The SEPTEMBER
Local EyeIssue 2018
155 Advertising For Local Businesses, Trades
and Community Information...
0% Finance Now on
all Beds & Flooring
4.6
0%FINANCE
ON BEDS &
FLOORING
See in store for full details
FLOORING & BED SUPERSTORE
Free Estimating Service Open 7 Days 100’s Of Room Sized
100’s Of Big Brands Free Parking Carpet & Vinyl Rolls
Free Local Delivery Available To Take Home
Off Cut Carpet Bargains
CARPETS, FLOORING, BEDS, MATTRESSES & BEDROOM FURNITURE
Nuffield Industrial Estate, Poole btehed
BH17 0RR, Tel: 01202 723162 store
Ferndown Industrial Estate, Wimborne
BH21 7PE, Tel: 01202 872240
Flooring Superstore www.carpetsandbeds.com
Stay in touch on Facebook The Bed Specialist
2
For less able clients we now display easy
access shower options, wet floor solutions,
high line toilets, shower seats, grab rails,
wet wall shower panels and more.
1D Cardigan Road, Winton
Bournemouth. BH9 1BJ
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
3
Please mention this magazine when responding to these adverts - Thank you
4
Welcome to the September issue of The Local Eye
By the time this issue hits the streets the school summer break will
almost be over. We had a great start with the weather but the last few
weeks it’s been more like the weather we are used to.
Always something for us to discuss though!
This magazine is delivered free to an alternating selection of around
13,000 homes and businesses in Bournemouth, mainly through the
Charminster, Queens Park, Moordown, Ensbury Park, Redhill, Winton,
Muscliffe & Strouden Park districts.
It can also be picked up from:
The Bournemouth Life Centre, Mike Stokes Tyres and Johns Fish &
Chips in Moordown, KwikFit Castle Lane, A-Storage in Charminster,
AH Parfitt - Chiropodist/Podiatrist in Winton, and Charminster &
Winton libraries, Moordown Community Centre, & several laundrettes
in Charminster, Moordown & Winton.
More information on rates and ad copy submission as well as online
copies of the current and previous issues can be found on the website.
01202 255485 / 08000 430485
07801 474788
[email protected]
www.thelocaleye.com
Many thanks for all your support,
Chris
Bournemouth Electric Bowls Club
Short Mat returns from 3rd October
Wednesdays from 2:00pm.
Never tried bowling?
All are welcome. A chance to meet
new friends, have some fun and
maybe discover a new hobby.
For more information
Keith: 07593 559103
Ron: 01202 252291
www.hugofox.com/community/bournemouth-electric-bowls-club-8744
Every effort has been made to ensure that the information contained within this publication was correct at the time of going to print. We
cannot be held responsible for any inaccuracies in advertisements, editorials or features nor for any consequences arising from these. We are
not to be held responsible for any errors, loss or damage to copy in printing. The Local Eye does not officially endorse any advertising material
included within this publication. It is the advertisers responsibility to ensure conformity with laws and/or acts relating to Trade Descriptions,
Sex Discrimination, Consumer Credit, Copyright etc. No part of this publication may be reproduced, stored in any retrieval systems or
transmitted in any form - electronic, mechanical, photocopying, recording or otherwise - without the prior permission of the publisher. The use
of this publication for canvassing, direct marketing or any other activity apart from sourcing local goods and services, is strictly prohibited.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
5
854 Dental Health
Professional, Friendly, Effective
Private Dentistry
01202 512967
Do you wish you had nicer or trouble free teeth ?
It is never too late to get help.
If you have dental problems and have been putting
off a visit, why not call us or pop in for a chat.
Modern dentistry can work wonders.
RICHARD J HULL B.D.S & ANGELOS SIDERIS Dip.D.S.
854 Wimborne Road, Moordown, Bournemouth, BH9 2DS
www.854dentalhealth.com [email protected]
Medical History
2000BC: You are not well, you must
eat this root.
1000AD: That root is unblessed, you
must first say this prayer.
1850AD: That prayer is superstition,
you don’t need it, use this potion.
1940AD: That potion is showmans
snake oil, you must take this pill.
1980AD: That pill is not effective, you
must take this antibiotic.
2018AD: That antibiotic is not organic,
you must eat this root.
There is now a new wine on the
market that doctors say can help cure
incontinence, its called Pinot More
A hesitant driver was waiting at a
junction, despite several large gaps in
the traffic. Eventually a voice shouted
from a car stuck behind him, “The sign
says Give Way not Give Up!”
Please mention this magazine when responding to these adverts - Thank you
6
Project Indigo
One boy’s adventure through time and space!
Hi, I’m Tom, a local Doctor Who blogger & I write about my adventures online at
anadventurethroughtimeandspace.com
Project Indigo is my blog where I travel the world visiting people and places associated with
Doctor Who. Join me today on a trip to Mars! Just kidding - we are actually at the National
Botanic Gardens of Wales.
In the Doctor Who episode The Waters of Mars (2009) the
Tenth Doctor visits Bowie Base One on November 21st 2059
and the National Botanic Garden was used as the filming
location for Biodome 1. In Doctor Who Confidential, it said
that scriptwriter Russell T Davies had the Botanic Garden in
mind when he wrote the story.
The Botanic Garden is in Carmarthenshire. This is the most
visited garden in Wales and was opened in May 2000, the
first botanic garden of the new millennium and it is built on
parkland dating back 400 years. When I arrived I walked
through the Broadwalk to The Rock of Ages which tells the
story of 300 million years of Welsh geology. I found a rock from Silurian times. In Doctor
Who we learnt that the Silurians are lizard like creatures that have lived on earth since pre-
historic times -longer than us humans. This rock was 431 million years old!
Next I went into The Great Glasshouse aka Bowie Base
One’s Biodome 1. This is the world’s largest single span
glasshouse and is based on the shape of a raindrop. It has
an amazing indoor display of Mediterranean climate plants
and protects and conserves many endangered plants.
These plants come from six areas of the world - California,
Australia, the Canary Islands, Chile, South Africa and the
Mediterranean Basin and it feels like you are travelling the
world in Wales! It was sweltering inside the dome, a lot
warmer than the Welsh climate.
In The Waters of Mars the Tenth Doctor meets the first human colonists of Mars, led by
Captain Adelaide Brooke. I found out that the glasshouse is the same climate as Adelaide,
one of two places in Australia that has a Mediterranean climate. I wonder if that is how
Russell T Davies came up with her name?
I really enjoyed my time at the National Botanic Garden of Wales, it was a fantastic way
to spend a relaxing day. I didn’t see The Waters of Mars but I did find a lovely indoor
waterfall, complete with fish. I missed out on seeing a Ghost Forest - so if I ever get the
chance to go again that is the first thing I will do!
If you would like to read about my other Doctor Who adventures please check out my blog.
Thanks for reading, goodbye!
Tom Project Indigo -- anadventurethroughtimeandspace.com
What did the get cannibal get when he was late for dinner? > The cold shoulder.
Why don’t cannibals like eating weathermen? > Because they give them wind.
“I hate my mother-in-law” said one cannibal. “Well just eat your spuds” said the other.
How do Chinese cannibals eat their food? > With chap-sticks.
Why was the cannibal looking a bit peaky? > Because he’d just eaten a Chinese dog.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
7
ODfifsercsoFuonrt ASPECT AsCpoedcet L.Eye
CONSTRUCTION
EXTENSIONS
CONSERVATORIES
LOFT CONVERSIONS
PROPERTY MAINTENANCE
A PROFESSIONAL APPROACH TO BUILDING
GUTTERING & DOWNPIPES
SOFFITS & FASCIAS
07525 805091
Local Bournemouth Company - Established 25 Years
Previous Projects Available To View - Meet Our Happy Customers
CUSHIONS REFILLEDHacluvoOesshtoyiomothunpershir?20%cushOiofnfall
refills
FROM THIS FOAM - FABRICS - SUNDRIES
TO THIS All aspects of upholstery undertaken
890 Wimborne Road, Moordown, BH9 2DR
01202 516949 : [email protected]
Please mention this magazine when responding to these adverts - Thank you
8
Mount Pleasant Townswomens Afternoon Guild
We meet in the Bradpole Road Community Centre at 2pm on the 1st Wednesday of every
month for a social afternoon, when we have different activities including a speaker, and
we welcome visitors who we hope may join us and become members of TG.
Our other activities include Trampers & Eaters (when we visit nearby places of interest
and end up with lunch), skittles, a music afternoon (all sorts) and a Social Studies
afternoon when we reminisce and discuss any current subjects of interest.
Charminster Afternoon Townswomens Guild
Trinity URC Hall, Sutton Road
Next meeting > 2pm Tuesday 25th September
Guest speaker - Jean Mitchell > Making cards
Come and meet us and make new friends,
and find new interests!
Further details from our secretary,
Margaret, on 01202 512543
St Albans Garden Club
St Albans Church Lounge
Next meeting > 2pm Monday 17th September
Guest Speaker - Mike Read
Nature of Vercors...
A Hidden Corner of France
Further details from Margaret, Tel: 01202 512543
Contact The Elderly - Hosts/Hostesses & Drivers Required
Once a month elderly people are taken out by a volunteer car driver for a little
ride and tea at volunteer host and hostesses home.
We need more volunteer host and hostesses who would be willing once a year,
on a Sunday afternoon, to entertain up to six elderly people
and their drivers for afternoon tea, (a downstairs cloakroom is essential).
Also reserve car drives are needed for two Sunday afternoons a year
when the regulars are unavailable.
If any elderly people would like to go on our reserve list for just an occasional outing to start with
and they do not have family in the area please contact
Carolyn Dennis 01202 424482
Once there was a golfer whose drive landed on an anthill. Rather than move the ball,
he decided to hit it where it lay. He gave a mighty swing. Clouds of dirt and sand and
ants exploded from the spot. Everything but the golfball. It sat in the same spot.
So he lined up and tried another shot. Clouds of dirt and sand and ants went flying
again. The golf ball didn’t even wiggle. Two ants survived. One dazed ant said to
the other, “Whoa! What are we going to do?” Said the other ant:
“I don’t know about you, but I’m going to get on the ball.”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
9
GARDEN MAINTENANCE
Lawn Mowing • Garden Tidy Up • Turfing
Hedge Trimming • Lawn Treatment
Mulching • Waste Removal & Disposal
GENERAL MAINTENANCE
Pressure Washing (Driveway & Patio etc.)
Painting & Decorating • Fence Repairs
Deck Repairs & Treatment • Shed Repairs
& Removal • Waste Removal & Disposal
PROMPT - RELIABLE - EFFICIENT
For urgent jobs, one-offs, or regular fixed price service call
01202 805 375
www.EdsGardenMaintenance.co.uk
WINTON WOOL SHOP
CARLY‛S CRAFTS
Stockists of:-
PATONS ~ RICO
STYLECRAFT ~ SIRDAR
ROWAN ~ KING COLE
Large selection of Patterns,
Needles and Accessories
Baby Clothes, Shawls and
Blankets Knitted to order
Shop 1, 1a Cardigan Road
(road opposite Poundland)
Winton BH9 1BJ
01202 512106
Delivery Service available
Please mention this magazine when responding to these adverts - Thank you
10
Stephens
Carpentry & Building
Kitchen Fitting General Building
Renovations
Fitted Wardrobes
& Cupboards Bricklaying & Plastering
Patios
Door Hanging,
Architrave & Skirting General Maintenance
Fencing, Decking, Sheds
1st and 2nd Fix
No Job too Small • References Available • Fully Insured • Free Estimates
Brian Stephens
Tel: 01202 525 445 Mob: 07921 525 424
[email protected] www.stephensbuilding.co.uk
26 Green Road Bournemouth BH9 1EA
SUDOKU
How to Play
Fill in the grid so that every
row, every column,
and every 3x3 box
contains the digits
1 through 9,
with no repetition!
Simples!
You solve the puzzle with
reasoning and logic,
there’s no maths involved
and no adding up.
It’s challenging.
It’s addictive!
It’s fun.
(Solution on page 44)
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
11
RH ROOFING
A family run local business providing a
multi disciplined roofing service for 25 years
Our services include:
Tiling ^ Slating ^ Velux
3 Layer Felt ^ Duo-Ply
Leadwork ^ Terraces
Balconies ^ Walkways
Moss removal
Emergency Repairs
From Single Tile / Slate
Replacement
To Full Re-Roofing
Competitive Rates
References Available
Residential Customers, Local Authorities, Managing Agents,
Companies, Builders, NHS Trusts
01202 522389 / 07786 154920
rhroofi[email protected]
www.rhroofing.net
Please mention this magazine when responding to these adverts - Thank you
12
“Your Child’s Foot Care”
It’s back to school time and it’s important to be
prepared. The usual stuff like buying new uniforms,
stationery and books etc is behind us now, but it’s
also important to check your children’s feet. This
article is not meant to scare you, but to provide
some hints and tips for what to watch out for.
As any parent knows, children tend to catch more
colds as their immune system builds up, but they
are also more likely to catch verrucas and fungal
infections such as Athlete’s foot.
Verrucae and fungal infections are incredibly easy
to catch, especially from changing rooms in swimming pools. Verrucae do occasionally disappear
by themselves but generally they require treatment. Verrucae present themselves as a small lesion
with tiny black dots but if left untreated, they can develop into clusters. At A.H.Parfitt, we offer
three different forms of treatment. The standard treatment is a salicylic acid paste where we
remove layers of skin until the verruca is gone. The second treatment available is low level laser
therapy. This is painless and involves coming in once a week for up to 6 weeks. The laser works by
pulsing the verruca virus, destroying the verruca. Finally, the most aggressive treatment available
is cryosurgery. This involves using liquid nitrogen to freeze the verruca. However, this can be
extremely painful and is not recommended for children.
Something else that is very easy to catch from
communal changing areas is Athlete’s foot, also
known as tinea pedis. It usually presents as flaky
and scaly skin which is very itchy. It most commonly
manifests itself between the toes but can be found in
other areas of the foot. We have a few creams in store
which we can offer to help treat this condition, but
as usual, prevention is the best cure. Tinea pedis can
be prevented in much the same way as verrucae, by
avoiding walking barefoot and keeping your feet dry.
We are always happy to hear from you here at A.H.
Parfitt, so do not hesitate to give us a ring if you have a
query or would like to make an appointment.
A H PARFITT CHIROPODIST / PODIATRIST
533-535 WIMBORNE ROAD
STATE REGISTERED WINTON BH9 2AP
HPC REGISTERED
Tel: 01202 528942
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
13
OPEN EVENING
Wednesday 26 September 2018
6.00pm - 8.00pm
If you are unable to attend our Open Evening, please contact us for an
appointment on one of our Monday or Wednesday morning tours.
THE BOURNE ACADEMY
OPEN EVENING
Wednesday 10 October 2018
6.00pm - 8.00pm
The Bourne Academy, Hadow Road, Bournemouth, Dorset, BH10 5HS.
[email protected] | 01202 528554 | www.thebourneacademy.com
Please mention this magazine when responding to these adverts - Thank you
14
Isn’t there
something you’d
rather be doing with
your spare time?
Could you use some help with your Cleaning, Ironing or Both?
• Regular hourly rate only £12 - £13 per hour
• One off spring cleans available - call for price details
• Times and hours to suit you - (minimum 2 hours per week)
• Reliable, honest, professional service
• Insurance provided
Call 0800 0925 773
Email: [email protected]
You deserve a rest... So be served by the best
A All Saints Church
Castlemain Avenue, Southbourne BH6 5EH
7:15 - Saturday 15th September
All Saints Church are putting on a production called “Would You Adam & Eve It?”
by the Searchlight Theatre Company.
Ticket prices are £8 in advance (£10 on door), child £5.
Tickets can be obtained from the church office by phoning 01202 253983.
Refreshments will be available.
‘Would You Adam & Eve It?’ shows what happens if you tell two chaps
who like to make people laugh; dramatise all 90 chapters from the first two
books of the Bible.
With a few strategic speedy bits to help it achieve a 90 minute running time
- it has amazed audiences around the world for the last 9 years, including the Edinburgh Fringe Festival.
Danny had recently passed his driving test and decided to ask his clergyman father if there was any
chance of him getting a car for Christmas, which was yet some months away. ‘Okay.’ said his father ‘I tell
you what I’ll do. If you can get your ‘A’ level grades up to ‘A’s and ‘B’s, study your bible and get your hair cut,
I’ll consider the matter very seriously.’
A couple of months later Danny went back to his father who said ‘I’m really impressed by your commitment
to your studies. Your grades are excellent and the work you have put into your bible studies is very
encouraging. However, I have to say I’m very disappointed that you haven’t had your hair cut yet. Danny
was a smart young man who was never lost for an answer. ‘Look dad. In the course of my bible studies I’ve
noticed in the illustrations that Moses, John the Baptist, Samson and even Jesus had long hair.’ ‘Yes. I’m aware
of that...’ replied his father ‘... but did you also notice they walked wherever they went?’
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
15
Zoe Bellamy
BSc.Pod.Med - M.Inst. Ch.Pod
Chiropodist / Podiatrist
Dog Walkers CHIROPODY
& HOME VISITING
Home Visitors SERVICE
In The IN YOUR AREA
Bournemouth Area For total footcare please call
Tailored to you and your dogs needs, we 01202 309932
provide a bespoke dog walking and care
service. For your peace of mind, we have 24 HOUR ANSWERING SERVICE
had years of experience with dogs and
are also fully insured.
Tel: 01202 468978
Mbl: 07775 905263
Email: [email protected]
www.howlinggoodwalkies.uk
Please mention this magazine when responding to these adverts - Thank you
16
Derek J.Rolls
Independent Estate Agents & Valuers
Top Tips For Selling Your House
First Impression – This can be make or break. If a potential purchaser is put off before
the entering the front door then it’s over before its begun. Take a look at the outside of
your home as a stranger might see it. It might be winter and very wet but for a small
sum or some time and energy you could tidy the garden, paint your front door and get
a sale.
Tidy – Be obsessive about this, as it is a make or break to a prospective client. Our
advice is to have a seriously good clear out before you put the house on the market
– even if you bundle up your prized possessions and take them off site. Prospective
buyers want to see clean lines and uncluttered work surfaces that create a feeling of
space
Clean – Fresh, sparkling and inviting would be perfect. Hard to achieve when you
have an active life with pets and children, but the cleaner your house is the easier it is
to sell. If you cant face the task we can put you in touch with someone who will provide
a full deep clean for your home.
Bathrooms – Generally we don’t advise sellers to refit a bathroom prior to sale –
unless it is really ghastly. Do the obvious instead – re-grout, re-silicon, fluffy towels,
pleasant scent, clean and spotless please.
Kitchen – Spare a thought for the poor estate agent as you dash out of the house
without loading the dishwasher! We want to take pride in your house when we show
clients around and leftover breakfast is not the first thing they want to see as they enter
the kitchen.
Brief the agent – The more we are prepared to answer questions about your house
the easier it will be to sell it and allay any fears that prospective buyers may have.
As an estate agent we dislike not having the answers. And we particularly dislike not
knowing how your gadgetry works so please do show us how to use the iPad entry
system, the drop down cinema and the fancy lighting system. If we make it look easy
the clients will love it. If we don’t know how it works, then they won’t.
Odour – It may seem trivial but the aroma of your house is really very important when
you are selling. A simple diffuser discretely hidden in the hall could do the trick. Some
people proffer the advice of coffee and home baked bread but be realistic. It could
take a few weeks to sell your home and you cannot be there ready to turn on the bread
maker at the drop of a hat.
Animals – People’s pets are much loved by the owner but very often just the owner
and not necessarily the person that is going to buy the house. Pets also can have quite
a strong odour, not to mention the litter trays, food bowls and clutter that goes with
having an animal in the house. Try to keep pet evidence to a minimum.
01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG
www.derekjrolls-estateagents.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
17
Derek J.Rolls
Independent Estate Agents & Valuers
Local Estate Agents Dealing With
Local Property Sales & Purchases
SOLD We have over 50 years of
combined knowledge and
experience in selling homes
in the area so truly do know what
your property should be worth
in todays market.
We work closely with our SOLD
clients and their solicitors to
assist in the smooth sale and
purchase of their homes.
SOLD Please call us on
01202 525778
or email:
offi[email protected]
for a free market valuation.
NO SALE NO FEE. COMPETITITVE COMMISSION RATES
01202 525778
958 Wimborne Rd, Bournemouth BH9 2DG
www.derekjrolls-estateagents.co.uk
Please mention this magazine when responding to these adverts - Thank you
18
Expert Advice with a Friendly Face
Gales Solicitors merges with Robert Wrynne Solicitors in Tuckton
Gales Solicitors, the family law firm based in Winton, has announced its merger with Robert Wrynne
Solicitors in Tuckton which will now be known as Gales Solicitors incorporating Robert Wrynne
Solicitors. An official opening of the newly named Tuckton office took place and the Mayor of
Bournemouth, Councillor Derek Borthwick attended and cut the ribbon.
Gales Senior Partner Matthew Moore welcomed the team at Robert Wrynne to the Gales family and
said, “We were looking to expand in Bournemouth and were well aware of Robert Wrynne Solicitors, a
very well established and respected firm with an excellent reputation in Tuckton and the surrounding
areas. Their ethos really fits well with us. Like our business they depend heavily on recommendations for
future work and both businesses really value the communities in which we work.”
Continuing Matthew added, “We will be building on the core work of Robert Wrynne in Conveyancing,
Private Client and Family Law. We are also looking forward to offering a new service for Employment
Law and Civil Litigation. Over the next few years we hope to develop and expand the firm, building on the
hard work of Robert and his team.”
Cllr Derek Borthwick congratulated both companies on their innovative move to increase business and
wished them all the success in the future with their merger.
Robert Wrynne concluded, “We are delighted to see that this merger will maintain, and I’m sure develop
the Tuckton office. I am looking forward to continuing to work with the business in my new capacity as a
consultant.”
About Gales Solicitors
Gales Solicitors was established in 1948 by John Gale and has been providing legal advice to the people
of Bournemouth and the surrounding areas for 70 years.
Now located on Winton high street, Gales Solicitors continue to deliver a professional service from a
local base. Offering legal services to both individuals and business clients. The company prides itself on
offering expert advice with a friendly face.
Actual warning labels & notices...
Full size windscreen sun shield: Do not drive with this visor in place.
Bottle of bleach: Do not look down nozzle when squeezing this bottle
Box of nails: Do not swallow - May cause some irritation
On a camera: This camera only works when there is a film inside
Bottle of red wine: Best served with or without food
Bikini: Do not expose to direct sunlight
Hotel pool in Sri Lanka: Do not use the diving board when the pool is empty
Microwave oven: Not to be used for drying pets
Christmas fairy lights: For indoor or outdoor use only
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
19
Please mention this magazine when responding to these adverts - Thank you
20
Brain Power
1: At a recent birthday party there were four mothers and their children. aged
1, 2, 3 and 4. It was Molly’s child’s birthday party. Jack is not the oldest child.
Alice had Carol just over a year ago. Debbie’s child will be 3 next birthday. Neil
is older than Charlie. Jackie’s child is the oldest. Charlie is older than Debbie’s
child.
Can you work out whose child is whose and their relevant ages?
2: Four couples met at the local pub to discuss the improvements they had made
to their houses.
Jerome had not recently had a new shower room. Melanie had not yet done her
kitchen, but perhaps would update it next. Terry, who is married to Suzy, had
not had new windows. Penny delighted in showing photographs of her new
conservatory. Neither Martin nor Phil had a new kitchen. Lauren had not had
new windows. Jerome, who also had not had windows, is not married to Penny
and Martin is not married to Melanie.
Who is married to whom and what work had they recently undertaken, assuming
that each couple had one improvement and no two couples had the same
improvement.
3: If a certain month of the year has five Saturdays and the third Saturday is
the 17th, what is the date of the last Monday in that month and on what day is
the 2nd?
4: What phrase or item relates to the code lines. A number & Letter
combination. For example:
7 W of the W = Seven Wonders Of The World
60 S in a M 7 D in SW 26 L in the A 30 D in N
5: Buttered cat paradox - Based on two popular statements
A.Buttered toast always lands butter-side down.
B.Cats always land on their feet.
So..What happens if we tie a piece of buttered toast with the buttered side up on
the back of a cat and drop the cat from a reasonable height?
6: Identify this well known proverb which has been re-written at some length...
Each vaporous mass suspended in the firmament has an interior decoration of
value.
Answers on page 44
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
21
LFB MEATS
01202 533997 X
www.lfbmeats.com
HBBBeraQittwiTsahIvMe?E!
Make the most of this wonderful weather with a great
selection of meats for your BBQ
BBQ PACKS FROM £3.99 each
Pork Ribs, Chicken, Burgers, Sausages
Also available a wide
selection of flavoured
sausages...
Pork & Leek, HoneyRoast,
Merguez, Hot Chilli,
Old English, Romany, British
Banger, Black Pepper, Beef
& Beer, Alabama, Stilton &
Chive, Sun Dried Tomato,
Pork & Apple.
(*all subject to availability)
Frozen Fish Fillets...
7-8oz Cod Loin
6-7oz Haddock
6-7oz Salmon
349-351 CHARMINSTER ROAD, BOURNEMOUTH. BH8 9QR
(Opposite Esso garage, lower Charminster)
Please mention this magazine when responding to these adverts - Thank you
22
Buddy is a 3 yr old Chihuahua X. He is looking for a very special home as he
is diabetic. He requires 2 insulin injections daily but he is very good about
this. He is a cheeky chap and loves to be with you. He is good with other
dogs and with children but he is not a rough and tumble type dog. He loves
to run around in the garden and enjoys his walks. He would need somebody
who is able to keep to a timetable because he needs food and jabs at set
times. A lovely boy who deserves that special home
For more information on Buddy or any of the other animals in our care please contact us on
01202 875000, e-mail: [email protected] or visit our website www.waggytails.org.uk
Waggy Tails Rescue are proudly presenting our annual Variety Concert on the 8th September at
Q E school Wimborne. This concert will showcase some local talent ranging from children
dancing courtesy of Prompt Corner Academy of Dance to various adults singing and playing all
who are giving up their time without charge. Details are on our website. A fun evening so please
come and support these acts who have kindly agreed to appear.
The event is kindly sponsored by Conduent.
Waggy Tails Rescue is a registered charity in Dorset;
We rescue and rehome dogs that have been abandoned, neglected or otherwise in need
of a new home. We also find homes for other small furries that may be in our care.
To find out more contact us on the number above or send donations or letters to:
Waggy Tails Rescue, Helens House,
143 Magna Rd, Canford Magna
Wimborne, BH21 3AW
“Bourne2Sing” Male Voice Choir
www.bourne2singchoir.uk
The Choir sings at a variety of local venues for Chari�es and Good Causes and since it’s incep�on
on the 4th February 2013 has raised in excess of £19,000. Our ethos is to have fun from music
by singing tunes that are familiar and pleasing for our audiences.
”Bourne2Sing” has grown hugely in popularity and our success can be gauged from the
con�nued number of repeat bookings that we receive.
Performances are given in two segments and presented by a Compere
with a Guest Ar�ste solo spot in each half of the Concert.
Future Concerts are: (All Performances commence 7.30pm)
21st September: St Mark’s Church, Highcliffe BH23 5AB
In Aid Of Fund Raising For “The Friends Of St Mark’s”
13th October: St John’s Church, Broadstone BH18 8AR
In Aid Of Fund Raising For The Church
17th November: Lady St Mary Church, Wareham BH20 4ND
In Aid Of Fund Raising For “The Mayor Of Wareham’s Charity”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
23
Experienced, Honest and Reliable Multi-Skilled Handyman
Inside Outside
Carpentry Decking
Plumbing Patios
Plastering Gardening
Tiling Pressure Washing
Painting and Decorating
Available for full or half day hire to catch up with all the little jobs you have
been meaning to do.
Phone David McDonald for free no obligation quote 07951738446 or e mail
[email protected]
Numerous references available.
Please mention this magazine when responding to these adverts - Thank you
24
Carpet Rugs Wood
Laminate Vinyl
Carpet Tiles
Luxury Vinyl Tiles
Commercial Flooring
Visit our new Karndean flooring showroom
01202 524052
www.cutwisecarpetsbournemouth.co.uk
39/41 Charminster Avenue, Bournemouth. BH9 1RR
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
25
01202 530 500
922 Wimborne Road
Bournemouth
BH9 2DH
Eye Examinations RCoInowcnloatranpcdotRrLaoetbinnesgertss
Complete Spectacles in association with
Diabetic Eye Screening
Hearing Assessments
Hearing Healthcare Service
Please mention this magazine when responding to these adverts - Thank you
26
Pies, Pasties, Savouries & More
WE ONLY USE FREE RANGE
MEATS FROM LOCAL FARMS
Vegetarian & Vegan Pies also Available
Call: 07826 347640
Email: [email protected]
872 Christchurch Road, Pokesdown, BH7 6DJ
Fruit & Veg Box Winners!
Another happy winner of the
monthly prize crossword.
The July winner, Eileen Bendall, receives her prize, here
being presented with a lovely box of flowers, fruit and
vegetables by Claire Oates, the treasurer of the
North Bournemouth Allotment Society who very kindly
donated the prize.
See page 43 for this months prize crossword,
and your chance to win 2 free tickets to Coastal Comedy on Friday 28th September.
More details of the venue are on page 45.
Are you a manic?
Ailuromaniac - Cats <> Ablutomaniac - Bathing <> Arithomaniac - Counting
Bruxomaniac - Teeth grinding <> Chionomaniac - Snow <> Cynomaniac - Dogs
Dromomaniac - Travelling <> Erythomaniac - Blushing <> Ichthyomaniac - Fish
Nudomaniac - Nudity <> Oniomaniac - Buying <> Phagomaniac - Food
Philopatridomaniac - Homesickness <> Timbromaniac - Stamps
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
27
FOR A FREE ESTIMATE
Call 07790 654729
Email [email protected]
Visit rpmservices.biz
Quality Automotive Valeting & Detailing QUOTGEETR1P0M%EOYFEF2:
Covering Bournemouth, Poole and surrounding areas
Providing your vehicle with the highest quality service to ensure it looks it’s best!
Using premium products to guarantee a quality finish, whether it’s a maintenance
wash, or being treated to full protection and restoration works, our range of services
can cover your requirements. See our website or contact us for more details.
FOLLOW US @RPMSERVICESDORSET
www.riseandshineevents.co.uk [email protected]
RISE AND SHINE EVENTS LTD
#RAS #DrivingBusinessTogether #ShowcaseAndShine
Sundowners Networking A Drive of Respect
Social Showcase And Shine Main Event
- 19th July 2018 - 26th August 2018
at The East Close Hotel at The East Close Hotel
Christchurch Christchurch
To keep up with our events please follow our social media channels
Rise and Shine Events Ltd riseandshineevents @RiseAndShineBiz
proud to partner with
Sponsorship
opportunities
are now
available
Please mention this magazine when responding to these adverts - Thank you
28 Therwe’wswm.moorree2tmooMorodoowrdno.cwomn
M MTA Business Focus
Fitz Butler-Smith
AMSOTSOROACRDIDAEOTRIWSONN
Dorset Steam Cleaning Services
I decided I really wanted to work for myself after 30
years of shift work, and it needed to be something
that would make use of the skills I had learnt along
the way.
I had already stumbled on a website article about the
huge number of people suffering allergies caused by
dust mites, chemicals and mould in their own homes
- and the huge health advantages of steam cleaning
over chemical cleaning.
I was hooked and researched further, eventually ordering a professional steaming machine
which was put to immediate use in my own bathroom and kitchen - with the most amazing
results!
At that time there really wasn’t a lot of information available about the benefits of steam
cleaning so I took to steaming everything around my home including the oven, carpets, even the
greenhouse, just to see if the same amazing results could be achieved without any chemicals.
And they could!
It all fell into place and Dorset Steam Cleaning Services was born right here in Moordown,
providing a chemical-free deep cleaning service to local residents and businesses. I finally feel I
am doing something worthwhile and that I am really passionate about, by reducing chemical use
and levels of toxins in homes across the area, one property at a time!
If you would like to find out more about my full range of services and the benefits of steam
cleaning, please check out my website and Facebook page, or just give me a call:
Fitz Butler-Smith
www.dorsetsteamcleaning.co.uk
www.facebook.com/
DorsetSteamCleaningServices
Email: [email protected]
Mobile: 07886 086803
The Moordown Traders Association meet monthly between 6pm-8pm
upstairs at the Moordown Conservative Club in Balfour Road.
All Moordown traders & businesses are welcome.
Next meeting dates are:
Tuesday 18th September / Tuesday 16th October
For more information visit: www.more2moordown.com
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
29
RR..JJ..HHuuAlcllclo&&unCCtaoontmms ppaannyyCertified Practising Accountants
AAAccccccooouuunnntttaaannntttss331122ChCahrmairnmsteirnRsotaedr, BRoourandem, Touetlh:, 5B3H38397R0T
s01202 533370For more than 25 years we have been assisting business
312 Charminster Road, Tel: 533370people in the Charminster and surrounding areas with :-
331122 CChhaarrmmiinnsstteerr RRooaadd,, TTeell:: 553333337700PimnlacenlauasdegeeepppFFFm∗∗∗PnoooeeeqaLPSerrryooouFnoiarPLSiPLLPSStpppmmmmaorlFFFroooaeiiiaeaallslltdlmammaallloeooeeia,rrrnteveeTstssb,tttBrrreieiiiiiinnntttoceeereTTTntonntt,,,rdueeeeeaeofrrrseeetttttrttdrrfoddkdaaahChhhohhhifffssswnkcfeffddduaaaCiCCeheehheoiiiariprccceneennewieiimooocpCfCCiiippprrraiaoeeenmmm3i33wxncpaaahhhmcaaannn0t00egccpccpp.aaaadccccptttprayyycoccaraanrrlocccopppnjeemmmoeooeeunnnroyoouthdeeeeruuuaaanvyuyyuuniiiuVsrrramanrnnrrnnntnnntsssoaraacAssssltttsasssitottoolacnccssscnsTsstttawwwbnnneceeccaao,lcgaaaoooeeeerrralueclllluuufsanlaamhhhoesssnnnecnnneteaaaueeeostttrndddbvvvsmssrrrnvtaeeevvvpsssssiteiciiiauuu∗∗∗asbbbcccrnevrrrPTBneeeyeeePBTBTPPTBirrrcaaaoteeeorooaaaaaaaaoooeestyxonnnuuuttttyxyyoxxoof.ukarocnnnaaaRrkrrkkraaaoRRRrfkonooodddfffkkkfssselLfffseeeollle.loooiiisss,eeetllluintnnttremuiiiarrreueeuusssdgkggndpddrippprrrtttntnaiiiienannaaiiiauaannnndnnnbsbbbsssarrrgggglgggceeelllloaeeeeaaabbb&&c&&mscssffffuuupoeeeeVVVVswsswwaueeeeniiiAAAAnnnniiisssistttteTTTTseeehhhs, sssat:::osssn---d
imPPmmPiinnnlllcacaaceeelnnlnlaaauuuaaasssdddeeegggeeeeeeeeemmmPPPnnnqaqqaaeeeyyyuuunnnrrriiitttoroorreaeeaalllldllddaaa,,,vvvbbbBBBiiiooocccoooueuueeoootttoookkkooonnnkkkuuueeeaaarrreeecccpppfffiiioooiiixxxnnnmmmeeegggdddpppaaalllooonenneerrrtttdddeeevvvVVVmammaarrrAAAaaaiiiaaannnTTTbbbaaa,,,lllgggeeeaaaeeelllfffmlmmlleeeccceeeeeeooonnnbbbmmmtttaaapsppssssseeeiiiaaasssrrrnnnvvvyyyiiicccrrreeeeeetttfffuuuooorrrrrrnnnLLLsss,,,iiimmmaaannniiinnnttteeeuuudddaaalllcccoooaaacccmmmcccpppoooaaauuunnnnnniiittteeessssss,,, aaatttooonnnddd
Try our authentic
Mexican Food in
Boscombe Market
every Saturday.
Also available for
events and parties.
07870878143 The Happy Mexican
Please mention this magazine when responding to these adverts - Thank you
30
Travel Feature -
On the Beach – in Dorset – South Coast ...
By Mags Addison
Aren’t we lucky to live where we do? Why go abroad when we have all this
beautiful scenery here in the UK? Yes, I hear this all the time, and agree –
our part of the UK in the South is stunning. However, I could still give you
many reasons why it’s always worth venturing further afield – after all there
is a big world out there to discover with its many wonders.
But for this month – lets us celebrate the beautiful beaches we have on our
part of the South of England. And in view of our recent hot summer, there
is nothing nicer than a morning stroll, along the shoreline, an early evening
BBQ on the beach, or sitting with a flask of hot coffee, or cool glass of wine, watching the sun go
down. How wonderful to do this when you have views like Old Harry Rocks in the distance, The Isle of
Wight, or the Purbecks. And if you are up for it during our British summertime - it’s bracing to have a
swim as our beaches are gently shelving.
I’ve done much of the above in places around the world, especially the early morning walks and the
sunsets - and they have been spectacular – but there is something about it being on your own doorstep
to make you truly grateful and appreciate it being close at hand.
Bournemouth and Poole share a stunning 7-mile-long beach that spreads from Hengistbury Head
to Sandbanks – beautiful soft white sand beaches. The promenade runs most of the length making
it ideal for strolling or cycling. What makes it unique are the many Chines strewn along the way –
giving different access points that take you away from the bustle of the central Pier approach and the
gardens.
Everyone uses their preferred chine, due mainly to the proximity of where they live, or access in getting
to the beach, and of course - the parking! Something we have consider in our corner of paradise - it’s
wonderful living close to the beach but parking your car in high season is another story. I’ve spent
many hours driving around trying to find somewhere to leave the car. And of course, paid parking is
so expensive in this area.
Dorset is a beautiful county, and the sheer variety of coast and beaches is diverse and spectacular. It
ranges from: Highcliffe, Mudeford, Hengistbury Head, Southbourne, Fisherman’s Walk, and Boscombe
down to Bournemouth. Then onwards to: Durley Chine, Alum Chine, Branksome Chine, Canford Cliffs,
Flaghead Chine to Sandbanks on the Poole peninsular. Across the bay in the Purbecks, the beaches
become more individual, and the scenery is stunning – West Dorset is one of my favourite places and
loved by locals and tourists alike: Studland, Swanage, Kimmeridge Bay, Lulworth Cove, Durdle Door,
Weymouth, Isle Of Portland, Chesil Bay, West Bexington, Bridport
– West Bay and down to Lyme Regis
What treasures! Our area is also famous as the Jurassic Coast in
Southern England. This World Heritage site extends from Old Harry
Rocks near Studland to the city of Exmouth. However, I love the
beaches in all parts of Dorset, and the views are truly incredible
everywhere. But I do have my favourite chine locally– which is
yours though!
Beach holidays, City breaks, Honeymoons, Weddings abroad, Adventure holidays, Ski,
Cruise, Tailormade trips, Flight only, Car hire, Airport hotels and parking and much more...
Contact Travel Counsellor
Mags Addison
018240520598017389102 Travel Counsellors ensures complete
financial protection on every booking
[email protected]
www.travelcounsellors.co.uk/margaret.addison
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
31
VETERINARY CLINIC
144 Richmond Park Road
Bournemouth, BH8 8TW
Are you struggling with the costs of private vet care?
We offer affordable veterinary services for your pets
Consultations £16 Boosters from £22
Neutering from £32 for cats, £55 for dogs
You could be eligible if:
• Your household has a low income
• You are a pensioner
• You receive means tested benefits
For more information on how to register
Please call the clinic on 01202 526520
Monday – Friday 9.30am – 4pm
Registered Charity No. 205126
Berry Hill Farm
Local Vegetables for local people
GUARANTEED FRESH SEASONAL VEGETABLES
DELIVERED TO YOUR DOOR IN HOURS
Grown locally in 1-2 people - £9.00
Bournemouth for approx 6 servings
local people, 2-4 people - £14.00
using only approx 10 servings
traditional
4-6 people - £19.00
farming methods. approx 14 servings
SELECT A BOX TO SUIT All boxes contain a selection of fresh seasonal vegetables
YOU AND WE DELIVER IT
For example: Potatoes, Cauli, Bunched Carrots, Cabbage, Brussel Sprouts, Purple
FRESH TO YOUR DOOR
Sprouting Broccolo, Leeks, Swede, Parsnips, Celeriac, Runner Beans, Broad Beans,
Marrows, Courgettes, Peas in Pod, Bunch Beetroot, Sweetcorn, Kale, Seasonal Salads.
Tel. 07971 795740 Berry Hill Farm, 185 Muscliffe Lane, Throop,
www.berryhill-farm.co.uk Bournemouth BH9 3NH Email. [email protected]
Please mention this magazine when responding to these adverts - Thank you
32 Picture Box
DROP IN FOR COFFEE A simple question of say what you see?
AND A CHAT!
Every Wednesday For example the first one below is?
2.00 – 4.00pm
GUESS
FLIRT CAFÉ BAR
GUESS
The Triangle, Bournemouth
‘Second Guess’ of course!
For all who would like a chat
and to meet new friends. BA O
PhD N
Assisted by the Lions Club of Bournemouth BSc
3.142
X
(Answers on page 44)
Did you know....
The record for completing a Rubiks Cube is 16.5 seconds!
Sheep buried in snowdrifts can survive for up to two weeks... brrrrr!
Hawaii had a rat problem so the mongoose was introduced to kill the rats, but the
plan failed because the mongoose hunts during the day, the rats were nocturnal.
An ‘artist’ in Chicago made a statue of Madonna using 180 pounds of ham.
Goat meat contains up to 45% less staurated fat than chicken meat.
Locked in a sealed room, you would die of CO2 poisoning before oxygen starvation.
The water pounding over Victoria falls can be heard up to 40 miles away.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
33
D Learn To
A
N Dance Now
C
E
D Specialists in the following:
A
N *Ballroom
C *Latin
E *Junior Street
*Ballet & Modern
D *1st Wedding Dance
A
N *Adults
C *Juniors
E *Tiny Tots
D ANGLO DANCE STUDIOS
A 93a Chatsworth Road
N Bournemouth BH8 8SN
C Tel: 01202 514551
E www.anglodance.co.uk
Please mention this magazine when responding to these adverts - Thank you
34
Do You Know About Raw Food For Cats & Dogs?
For generations, dog owners have been buying bags and/or
tins of pet food. Many people still do this today. Some pet food
brands are more expensive than others and there are several
foods today that claim to be all natural. Over the past few years,
more and more owners have been switching their dogs and cats
to a raw food diet.
Dogs, unlike cats, also need a mix of vegatables with their meat. We can supply these in addition
to the raw foods or you can also choose from a selection of premixed meat/vegetable packs.
Benefits of a Raw Food Diet:
Owners who take their dogs for a walk in public areas are required to clean up the dog’s poop
after he goes. If you find that your dog’s pooh is soft and sometimes runny, it can make cleaning
up after him a very disgusting job. If you start your dog on a raw dog food diet, you will notice
that his stools are firmer and much easier to clean up.(It’s a lot less smelly too!)
It is not uncommon for dogs to have digestion issues when they eat bagged or canned dog food.
Some dogs get very gassy, which can be pretty bad for anyone who is in the room with the dog.
Some dogs vomit after a big meal. If you start your dog on a raw dog food diet, he will get a
daily supplement of probiotics, making digestion easier.
If you have ever seen a wolf or a wild dog, you know that they often have beautiful, shiny coats.
This is because they are eating a raw dog food diet on their own. This diet will give your dog all
the vitamins and minerals that he needs to keep his coat and his skin healthy.
Many dogs have yellow teeth, infected gums, and very bad breath. This can due to the fact that
they don’t brush and floss every day and because they are eating manafactured dog food.
When you switch your dog to a raw food diet, his teeth and gums will be healthier and his breath
will smell much better.
The carbs in bagged dog food can give your dog a huge spike of energy, only to have him crash
later. The additives in commercial dog food can have the same effect. If your dog is overly hyper
for a while after eating and then strangely lethargic shortly after, you should switch him to a raw
food diet. Raw food will keep your dog’s energy level at an even keel.
It is not uncommon for dogs who are fed commercial dog food to become overweight.
This is not the case on a raw food diet. This diet is very high in protein, making it the most
weight-friendly option.
Still unsure? Come in to see us, we have a very wide range of raw foods for cats & dogs and can
help you decide what to start on depending on your pet.
Superpets - 01202 512100
404 Wimborne Rd, Bournemouth BH9 2HB
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
35
Please mention this magazine when responding to these adverts - Thank you
36
be gorgeous!
Slimwimth ing
World
MONDAY TUESDAY
Charminster Moordown
Bournemouth Moose Centre Bournemouth Life Centre
117-119 Malmesbury Park Rd 713 Wimborne Road
7.00pm 9.00am & 11.00am
Kate: 07486 871795 Nat: 07846 522793
Moordown Winton
Bournemouth Life Centre Winton Methodist
713 Wimborne Road Church Hall
7.00pm Alma Road
Nat: 07846 522793 5.30pm & 7.30pm
Beckie: 07799 534293
TUESDAY
Springbourne
Charminster
Springbourne
Bournemouth Moose Centre Christian Centre
117-119 Malmesbury Park Rd Curzon Road
9.30am 5.30pm & 7.30pm
Beckie: 07799 534293 Val: 07971 106169
Charminster Westbourne
Bournemouth School for Girls West Cliff Baptist Church
The Drama Block, East Way Poole Road
6.30pm 5.30pm & 7.30pm
Debbie: 07931 480464 Barbara: 07519 106333
slimmingworld.co.uk
0344 897 8000
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
37
be gorgeous!
Slimwimth ing
World
WEDNESDAY FRIDAY
Wallisdown Moordown
Wallisdown Liberal Club Bournemouth Life Centre
Kinson Road 713 Wimborne Road
7.30pm 9am, 11am & 1pm
Louise: 01202 874037 Sadie: 07545 379045
Westbourne Winton
West Cliff Baptist Church St Luke’s Church Hall
Poole Road St Luke’s Road
9.15am, 11.15am & 7.30pm 5.30pm & 7.30pm
Barbara: 07519 106333 Charlotte: 01202 510359
Charminster SATURDAY
St Francis Church Hall Winton
Charminster Road
9.00am & 11.00am St Luke’s Church Hall
Debbie: 07931 480464 St Luke’s Road
8.30am & 10.30am
Charminster Charlotte: 01202 510359
* New Group from 12th Sept Kinson
Bournemouth School for Girls
The Drama Block, East Way Kinson Community Centre
6.30pm Milhams Road
Debbie: 07931 480464 9.30am
Jenny: 07841 398337
THURSDAY
slimmingworld.co.uk
Redhill
0344 897 8000
St Thomas Church,
Western Avenue
5.30pm & 7.30pm
Louise: 01202 874037
Moordown
Bournemouth Life Centre
713 Wimborne Road
5.30 pm & 7.30pm
Sadie: 07545 379045
Please mention this magazine when responding to these adverts - Thank you
night
www.adamandevesfoodOto.wnmeate
38 ohreclaloll@0a7d9a4m84a9n4d0e2v4esfocHSareafaanesdo
Catering & events Raspberry & White
Cawtewrinwg.&adEavmenatsndevesfIonogTrdCea.dshwtiyeoenc&tboseslaa.ctseyocCmohues-ecsoeucsake Ingre
300Mg eDtrhieoddcous-cous
480Bmol ibl othiliengwwataetrerawndithaodnde sotrock cubes. Pour o
morae svpelgaesthaobfletshteocokilc-usbeepsarate with a f2or0k.0gLe
woawrdwcaa.mallda0an7md9Cwea4vn8aweds4tef9wevo4eor.0sdai2fn@o4doggfdaom.r&wmaaeilbaeq.csunvo.comedotemnetvsesfnH2GOHOt3Ioo0ni0oaanngm0ogoeeh0nnAS‘faIbgcaddltddrgdetluedodeteheffacrsoaDfuudmodl.ihavdnfurellnkwyridedlooigsciootls.ee,yknhttffowceosdi,nhh--fenofccfpclierhatbcioyetahpOooeosrhopkoaoptausjulpseeuavhipmeslvgs.dpriree-pdcseschp.ecoeoreeao’drOaoaf.ddoeulkSstilfifmlsuirvl,eeentenacehdprsch-.ghneahdoeedruhfvretalineeeaaastrerkdvbleb-lsoolstaeurhsgreolasinkoitnoetithwssceoooiratuwhiknrmc535mngagih.007enriefteog00oxotdlervgmietiksfcee
&maenvednetvsesfood.webs.comCatering & events S4e8a0smonlinbgoiling water with one or 250g
more vegetable stock cubes
Good slug of Olive Oil
TaInsgtyre&dwieeawnstyws c.oauds-acmouas ndevesfOHIonanogenrddleef.udmwlioeonefn-ctbcahspsoep.rcps eodmin chunks
Raspberry & White chocolateMAIaf‘BSabTMBaTfBMa‘IAcdlcdleudeooHOHG2tn3S4mOdudaaoeooesdoreesae00f8pidoidoftavpaadnnoiiglf273domPCMPaMssttaa0llfn0h0kylotteeehhnnktlyldra050ourttlstlamroso.hgyygeadtlytddieeooo.hhdh00guttsytltwhxttsdieetslh,hhnhffddaleevggfeDcsh,hhsit&&oeuutmsblliniihhberyenhlwyeunterreorywwlleoocuwoitrdgooohoCwideooagrgscftnooooeraeettuaf,eithuuaakhsnutuvhldfftusortmcvhloseaagtittafeorliw--gttiasnhnoeefccreaihcrtrfeehpeeccchssscgheha,eeiiotrberaabhceoprOyyerrapd’eerrwoama’epk.dihoclouawe.edopabgdorlsjaaelopSeeltalhcciopioSafscrnleieesevi.avl,nniedp-reltbvslooromceulpul-tdradsiestcaceh-tpddrtt.eaiehroocponnoiuueeoeho.ssginedtOdasoglaanefcecddreaudcsaaeessagedcklrekhdss,pdfui--fswreatpddafltcualihrtealeemncciadaaas.cteaaddaianatit&meedetooutsvlsribkleciv-hrbslesllhnabxsstPCccMluuhodaeotol(eotttlaeaotoetyuaeuheavrr,tooohssiutehahsguinsrceonsneiegrmeiccenobvrnekleasurtgrkwkkdluaxiskonwootib-kaoedritkslooictniwesroccinetiestiotcceurtnstntehuuhhyihwlhhcsschbewtesecbbonotveaooodoaoeooiratheeisaptrbivuatweslutchwissfohik.u&eiunfrk..aoeenrnsoonngPrtiaggPP)ratigt.reriengtefkO32OSHnHmtG2S4tOHnohrrenkoorm32Ot4HnIOSHGfootoeree0,008efiiu.n&tseooeoaaannnfggeuu0o0t.8-ioogmmaad0ootnaanng0c00omderorao0eeeghhnnnqvre0rrL0rrrlossvteehminnkLragggseaadceikttsdddeooolmsereriggettladeoo,diteddoeyihe,atttlunnhhnefffvaalrvtDccnaesontvvddoornhteffuuunaamlvsoDocsloiiiihhbote.ennuusdmounnnvrrrtleeeerieihb255lllennavsrcuwnriiieddgreoriddsllodggggssaccpierrkiioooemdgo705idoieokggags,,coeieooekkngacarld,sfffooeiecclccg00klnossditfheeeldlffnoimomo--c-nnafhosnnioontiooffcccovaemg--fnhpponvcoectfccadtoutfghhafiiootptbcdcaauuprebhe.oeppOghauiopreeea.bfbmhooolssppkkOhesrloYsswuwtm5opppkaal-sjjYesm5ltloppucwi--pdeeepaaalijyecplcasopacnoeeesseova-ooaccaipeosddmpp-r.aoeossrrivoamprfgdddp-rnigoosuessxsctrtuicnpopu..xeedsausheusootcuoootweeoe.eduuiotocoddsetedeoOliwbnaaffccsdortsludicnOcuarassfcirdrhgueskhcalkksssogi.cffswaaaskopeklsuuoilomaaieafswrrhhneeontltuhitrrcneentoteenirfnnuheonntccddetuuihon,tsstdnscdlto--guhrirssehhddlycb-hsehsddychooeeblbhprdo.oerurhhha.vvvrrloeeuhcvriinsmneeeeeieeei,nsbhneeeeerrerrksdd,errkbbe--dssab-oecewrssseorssmrsuregheriaeitipelrsnerssto&cly.oayofbpusuopi
ous a‘fbSclTeueosarafpoCMvfsnkyletahsa.yitswkilhhfle&iryitooynhofueouttmguhahhpresee’yrca.feohrStfciie,edelo-ecprgshu.seaeeescrpf-eacoacsatreorekoMaauoetatrnselnageoeawankaitsntittieot&h6ws paohipytwohufuootn~arrs.skuof.ocmrrLekhecrtaiaolhvslpekebefieoeenrprris5ectosemuhocisnnecsctootauopfs.kriedgneeaftor&apt ul
Add the other oil and all the other ingredients and mix lightly.
IdMeeatlhlyo,dleave all the flavours to soak in over night. You can
A alBaddodyilgotohtehesetwrosahlitecererpdarivneesdtgoaentdaedbdsaletyosaclnikkdectueclbolseuhsr.igmPe,ot“tuFerast,ohoverre,orIlchivoaeuvses-aacnpodruosobaltehnmed.rI have two
rsattoeckwcituhbaes“ff.TpeoPSbhmr‘fareiclaekoeuaotrassu.’lvfspotenfreoLkyilpsanob.ewaqitssvfarhhucireytverioorhroonetefsueucdm,f”otg.obhptuehru“herasT’tee5.-ohttfcSp,hmeeioerlceyr-iuphy.eisnsssaeaoetsyaernpe,tasnlxa‘oeyHtcdrekloiaa,nraitwomegoweeanw’rdhieni,iottptshwhwrooeatinwstothfhinsotaeua.rytktefho.oson.ruLeDkgetohhtaotiyvnofekogur.e”fwaoe“aprmWn5octhommtaouteishdnnacotsv.otte“uhoYsesooyumskaenyf?ou”wnt,?”h’”ehe
vlelotauhgreas oitnothwsetowtshiartataouehhiirkmdngesh,aghIAabSwii“dtnirneIdepofdteerooamo,mdtddavhranvpaeikalneotelesrynydhtacwnrti,hhyferaoytnleaigesoyeatvoseikrhnuoagpaetewdrsuovhhnmaleipnieetrdctsppe.adehreoaarrYemadlorceFdudlootlorift,ivlt,teautxiuh“soacnehrteslhn.haccgneigrbciaieedtssefoihentlbamsauaastlynuelevsbaloydrl.youeo.lBteJruvrhatrsoecpireonrlsorisnygkoobttobow.etyipthMloeessceulsomoyloarrabuyw.ptikeiInwranngrhtgogih.renar.oe.pvte.ttoteadsshervoticarsweleto,aunrnotoptstinhromtsoerinogavaaa.”lecslhnieevrhtdT.te.t.yh.aoisYmolnekmauoninirnnuxyeogpdxlhcitatpgoaiormdaurhntraoshetrytel.o”e,sy,tsr.ats“honTtedhhpbaarwratnoeiIksu’lehylgaoaphvnuuted,”t
bles like cophauerrrrgfoeetmsttwaeleesr,peoairrnrsooildtisvetetohsteahirnecdpargoieet,shth’esorhldoiunsger.oAssarhyebuesahdesreadndheprrainyi,nsgh.eImsapwrethssaetdh,isshtewwo amlkaeled
over and placed her parrots in with them. After a few minutes, the female parrots cried
itsosoiulewtninnce.u. nFiisnoanll:y“, Honi,ewme’arleeppraorsrtoittultoeosk. eDdooyvoeur want to have some fun?” There was stunned
e or on at the other male parrot and exclaimed, “Put
the beads away, Francis, our prayers have been answered!”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
39
Please mention this magazine when responding to these adverts - Thank you
40
Poole Mayor Attends Bacalao
Press release Celebration Lunch
For immediate distribution: 18 August 2018
Press release
For immediate distribution: 18 August 2018
The MayoPoroolefMPaoyoorlaet,teCndosuBnaccailalloocrelSeberaatnionGluanbcrhiel, along with other guPeosotlse Matatyeonr adtteednd,saBaGcarlaaoncdeleBbraatcioanlaluonchlunch at
the Hotel du Vin on Thursday (16 August) to celebrate the successful completion of the Rotary Club of Poole
Bay’s Heritage Lottery funded project - Pirates, Castaways & Codfish.
Bacalao is a Portuguese dish which uses salted cod, a trademark of the Poole fishermen as it fared better in the
dry climate of southern Europe. Guests were able to sample a version devised by the head chef at the Hotel du
Vin – which appropriately started life itself as one of Poole’s Georgian merchant venturers houses. They alsocillor Sean Gabriel, along with other guests
enjoyed Jane’s Story (from June Garland) and a visit from Governor Woodes Rogers (aka Colin Phillimore).attended, a Grand Bacalao lunch at the Hotel du Vin on Thursday (16 August) to celebrate the successful
completion of the Rotary Club of Poole Bay’s Heritage Lottery funded project - Pirates, Castaways &
Codfish.
cillor Sean Gabriel, along with other guests
attended, a Grand Bacalao lunch at the Hotel du Vin on Thursday (16 August) to celebrate the successful
completion of the Rotary Club of Poole Bay’s Heritage Lottery funded project - Pirates, Castaways &
Codfish.
Bacalao is a Portuguese dish which uses salted cod, a trademark of the Poole fishermen as it fared better
in the dry climate of southern Europe. Guests were able to sample a version devised by the head chef at
the Hotel du Vin – which appropriately started life itself as one of Poole’s Georgian merchant venturers
houses. They also enjoyed Jane’s Story (from June Garland) and a visit from Governor Woodes Rogers
Bacalao is a Portuguese dish which uses salted cod, a trademark of the Poole fishermen as it fared better
Over the last year, Poole Bay Rotary has been involved in taking another look at the maritime history of Poolein the dry climate of southern Europe. Guests were able to sample a version devised by the head chef at
between 1580 and 1730. Originally inspired by trying to identify whether three historical characters gave theirthe Hotel du Vin – which appropriately started life itself as one of Poole’s Georgian merchant venturers
houses. They also enjoyed Jane’s Story (from June Garland) and a visit from Governor Woodes Rogers
names to some of the old alleys leading to the Quay, the project has(aka Colin Phillimore).
(aka Colin Phillimore).
developed into something more broadly based.Over the last year, Poole Bay Rotary has been involved in taking another look at the maritime history of Over the last year, Poole Bay Rotary has been involved in taking another look at the maritime history of
Poole between 1580 and 1730. Originally inspired by trying to identify whether three historical Poole between 1580 and 1730. Originally inspired by trying to identify whether three historical
characters gave their names to some of the old alleys leading to the Quay, the project has developed into
characters gave their names to some of the old alleys leading to the Quay, the project has developed into something more broadly based.
something more broadly based.
The place of women in 17th century society, the growth of Poole fromThe place of women in 17th century society, the growth of Poole from its origins as a wool port, cod
The place of women in 17th century society, the growth of Poole from its origins as a wool port, cod
fishing, international trade, pirates, privateers and merchant venturers are all part of this fascinating
story. The 150 years from 1580 to 1730 is an important prelude to Poole’s Georgian hey-day, one which
is now neatly summarised in the new heritage book published by the Rotary Club.
its origins as a wool port, cod fishing, international trade, pirates,fishing, international trade, pirates, privateers and merchant venturers are all part of this fascinating
story. The 150 years from 1580 to 1730 is an important prelude to Poole’s Georgian hey-day, one which
privateers and merchant venturers are all part of this fascinating story.is now neatly summarised in the new heritage book published by the Rotary Club.
Don Nutt, project manager and a member of Poole Bay Rotary, said, “We have been thrilled not only by
the number and enthusiasm of our community researchers, but also by the interest already shown by
local people. We very much hope that our new book, the associated website and other interpretative
material which we will be handing over to Poole Museum will provide a suitable legacy, ensuring that
Poole’s heritage can be shared as widely as possible with young people, residents and visitors.”
Don Nutt, project manager and a member of Poole Bay Rotary, said, “We have been thrilled not only by
The 150 years from 1580 to 1730 is an important prelude to Poole’sthe number and enthusiasm of our community researchers, but also by the interest already shown by
local people. We very much hope that our new book, the associated website and other interpretative
Georgian hey-day, one which is now neatly summarised in the newmaterial which we will be handing over to Poole Museum will provide a suitable legacy, ensuring that
heritage book published by the Rotary Club.Poole’s heritage can be shared as widely as possible with young people, residents and visitors.” Stephen Boyce, Chair of Heritage Lottery Fund South West Committee, quoting from England in
Particular said, “Stories are the currency of ordinary history. Small details, such as the name of a street,
Stephen Boyce, Chair of Heritage Lottery Fund South West Committee, quoting from England in help us share the knowledge of what makes a place”. He went on to congratulate the Rotary Club for
Particular said, “Stories are the currency of ordinary history. Small details, such as the name of a street, adding to the 40 projects already supported by the Heritage Lottery Fund in Poole. He reminded the
help us share the knowledge of what makes a place”. He went on to congratulate the Rotary Club for
Don Nutt, project manager and a member of Poole Bay Rotary, said, “We have been thrilled not only by theadding to the 40 projects already supported by the Heritage Lottery Fund in Poole. He reminded the
audience that these are only made possible by the generosity of National Lottery players.
number and enthusiasm of ouraudience that these are only made possible by the generosity ocfoNamtionmal Luottneriytpylayerres.searchers, but also by the interest already shown by local people.
We very much hope that our new book, the associated website and other interpretative material which we will
be handing over to Poole Museum will provide a suitable legacy, ensuring that Poole’s heritage can be shared
as widely as possible with young people, residents and visitors.”
Stephen Boyce, Chair of Heritage Lottery Fund South West Committee, quoting from England in Particular
said, “Stories are the currency of ordinary history. Small details, such as the name of a street, help us share
the knowledge of what makes a place”. He went on to congratulate the Rotary Club for adding to the 40
projects already supported by the Heritage Lottery Fund in Poole. He reminded the audience that these are
only made possible by the generosity of National Lottery players.
The Mayor of Poole, was presented with a souvenir copy
of the new heritage booklet by Poole Bay Rotary Club
President, Dimpee Kalita-Smith. The Mayor, Cllr Sean
Gabriel, commented, “I will be adding this to the items on
display in the Mayor’s Parlour. It is an excellent guide to an
important period in Poole’s history and one that I would like
to see shared widely with local people.”
Copies of the book will be available, in due course, from
Poole Museum.
For more information please contact: Alun Williams
(Poole Bay Rotary)
[email protected] 07974 565019
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
41
Please mention this magazine when responding to these adverts - Thank you
42
There is no beating the taste of truly fresh
fruit and veg especially, when it’s yours!
September / October - Gardeners Tips
What to do in the garden or plot in September? The early summer heatwave followed by our more usual
mix of rain and shine has helped some but also hindered others, with many crops coming early.
There are some jobs in September that we must do regardless of conditions. The following thoughts are
for guidance only under normal conditions.
In the greenhouse:
The Tomatoes and Cucumbers are probably over so clear out the dying or dead plants and any other
detritus, giving it a good clean prior to new sowing and planting for overwintering plants.
Sow Winter Salads of Rocket, Lettuce and mixed leaves, they all should do well and keep you in green
leaves for many weeks. Sow hardy annuals for early flowering next year.
Take cuttings of your tender plants that may not survive the winter.
In the Vegetable Garden:
Cut to ground level the Asparagus fronds once they turn yellow and mulch with well rotted manure.
Plant Garlic and Winter Onion Sets for next year. If you have healthy
Strawberries you can create new plants from the suckers for next year. If you
have not done so, dig up your main crop Potatoes before the slugs attack. Look
out for tiny holes in the potato, which is the tell-tale sign that a slug has eaten
his way inside. If you cut the potato before cooking you will be able to remove
any offenders then.
In the Garden:
Empty any hanging baskets or pots. Cover your pond to help it remain free from leaf drop. The lawn
may have had a bad time so repairs to bare patches will be necessary. Many supermarkets sell kits at
very reasonable prices, we have used them to very good effect.
Looking ahead to October. I suspect there has been a lot of premature leaf fall
due to the dry summer.
If you can collect them, do so although they do take 2 – 3 years to rot down for
use as a mulch. (Leaf Mould my mother used to call it.) Whilst you’re doing this
you could start a new compost heap. Wooden pallets make for a great compost
bin and most builders’ merchants are happy to give them away. I get mine from
Travis Perkins on Wallisdown Road.
Any way there is loads to do to get both the garden or plot ready for winter and start a few things off for
next year.
• This month may be the last time you cut the lawn this year. So set the blades one step higher than for
summer cutting. This will protect the grass from potential frost damage.
• Clear & clean up as much as you can but not all at the same time. Greenhouses, ponds, water butts,
gutters and where you have been throwing things behind the shed. If you have wooden garden furniture
but no inside storage you will need to provide some winter cover.
• If you have not cleaned your flower pots then do that now too. The terra cotta ones that are not frost
proof will need to be brought indoors.
• If you like winter colour and perfume in your home, now is a good time to plant some Hyacinth bulbs.
Do ensure you only buy ‘Prepared Bulbs’ plant them early in the month and you should have a great
show around Christmas.
• At North Bournemouth Allotments we have an annual biggest Pumpkin Competition. So if you have
been growing them, now is the time to harvest in time for Halloween along with any other squashes you
have been growing
North Bournemouth Allotment Society, Cornelia Road, BH10 4FG
www.northbournemouthallotmentsociety.co.uk
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
Animal Farm 43
123 456 Prize Crossword
7
89
10
11 12
13
14 15
16 17
18 19 20
21 22
23 24
25
26 27
28 29 Enter This Month To Win
(©c)CChheetttt--AJuugluys2t 0201118 2 Free Tickets to Coastal Comedy
For Friday 28th September
Across primate has a little oDneowafnter Down
1. African 1. Water carrier shows respect before her
ex-President (8) majesty (6)
ate has a 5lit.tKleeeopnoenatoftneorcturnal friend o1f .MWr Taotaedr (c6a)rrie2r. Wshiothwasrmressapnedctlebgesfoouretshtreertcmheadjessctaytter
) 8. Unusually keen ox stole the i(n6s)ects
golden flyer (11)
octurnal frpierontdecotfioMnr(1T1o)ad (6) 2. With arms a3n.dTalekgesa oduirtescttrerotcuhteedtostchaettqeureugeolodfehnoney
en ox stol1e0.thSewimnsmeecrtstapkreosteinctaiocnuppa,fblyuet rw(i1th1o)ut makers (7)
permission (5) 3. Take a direc4t. rAogureteemtoentthfeouqnudeuinegoafrlhicoknyeeyscargot (3)
akes in a c1u1p. pTaw,obauntimwaitlshoguett together wmitahkaerresd(7) 5. He is in charge of a hive of industry (7)
s get toges11ptta43hinn..edgCRraeoewrmp(sti7mti()lhe3u,nap4ir)srotebdSletampnaininsdGbaaarddlyenbio546ttf...eEnAMHdgeebisnryeiesl(rei7atimtn)blelecenhstae7c69rfotrg...teueCIMiantnai’togssldulfernrurieainoapgt(bhhhga5lietin)avndriesgnleifcototwotkflilyniopitngwhleadrysftuiachgdsalheetlortralgyewidnom(ftcw7our(rr)ie3tt(ha)h8tfi)usarlleow
Stan is ba1d6.lyIsblaitntdendibscyovliettrleed in the Tob(5ag) o area (3) marsupial (7)
17. Lee comes back with slippe7ry. cCaatlclhu(p3)and 1fo2.lloThwestehetralecmksulrea(d8)to an early butterfly
blem in Ga1r8d.eLnoookfeEddaeftner(7th)e horse gett9in.gImt'sarnroietdhing(t1o1)play dead for this marsupial (7)
overed in thoeneTwobspaagpoeracrehaief(3(7)) 12. These trac1k5s. lReealdattivoeasnofecaormlymbuuntitsetraflrye (a1ct1u)ally
back with2s1li.pPpoeinryt tcoafitcshhy(b3r)eakfast for 1th5e. sReealatives onfactiovme nmourtnhisAtmaerreicaacntsu(a7ll)y native
er the horsceapgteatintin(7g)married to north American16s.(S7ir) makes silly mistakes taking on those
ehfy(b7r)eakfa2lg2saa35twl..lfneUSorlnr(iyd5dt(e)eh7rse)choseveeeatroacnagepdnitsatpsinlamyaaktetaop1s1mo69Lem..osnsSEedxioronpfnemethcnakeske(es8s)f2e1wsog09iirltg..lhyhsEAexsstmohpnImaeisstnnehtesaaeaenknmtseeycpfsckoorortot(nhah8dfeke)uurinscn(eegt7dhs),oamstnhpootrrhwoeodmsueecgeegwtsshimethore
on display26a.tSteolfpcLoonntrdool nsagidatlloerbye in favtohuarnoaf ny otherfo(r7e)ign kitty (7)
grizzly social workers (11) 20. As I seem 2c2o.nCfruosaekde,dsahfotewr smnaektehbeitfeorineiRgunsskiiatnty
agents m2a8k.eLaazymcersesatoufretshefoulanwdnin the(b7r)oken surroundings (6)
homes of southern otters (6) 22. Croaked af2t4e.rAsfntearkteeabibtieteinchReuwsesdiatnhe home of beast
said to be29in. Mfaadveouorneoflogvreizczolsytly animasluinrrsoturanndginegs (&6)priest (5)
need (8) 24. After tea b2it7e. Mchimewiceodurthaenchieonmt aenocfesbteoar s(t3)&
(11)
res found in the broken homes of priest (5)
(6) animaPlleinassetrmaenngteionnetehdis mag2a7z.inMeiwmhicenourersapnoncideinntg atonctheesstoerad(3v)erts - Thank you
ove costly
44
PRIZE CROSSWORD ENTRY FORM
Send your completed entries to:
September Prize Crossword, The Local Eye,
22 Oswald Road, Moordown, Bournemouth. BH9 2TQ
Name: ________________________________ Tel:____________________
Address:______________________________________________________
Address:______________________________________________________
Closing date for entries is Tuesday 18th September
Congratulations to Eileen Bendall of Withermoor Road
who won a fantastic box of fruit and veg courtesy of
North Bournemouth Allotment Society (P26)
Solution >JuCrliyminSaloInlutenttion Brain Power
1 5C 6D 1: Mother Child Age 2: Jerome is married to Lauren and
Molly Charlie 3 they had a new kitchen. Terry is
V 2P 3C 4P Jackie Neil 4 married to Suzy and they had a new
7F A L S E H O O D 8D U P E D Debbie Jack 2 shower room. Martin is married to
L Y A S 9S T S Alice Carol 1 Penny and they had a new
1O0 U T C A S T S 1C1 O P P E R conservatory. Phil is married to
Melanie and they had new windows.
EHT EAUC
1Y2 O G I 1S3 O M B R E R O
14F S S S A
1B5 O B 1B6 I E S 1M7 1A8 J E S T Y
1C9 R
RU E
2R0 E P R O 2A1 C H 2R2 I 2C3 H
W G I A E O 2G4 3: 26th and Friday
2R5 O L L E D 2R6 U S T L E R S 4: 60 Seconds in a Minute, 7 Dwarves in Snow White
26 Letters in the Alphabet, 30 Days in November
MASGT L E
27L A I R S 2R8 E N E G A D E S
NS DDRD 5: No answer, just the image of a spinning cat 4 inches off the ground!
SoluAtionu>gTuimset &SToidleution 6: Every cloud has a silver lining.
1S E 2A W 3A T E 4R 5T E 6A S E 7D
ULN UES R
R A 8T I 9M E M A C H I N E
10F A R S I A Picture Box Answers
TE S
E M Q R 11F I E S 1T2 A S 1. The three degrees
1R3 E C O U N T M H A 2. Neon sign
L E 14I N 1T5 E N S E G 3. Fruit pie
1A6 D O 1O7 N E 4. Dirty look
NW 5. Wrong end of the
N 1C8 O M 1B9 I N E 20I
R stick
R 21L I N G E R 2S2 6. Diamond in the
AK
23L O S 2E4 S I T F T T A rough
O N E T 2E5 X I T S
2G6 R A N D F A 2T7 H E R C H
U ULO I AE
2E8 X P I R Y 2T9 R E M B L E S
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
45
GNEOORFCFOTT
AS SEEN ON: LIVE AT THE APOLLO BBC2
THE MASH REPORT BBC2 Top Support from:
8 OUT OF 10 CATS C4 AND MANY MORE
“FAnRabIsDoluAte tYoni2c” 8ThetThelegraph
SEPT 2018
BOX OFFICE
01202 316316
Advance tickets £15
Michael EdTwanairads
Doors open 7.15pm Frankland
‘BEST NIGHT OUT’
£20 on the door. Show starts 8.30pm
Hotel Celebrity, 47 Gervis Road
Bournemouth
SBpHo1n3DsDored by
Adrienne Coles
www.coastalcomedy.com Also online at:
Over 18’s only Acts may change due to TV commitments
Please mention this magazine when responding to these adverts - Thank you
46
Pupils put new SafeWise tours to the test
mouth Local charity SafeWise has joined forces with St Mary’s Primary School
in Wareham and Damory coaches to help develop new Junior Citizen tours
which are set to be rolled out to thousands of pupils from September.
St Mary’s is the last of five Dorset schools to trial and feedback on the new tours, which focus on
equipping children aged five to 11 with skills for life, at SafeWise centres in Bournemouth and Weymouth.
Year two pupils spent four hours at SafeWise Bournemouth’s indoor safety village testing out a range of
interactive scenarios based around fire, road and water safety plus healthy choices, online safety, journey
planning, first aid and more.
SafeWise Bournemouth Manager Elise St.Hill said: “I’d like to thank all the schools which have visited
to test out our new Junior Citizen programme, they have provided invaluable feedback which we will use
to fine tune the tours. “The Junior Citizen schools programme aims to provide realistic and immersive
learning experiences to equip children with the skills, knowledge and confidence to live active, fulfilling
and safer lives in the real world.
ng form and “It is essential that we deliver engaging, value for money tours
d Approved pDarwoiyvtmihhnieegcnrhItnshsmctahrevuoeecottblotsehresiesn(nAcreeDriecItsedi)cis.vaeoldlfysicmhopoolrsta, nsot.”the
visit of St Mary’s and the
St Mary’s pupils were transported from Wareham to SafeWise
e)t-odrrlievearv-egoaldm/Bse)psooserauccgrionaenleatmratacSotteaustfthehfWeobDriysDsecDGhhaeomaodlosryto,
who are backing the new tours by offering
cut the cost of coach hire.
Damory General Manager Adam Keen said: “Damory is extremely
pleased to continue providing competitive travel to the Safewise
collisions happceenntarneds hinowBotouarnvoeimd othuethm,and Weymouth for local school children.
This FREE sche“mTehise owpoenrktothaalltytohuensgtaff deliver at these centres is invaluable and the
ithin the past rfooaudr yseaafrest.y aspect is particularly pertinent to us, given that we are a significant user of Dorset’s roads.”
ifeDrive datesCarlea:ss Teacher Mr Leyman-Hobbs said: “The children have enjoyed a superb day at SafeWise.
“The new tour represents a really good step forward, such as the clever voting system, real car which the
children can get into as well as other situations where they recognise danger and deal with it. “It’s a nice,
secure environment for the children to learn in and all the helpers are really down to earth, so the pupils
feel confident asking questions and are not afraid to have a go and try different things around the centre.”
For more information about SafeWise school tours go to www.safewise.org/discover
une 2017 ScootWise, Mobility Scooter Training at SafeWise Bournemouth –
eliver safety awSaarfeenWessisceouarrseeswforrkmionbgilitny partnership with the Dorset Clinical Commissioning Group to deliver safety
oter or those tahwataarreenleososkicnogutorsbeusyfaor mobility scooter users in Dorset. The sessions are designed for those already
e to limited plaucesisnagvaailambloeb. Tilhietynsecxtooter or those that are looking to buy a mobility scooter.
The sessions cost £10 per person. All sessions must be pre-booked due to limited places available.
For more information, including booking instructions please look at our ScootWise page:
safewise.org/education/scootwise
e (safewise.org/education/scootwise/)
Two women that are dog owners are arguing about which dog is smarter....
ur child could leaFrnirasbtouWt boamsicabnike: “My dog is so smart, every morning he waits for the paper boy to come
safety centre and THEN put the skailrlsotuhenyd’veand then he takes the newspaper and brings it to me.
t’s more, all of tShiescfoornFRdEWE! oman : “I know...” First Woman : “How?” Second Woman : “My dog told me.”
e (safewise.org/education/bikeability/) ....................
will be dependentTown aogeh/aubnilittey rasndare walking through a forest looking for deer. When all of a sudden, a
giant bear jumps out and scares the hell out of them. They drop their guns and run
like hell. One of the hunters stopped, opened up his backpack and laced up a pair of
Nike trainers. His buddy looked at him and said,
“What are you doing? Are you crazy? You can’t outrun the bear!”
MToayt2h0i1s7the hunter said, “I know, but all I have to do is outrun you!”
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com
47
/year*
Please mention this magazine when responding to these adverts - Thank you
48
WE HAVE
MOVED
Problems with
your PC or laptop?
Let us make I•T•
Local, knowledgeable and affordable. All backed up with fantastic service!
Come and see us at our new shop between Iceland & Motobitz.
EZ Computers has moved but don’t nus 10% DISCOUNT ON LABOUR
worry we have moved just up the road
between Iceland and Motobitz. Pop in FOR NUS MEMBERSnationalunionofstudents
and see the new shop with internet
cafe and gaming centre. OPENING TIMES
EZ Computers Repair Centre have been Monday - Friday 9:00am - 7:00pm
operating in the Winton area since the early Saturday 9:30am - 5:00pm
1990’s. Initially started as a retail store,
EZ Computers swiftly branched out into Sunday & Public Holidays CLOSED
offering repair services to the local
community on a NO FIX NO FEE basis. EZ Computer Repair Centre
The current EZ team has over 50 years of 469 Wimborne Road • Winton • Bournemouth • BH9 2AN
combined experience in technical support,
repairs and servicing, and PC sales. EZ Tel: 01202 267267 & 01202 268268
Computers also offers online gaming, internet Email: [email protected]
access and printing facilities. Whatever
your computer needs, our friendly and www.facebook.com/EzComputersRepairCentre/
knowledgeable staff will find the right solution
for both your situation and your budget.
To advertise <> 08000 430485 <> email: [email protected] <> www.thelocaleye.com