc–t 1th.3e0pDmDG Administrator on [email protected] ,
e practical sesrsiionngcoorsttse£x4t50p7e7r 1pe3rs4o9n9an7d7l7as(tws uepwtoil9l0cmailnluytoesu. Obnacceky)our booking form and payment have been received
u will be givenodretlaeialsvteo aarrmanegsesaygoueradtriSveafdeirWectilsyewhitehaodnoefofficoeuroDno0rs1e2t D0r2iv5er9G1o3l3d0A.pproved Driving Instructors (ADIs).
you take up a practical and theory session the cost is just £50
LifeDrive theory sessions at SafeWise Bournemouth
rmicmeinooirsnetr0ian1tf2oo0rr2mon5ahL9tdai1idofp3egnp3D@0pe.lnrseiaavafseenewdivsisihsediot.eowtrshgiegt,oDnrioeanrdgvseoottoirdDtreretixhvdteeu0rm7cG7e,o1dla3dce4wcv9iee9dbleo7p7npa7tgisne(wgb(seytahwfheeiewlilrlicpssaeikln.loigylrolgsyu/odabounarndcskeg)ete-oxdrrprdlieevrreaiivrve-eegnroacsledmt/owe)souistranhcgdoefenrarteatsetcSatapntfohedsWetwD-istDheeGyshtectaohdleloisriyons
and practical sessions.
eDrive theoTryhisseFssRioEnEs sacthSeamfeeWisisoepBenoutornaelml yoouutnhg–pveaorpioleuasgdeadtebsetween 17 and 25 who live in Dorset and
eDrive is desighnaedvetopraesdsuecde atchceidirendtrsibvyinhgelpteinsgt ywouitnhgienr tdhrievepras stot fuonudrerysteaanrds.why collisions happen and how to avoid them,
veloping their AskiFllsRaEndEe£xp5e0riAenmceawziothnfvreoeupcohset-rteisstgthiveoerny taondepvrearcytiocanlesetshsaiotncso. TmhpislFeRteEEs stchheemcoeuisrsoep!en to all young
ople aged betwTeheen n17exatndL2if5ewDhroivlievediantDesorasreet:and have passed their driving test within the past four years.
FREE £50 Amaz•o n voucherTisugeivsednayto1e9vethryoSneepttheamt cboemr p2l0et1e7s the course! The next LifeDrive dates are:
• Tuesday•1 9th SeptemWbeedr n20e1s7day 18th October 2017
• Wednes•d ay 18th OcTtohbuerrs2d0a1y7 23rd November 2017
• TThhuurrssddaa•yy 27t3hrdDNecoevmeTmbhebrue2rrs02d107a1y7 7th December 2017
•
r more informaFtoiornm, looorkeaitnofourrmLifaetDiorinve, lpoaogke (asat foeuwrisLe.iofregD/erdivuceaptiaogn/eli(fes-adfreivwe/is)e.org/education/life-drive/)
ootWise, MSobcioliotytWScoiostee,rMTraoinbiinlgitayt SSacfoeWotieserBToruarnineminogutaht–S2a1sfteJWuniese20B17ournemouth –
feWise are worSkainfgeWin pisaertnaerershwipowrkitihntgheinDoprasrettnCelrinsihcaipl CwomitmhitshsieonDinogrGsreotuCp ltiondicealivleCr osamfemtyiaswsiaorenninesgs Gcoruorsueps ftoor dmeolbivilietyr
ooter users in Dsoarfseetty. Tahweaseressnioensssacroeudresseigsnfeodrfomr tohboisleitaylrsecadoyoutesirnug saemrsobinilitDy oscrosoette.rTohr ethsoesesstihoant saraerleoodkeinsgigtonebduyfaor those
obility scooter.aTlhreasdesysiuonssincgosat £m10opbeilriptyerscoon.oAtellrseosrsitohnossmeutshtabteaprree-lbooookeindgdutoe tbouliymaitemd oplbaicleistyavsaciloaobltee.rT.hTehneexstessions
ootWise datescaores:t £10 per person. All sessions must be pre-booked due to limited places available.
• WednesTdahye2n1estxJtuSneco–o1t0W30ihsres tdoa1te3s00ahrres:
• Wednes•d ay 9th AugWuste–dn10e3sd0harys t9oth13A00uhgrus st – 1030hrs to 1300hrs
• Friday 1•3 th October –Fr1i0d3a0yhr1s 3toth13O00chtorsber – 1030hrs to 1300hrs
more informaF(tsiooarnf,emiwnocilrsueed.iionnrgfgob/roemodkuainctigaotinino,sntirn/uscccltouioodntiswnpgilesbaeos/)eolkoionkgatinosutrrSuccotoiotWnsiseplpeaagsee(slaofoekwiaste.oourgr/SedcuocoattWioni/ssecopoatgweise/)
keability at SafeWise Weymouth – 27th May & 2nd June
e CYCLING seriousJlyil:ld’sonc’at mr iwssaosutuonnrBeikleiaabbilleitya! Hnodws‘ahweescoamlele‘ wdoJuoldhitnbefoifryoaurricdhield ecovueldryleatrinmabeouitt bbarsoickbeikedown.
ntenance, road saOfentye, sdiganaylliJnog hannd gmoantoyeeuvtriangnsoktilhlseinraonnaemaozifngthooutsdeoocrarollasd.sa“fWetyhcaetnthreaapnpdeTnHeENdptuht itshetsimkilles ?th”eyh’vee
rnt into practice by venturingaosukteodnt.o“Mthye rboardaskseursrowunednintgothuets,”afeJtiyllcsenatirde?. W“Chaatn’s myoorue, caoll mof tehitsoforgFeRtEEm! e?”
more information, including boo“kWinhg einrsetruacrtieonys opluea?s”eJlooohknataosukr Beidke.a“bI’ilmity ipnagAes(sdaafe,w” iJseil.lorrge/sepduocnatdioend/b.ikeability/)
aces are allocated on a ‘fir“sAt cnodmew, fhirestrsee’rsvetdh’ beascisa.rT?h”e dJaoyhynouar cshkileddis.aJlliolclarteedpwliielldb,e d“eIpt’esndinenthoenraegew/aitbhilitymaend.”
mbers.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
47
*** LOWEST PRICE MATCH PROMISE ***
Surewise.com
Mobility Scooter
ISnusreuwrisae.ncocme
Are you covered?
• Damage to Scooter • Theft • Accidents
• Property Damage • Breakdown • Puncture
Underwritten by 01268 200 020
The Salvation Army General Insurance Corporation
www.surewise.com
*** NO HIDDEN FEES ***
Please mention this magazine when responding to these adverts - Thank you
48
Horizon Live-in Care provides professional, To learn more about our
fully qualified and experienced 24-hour live-in care services,
live-in care services across Dorset, please contact us on
Hampshire, Wiltshire and Surrey for a wide
range of people including the elderly, the 01202 737456
infirm and those with mental health needs.
HORIZON LIVE-IN CARE
Your Horizon Live-in carer enables you to 1430a Wimborne Road,
continue to live your life in as much comfort Bournemouth BH10 7AS
and freedom as your condition allows. It [email protected]
means you can stay in your own surroundings,
maintain contact with neighbours and
retain beloved pets. Our live-in carers are
homemakers too; they are all as house proud
as the people whose homes they share and, as
well as performing day-to-day chores, provide
continual companionship and reassurance
through difficult times.
www.horizonliveincare.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com