The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.

SLVoice_ISSUE32_081117_OPT

Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by Vero Beach 32963 Media, 2017-08-10 00:36:02

08/11/2017 ISSUE 32

SLVoice_ISSUE32_081117_OPT

Beating blood cancer?

A12 B1 B2Raves for CAR T-cell therapy
Riverside: Good, fellas ‘Christmas’ in summer

Upcoming season caters to men Peter White returns to the Lyric

VOLUME 2, ISSUE 32 YOUR INDEPENDENT LOCAL COMMUNITY NEWSPAPER FRIDAY, AUGUST 11, 2017

Services Dist. has no ‘LOOK AT WHAT HE’S DONE. FOUR PEOPLE ARE LIVING Feds: Massive
reserve-fund policy; THEIR LIVES BECAUSE OF THE GIFT HE GAVE THEM.’ fraud scheme
it just has the funds made way here

BY PATRICK McCALLISTER | Correspondent CONTINUED ON PAGE A3 BY BETH WALTON | Staff Writer

The St. Lucie West Services Dis- Heart-donor recipient Adelia Harris lets Eleanor Kohen listen to the heart that used to be In the early-morning hours
trict has plenty of extra cash to in grandson Joshua Schwabenbauer’s body before he died in a boating accident in 2012. one Saturday in June, detectives
stay open in a crunch, such as a Schwabenbauer, inset, was an ardent advocate of organ donation. PHOTO: MITCH KLOORFAIN watched as Erick Alberto Gonza-
devastating hurricane. But that’s lez Rosario left a Vero Beach con-
because of self-discipline. There’s JOSH’S LEGACY venience and check-cashing store
no rule saying it must. on U.S. 1 carrying a Corona box. It
BY SHELLEY KOPPEL | Staff Writer means helping others. That’s 24-year-old South Carolina wasn’t beer they were after.
At its last regular meeting, the [email protected] how I came to know Sharon woman who received Josh’s
Board of Supervisors approved Schwabenbauer of Lauderhill, heart. She traveled to St. Lucie When they pulled over Rosa-
holding a public hearing to make No parent should bury a Florida. Her son, Josh, a fire- County and the group met at rio’s car a few minutes later, po-
itself get a proverbial piggy bank. child. It is not in the normal fighter and paramedic, died the St. Lucie County Tax Col- lice discovered the Corona box
order of things. Whether it’s in a boating accident on Sept. lector’s Office, which raised was stuffed with $143,000 in cash
“What we’re trying to do is from a lengthy illness or a sud- 7, 2012. An ardent advocate more than $13,000 in April in – just-laundered money they say
mainly to set up a policy not just den accident or overdose, the of organ donation, Josh’s liver, was partial proceeds from a mul-
for the current (Board of Super- death of a child is a life-chang- kidneys and heart changed the CONTINUED ON PAGE A10 timillion-dollar workers’ comp
visors), but future boards to have ing event that reverberates lives of four people. and insurance fraud scheme.
a minimum fund balance,” said throughout the family forever.
Dennis Pickle, manager and util- On July 15, the Schwaben- Rosario, 33, of Pt. Saint Lucie
ities director. For some families, mak- bauers met Adelia Harris, the was arrested and is now in the
ing any sense of the loss Indian River County jail with
The district is a Community his bond set at $300,000. He is
charged with multiple counts
CONTINUED ON PAGE A10 of fraud and money laundering.

DANCE FEVER! CONTINUED ON PAGE A6

Kayla Hill, 7, dances with other Boys & Girls Solar events turn
Clubs members unit during halftime of the all eyes on skies
clubs’ title basketball game at Treasure Coast
High School last Friday. PHOTO: MITCH KLOORFAIN BY PATRICK McCALLISTER | Correspondent

Look up: The universe is put-
ting on two great shows.

The first, this weekend, is a me-
teor shower (more on that later).

But the main attraction comes
Monday, Aug. 21, when the Trea-
sure Coast will get an 85 percent
solar eclipse. It’ll start at about
1:30 p.m., peak just before 3 p.m.
and continue to 4:18 p.m.

“It’s not going to get dark,” said
Jon Bell, director of the Hallstrom

CONTINUED ON PAGE A3

IN THIS ISSUE Bonz says cheerful
Rocky is one happy
LOCAL NEWS A1-A11 camper. Page B7

OBITUARIES A9 ARTS/PEOPLE B1-B8

HEALTH A12-A15 DINING B9-B10

GOLF B15 REAL ESTATE A17-A28

© 2016 Vero Beach 32963 Media LLC. All rights reserved.

Family Owned and Operated STARKEY,
the only
Mutter’s Hearing American
Center, Inc. Owned and
Operated
Hearing Aid
Manufacturer

Providing superior products, service and care with
honest and competitive pricing since 2003

Bailee Mutter, Joe Mutter, Tammy Shearer-
Carpenter

Hearing Loss is a Major Public Health Issue

Did you know hearing loss strangles your brain and

prevents you from UNDERSTANDING what you hear?

Answer this questionnaire for yourself or a loved one.

Yes No Yes No
£ £ 1. You can hear, but you can’t understand. £ £ 5. Prefer the TV or radio louder than others do.

Among the first sounds which “disappear” are £ £ 6. Have difficulty understanding conversations
within a group of people.
those which are most high-pitched.
£ £ 7. Avoid group meetings, social occasions, public
These include: facilities, or family gatherings where listening
- Women’s and children’s voices may be difficult.
- Bird songs
- Confusion among sounds of words such as: £ £ 8. Have trouble hearing at the movies, house
of worship, concert halls, or at other public
“dime,” “time,” “bake,” “take” gathering – especially where sound sources
are at a distance from the listener.
£ £ 2. Have difficulty in understanding what is being
said, unless you are directly facing the speaker. £ £ 9. Have ringing in the ears or other head noises
(hissing, buzzing, crickets, etc.) Tinnitus often
£ £ 3. Find yourself complaining that people are accompanies hearing loss, but not always,
mumbling or slurring their words. and as such, may be the ear’s way of saying,
“Ouch!”
£ £ 4. Are continually asking people to repeat words
or phrases, though they feel they’re speaking
loud enough.

If you answered “yes” to at least two of these questions, you may have hearing loss and need to have your hearing tested. Call Mutter’s Hearing Center today!

Look for our reviews on Facebook, Google and our website!
www.muttershearingcenter.com • www.facebook.com/muttershearing

YOU SHOULD EXPERIENCE THE MUTTER DIFFERENCE

Call For Your Free Clinical Hearing And Speech O%
Understanding Evaluation Test Today!
FINANCING AVAILABLE
RISK FREE TRIAL 772-871-1222
Subject to credit approval

2014 2015 1420 SW St. Lucie West Blvd., #101 • Port St. Lucie 2016

Serving the Treasure Coast Since 2003 Voted #1 Hearing Center
www.facebook.com/muttershearing

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS August 11, 2017 3

‘One of the things the eclipse can do is help change anyone’s perspective of their place in the universe.’

SOLAR EVENTS leaving Florida, wait to 2045.”

CONTINUED FROM PAGE A1 This is expected to be the best documented

Planetarium at Indian River State College. “It’s eclipse ever. A notable science experiment that’ll
going to be just as bright as any other day.”
happen during the event is EclipseMob. That
Well, just as bright as, say, a somewhat cloudy
day. But, the eclipse is still worth a good look, crowdsourcing experiment by the National Sci-
Bell said. Preferably a good, safe look. “It’s always
dangerous to stare right at the sun,” Bell said. ence Foundation will watch how the ionosphere
“Your body is smart. Your body tells you to stop
looking. You squint, you close your eyes. Your affects radio waves during the eclipse.
body is telling you to stop looking.”
Bell said while eclipses have long been great for
The college will open its planetarium to the
public for eclipse watching that day. Bell will also science, they’re also a good time for philosophy.
tie into a planetarium that’s in the path of total
eclipse to project images onto the dome. At full “One of the things the eclipse can do is help
eclipse, the Treasure Coast will have a crescent
sun for a few minutes. Bell said those not at the change anyone’s perspective of their place in the
planetarium can get an interesting show by going under
trees to see crescent sunbeams. universe,” he said.

“The leaves will act like pinhole cameras,” Bell said. To get ready for the eclipse, folks can spend
The path of the total eclipse through the United States
will start on the South Carolina coast and move northward some time with the Perseid meteor shower. It’ll
through Tennessee, upward to Nebraska and Wyoming,
and finally exit from the northern part of Oregon. The Treasure Coast will get a partial solar be around until Saturday. Bell said the moon will
Bell has seen two total eclipses. One was in Finland. The eclipse on Aug. 21. The moon will cover obscure the shower around midnight on Friday
other in Mexico. and Saturday. But, the early night will be a good
“Nature, it hits the pause button,” Bell said. “It’s not pitch about 85 percent of the sun just before 3 p.m.
black, but it’s like dusk.”
He had a tip for anyone now deciding they just have to PHOTO COURTESY OF THE HALLSTROM PLANETARIUM
drive to South Carolina to see a total eclipse. “The hotel
rates are skyrocketing,” Bell said. “They’re, excuse this, out time for a meteor party.

“The eastern sky is where you want to face for

of this world.” Probably better to enjoy the show at the IRSC most meteor showers,” Bell said.

planetarium. The darker the eastern sky, the better.

An eclipse is caused by the alignment of the Earth, moon “Don’t expect it to be like a fireworks display,” Bell said.

and sun. The moon crosses in front of the sun, casting a “You can go 10, 15 minutes and see nothing.”

cone-shaped shadow on Earth. A wonderful cosmic coin- But, then see a dozen “shooting stars” in a minute. Bell

cidence makes it so the moon, which is about 240,000 miles said in between seeing meteors streak the sky, it’s fun to

from Earth, appears to be almost the same size as the sun, stargaze. “Look for patterns,” he said. “If you know the con-

which is about 93 million miles away. stellations, look for them, or make up your own. Make it a

While eclipses are fairly common, the planet’s a pret- family starwatching party.”

ty big place, so people usually have to travel far to see

them. The last time a total eclipse traveled across the The eclipse will be streamed live at www.eclipse2017.nasa.

continental U.S. was in 1979. Bell said eclipse aficiona- gov. The IRSC planetarium is at 3209 Virginia Ave., Fort

dos in Port St. Lucie will get a shot at watching a total Pierce, on the eastern end of the campus. No reservations are

one from their backyards, but … “If you don’t feel like needed to attend the eclipse watch. 

WE HAVE JUST THE RIGHT HOME FOR YOU! Don & Lisa
Baetzold

TWO GREAT OTHER HOMES Lisa Don
OPEN HOUSES! AVAILABLE
(772) 618.0026 (772) 919.2100
…CALL TO VIEW
[email protected]

SUNDAY • Aug 13th, 1pm-4pm VPILGLAAGE GAATRLEINA VPILGLAAGE

BRING AD TO GATE FOR ACCESS

9425 BRIARCLIFF TRACE - PGA VILLAGE

NEW

FABULOUS HOME WAITING FOR YOU! PRESTIGIOUS PGA LOCATION SOLAR HEATED POOL ENJOY THE FLORIDA LIFE

3/BR + Office Kingsley Model Gourmet Granite Island Kitchen, Glass Tile Back Splash, 9616 Crooked Stick 34986 2401 Lamb Ave 34953 9420 Briarcliff 3/BR + Office spacious floor
Newer SS Appliances, All Upgrades! PGA Golf Course & Water Views Classey family home 4/BR + Office 3 1/2 Baths, Open / Spacious Floor Plan 4 Brm, Granite plan, granite kitchen SS appliances, wall ovens,
RX-10355887 $419,900 & Stainless Kitchen,Private Fenced Yard, quality upgrades, rock formation pool/spa with
1st FloorMaster Bed, Chic Gas Kitchen waterfalls and golf views. Call today for viewing
8125 CARNOUSTIE PLACE/CASTLE PINES - PGA VILLAGE Roll Shutters & Generator. Screen Patio Bring Offer RX-10331665
RX-10295378 $544,900 REDUCED $269,900 RX-10212747 $539,000
NEW
VPILGLAAGE VPILGLAAGE VPILGLAAGE

FURNISHED/TURNKEY RENTAL FURNISHED/TURNKEY RENTAL

TURNKEY TOWN HOUSE ANNUAL RENTAL CHIC DECOR & LAKE VIEW Spacious 3/BR 2 BA OUR BUYERS
Beautifully decorated, RECEIVE A PGA
3/BR 2.5/BA 2 Car garage. Fabulously furnished & decorated, Open balcony on 2nd floor, 2/BR + DEN Popular Fairview model 2/br + Den, professionally decorated, large large master suite, GOLF CLUB SOCIAL
first floor screened patio can be used as seasonal rental Call for details. spacious open floor plan, master suite with incredible oversized closets screened patio you MEMBERSHIP
RX-10355249 ONLY $189,900 large walk in closets. can rent seasonally for
screened patio with lake views $3,000 call for details. *Call for details
Owner ok with two pets. Call for details Call for all the details
RX-10350084 $1,900 RX-10348271 $2,000
RX-10315358 $2,050

ARE YOU THINKING ABOUT MOVING? NO ONE WORKS HARDER TO GET YOUR HOME SOLD!

references available Call today to see what your home is worth!
upon request

4 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS www.stlucievoice.com

BEING TRUE
TO ST. LUCIE
SCHOOLS!

A pep rally for St. Lucie County schools
brought out top officials to the old ball
game last Friday at the St. Lucie Mets
game at first data field. Showing sup-
port, and thanking the students and
school staff in attendance for improved
grades and test scores countywide
were, from left: St. Lucie County
Administrator Howard Tipton; SLC
Commissioner Linda Bartz; SLC Deputy
Sheriff Garry Wilson; SLC Property Ap-
praiser Michelle Franklin; Port St. Lucie
Police Chief John Bolduc; Fort Pierce
Mayor Linda Hudson; Port St. Lucie
Mayor Gregory Oravec; SLC Economic
Development Council President Pete
Tesch; and St. Lucie County Chamber of
Commerce President Terissa Aronson.

PHOTO: MITCH KLOORFAIN

Property owners urged to carefully scan TRIM appraisal notices

BY PATRICK McCALLISTER | Correspondent tions to another property should they relo- Permanently Disabled Florida First Re- Property Appraiser Michelle Franklin will send residents
cate. sponders Exemption. That exemption nixes their annual Truth-in-Millage (TRIM) notices next week.
Michelle Franklin, the county’s Proper- property taxes for those who had catastroph-
ty Appraiser, is sending out mail next week. Earlier this summer taxing authorities, ic injuries while working for Florida fire, PHOTO COURTESY OF ST. LUCIE COUNTY PROPERTY APPRAISER’S OFFICE
They’re not bills or junk mail – the letters ex- such as the county, adopted proposed mill- police and corrections departments. Addi-
plain to property owners’ what their proper- age rates for the next fiscal year. A millage tionally, quadriplegics and some honorably tions for the blind, widows and widowers,
ty taxes and assessments can be if local tax- rate is the amount of ad valorem tax for every discharged veterans with total and perma- active-duty military and others.
ing bodies approve proposed rates. $1,000 of a property’s assessed taxable value. nent service-connected disabilities can get
The rates have to be adopted in two public their property taxes eliminated. Franklin said property owners are wel-
“They’ll mail on Friday the 18th,” Franklin hearings before the start of the fiscal year, come to call her office at 772-462-1021 to ask
said. “They should hit the post office mail- October. Local taxing bodies can adopt low- However, complete exemption from prop- about exemptions. Property tax bills go out in
boxes on the 18th, and homes on the 19th.” er millage rates, but not raise them, from the erty taxes doesn’t include special assess- November. 
adopted proposed rates. ments, such as storm water. Even if someone
The letters are the state-mandated Truth- isn’t obligated to pay property tax, he or she
in-Millage (or TRIM) notices. Franklin said “We have about 22 taxing authorities in St. must still pay any special assessments on his
the notices tell property owners what the Lucie County,” Franklin said. or her tax bill.
appraiser’s office figures their homes are
worth and what their taxable values are after Not everyone pays to all 22. Residents’ The homestead exemption, of course, is
standing exemptions are calculated. “When TRIM notices will let them know which gov- the best known. To qualify, one must, as of
you see (the TRIM notice), please open the ernmental bodies can tax them and when Jan. 1 this year, be a U.S. citizen or legal per-
envelope and see if you agree with the val- the public hearings setting their tax rates manent resident and a permanent resident
ue,” Franklin said. “You have 25 days from will be. “When you flip the TRIM notice over, of Florida. Additionally, he or she must have
the date of the mailing to file an appeal.” that’s when you see all the information about made the property his or her residence.
your taxing authorities,” Franklin said.
Those who think their properties are ap- Those 65 and older can get an addition-
praised too highly will not want to pay prop- TRIM notices are a good reminder that al $25,000 homestead exemption if the ad-
erty taxes on value they disagree with. Those many qualify for various property-tax ex- justed household income is $28,841 or less.
who think their properties are appraised too emptions. That figure changes with the consumer price
low will want to consider portability – the index annually. There are additional exemp-
ability to take the Save Our Homes protec- For example, during last year’s general
election, voters approved the Totally and



6 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS www.stlucievoice.com

FRAUD SCHEME make it appear their employees are working for the RISE
shell company and so are insured. AND
CONTINUED FROM PAGE A1 SHINE
These subcontractors, who are actually paving – AND
An associate, Maynor Hernandez, 29, of Pompano a road or building a shopping center, funnel mil- DASH!
Beach was arrested later and faces similar charges, lions of dollars in checks for the employees they
in addition to allegations of racketeering. are “renting” to the shell company, which turns the Ava Dodd and other participants in the 4th Annual Lincoln Park Academy Greyhound Dash
checks into cash, pays the workers, and provides got an early view of sunrise as they raced over the south bridge in Fort Pierce last Saturday.
Both men have pleaded “not guilty” and request- the contractors with “proof” of liability insurance The event raised funds in support of LPA’s cross country and track teams. PHOTO: MITCH KLOORFAIN
ed a jury trial. They face maximum penalties of 30 and workers’ comp to show when they are bidding
years if convicted. The men will be tried at the In- a project.
dian River County Courthouse but no trial date has
been set. Because these subcontractors are not paying
workers’ comp and liability insurance, they are able
Authorities believe the men’s activities are evi- to win jobs by submitting much lower bids than le-
dence that a popular South Florida fraud and mon- gitimate subcontractors.
ey laundering racket has now made its way to the
Treasure Coast – a scheme that exposes the dark un- Similar schemes have successfully been identi-
derbelly of the construction industry. fied and dismantled in Miami-Dade, Broward, Palm
Beach, Lee and Orange counties, Wolfkill tells the
Detectives allege the $143,000 they found in the court.
Corona box was obtained illegally through a shell
business established to defraud workers’ compen- The investigation in Indian River County was
sation insurance providers and conceal illicit funds. triggered in March when detectives checked on the
amount of money flowing through Vero check cash-
In an affidavit to the court, Robert Wolfkill, a de- ing stores by querying a state database.
tective with the Florida Department of Financial
Services, explains the scheme. Money service businesses, such as check cashing
stores, are often used to transfer funds from sub-
A shell company – a registered business that has contractors to shell companies to avoid detection,
no significant assets or operations – is established and these businesses are required to report their
for the sole purpose of acquiring minimal workers’ transactions to the state.
compensation and employer’s liability insurance,
he writes. Wolfkill was probing the work of a Broward
County contractor known to rent labor from shell
Typically, the fraudulent policy will cover a small companies in order to launder money and commit
number of laborers doing low-risk work, even workers’ compensation fraud, the affidavit states.
though the shell company may have no employees He worked alongside a detective with the Broward
actually performing construction work. County Sheriff’s Office Strategic Investigations
Money Laundering Task Force.
Because a certificate of workers’ compensation
coverage in Florida does not include the names of The contractor is not named in court documents,
workers insured, unscrupulous sub-contractors
CONTINUED ON PAGE A8

DEPENDABLE MITSUBISHI

MITSUBISHI’S 100TH ANNIVERSARY

FIND YOUR OWN LANE

2017 MITSUBISHI MIRAGE G4 ES 2017 MITSUBISHI OUTLANDER SPORT ES

BRAND #7110 MSRP $16,240 BRAND NEW #7118 MSRP $22,090
NEW
SALE PRICE SALE PRICE

$11,990* $17,870*
Power Windows, Power Door Locks Equipped with: A/C, Automatic Transmission,
Automatic, AC, USB Port, Blue Tooth Power Windows & Locks, 7 Airbag System, Keyless
Entry, USB Port,140 Watt CD MP3, Fuse hands free
42 MPG HIGHWAY link system with Bluetooth

31 MPG HIGHWAY

5 YEAR UNLIMITED ROADSIDE ASSISTANCE. 10-YEAR 100,000-MILE LIMITED POWER TRAIN WARRANTY

5 YEAR OR 60,000 MILE NEW VEHICLE LIMITED WARRANTY

PREOWNED SPECIALS! PREOWNED SPECIALS! PREOWNED SPECIALS! PREOWNED SPECIALS!

2012 MITSUBISHI GALANT 2010 MITSUBISHI LANCER ES 2011 TOYOTA COROLLA LE 2012 FORD FUSION SE 2017 MITSUBISHI MIRAGE ES
FE Sedan. Excellent Family Car. Power Windows, 74,000 Miles Back Up Camera. 55,000 Miles. Full Power, Cruise, 47,655 Miles. Only 25 miles! Cargo Package.

$6,400 $6,750 $8,500 $9,400 $11,400

2015 OUTLANDER SPORT ES 2015 MAZDA3 SV 4DR SEDAN 2015 JEEP CHEROKEE 4D SUV 2016 MITSUBISHI OUTLANDER GT 2016 RAM 1500 CREW CAB SLT
Keyless Entry, 44,198 Miles. One Owner. 29,126 Miles. Backup Camera. Bluetooth. 4x4 Touring Package, 12,000 Mi. 2,100 Miles.

$13,500 $12,900 $16,850 $25,760 $25,899

772. 569.12001440 U.S. 1, VERO BEACH I MON. - FRI. 8:30 A.M. - 7 P.M. SAT. 8:30 A.M. - 5 P.M. I

ONE OF THE BEST WARRANTIES IN THE BUSINESS! DEPENDABLEMITSUBISHI.COM

*plus tax, tag, title, destination, and $289 Dealer fee. Price includes all factory rebates, cash back, and dealer discounts. Vehicles subject to prior sale. Not responsible for typographical errors. Offers Expire 8/17/17.

ALSO KNOWN AS

fFuIUWNrQrnRoChUiNRoteAubmIErTLreepDeIUsTaiIytnBRaYtoisanLEouiNnEddt’yaAlehSlawnMaEfcydiLthconEEeeipudsCsBroresTcFRohoolIfAoOlornoairNmNserirdiDseydeoaoafecfoa.uSraPnretrsAyddeuTlveaatIehOdl rey

“ANBo OSnOeLBUeaTtsEaLPYarNadOiseOPrNiceE”

oalHoHyunWoworodweubcew’3roeslcl0tbemaS.memnmoNpsaueitOwaknntpkeTieudteritaCiboecisOnebensucNersaiflenluorwVio.edoIcamNWviueyneCrregrSftEpr’aeotrDorihebunimceaYtj?eusEIoysWtnsTioftata?euYe2nrBO.re0sntrhUthitenoho!rtgepu

A. “THE ARUBA” Two (2)
Piece Sectional with C$o1n2tr8as8t.
Welt. SALE PRICE
AChvaaitlaHbglte. aCtoSckimtaiillaTraSbalvein&gsC.hair
BPWi.eec“lteT. HGEroTuRSpAINwLIEDitPAhRDCI”CoEnFotr$ua8rst(848) .
CInoccluktdaeils;Ta2bPleie&ceOStetcotmioanna.l,

CfoorcFkutaniclti&onOAttboimlitayn. can be Inter Changed

An unforgettable

8 August 11, 2017 memoSTr. iLaUClIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS www.stlucievoice.com

takes planning. companies since 2014 to launder money
through workers’ compensation fraud.
HILLCREST MEMORIAL GARDENS FRAUD SCHEME

WHEN YOU PLAN AHEAD, you can design every detail of your ownCONTINUED FROM PAGE A6 Hernandez confessed to assisting with
the opening and operations of EAR Con-
final tribute. That way, your loved ones won’t have to guess wbhuat tonyeoouf the contractor’s payees, EAR struction Services through Rosario, ac-

would have wanted, & you’ll have true peace of mind. When yocCuao’snrhseetdrruescotaimodney$S2e.r6vimceisllioCnoripnocrahteiockns, had cording to the court records. He said he
over obtained insurance with the help of a
co-conspirator and that he charges 6 per-
to get started, your Dignity Memorial® professionals can htheelpco. urse of four months at One Stop cent of payroll to “rent” the policy, the af-
Shop, a business that provides check-cash-

FERNHILL MEMORIAL GARDENS ing services at 8108 U.S. 1 in Wabasso. fidavit notes.

SERVICES INCLUDE: The amount far exceeded the payroll He told detectives that he moved his op-

• Personalized Professional Planning Consult that would have been anticipated based on erations from Miami-Dade and Broward
• End of Life Commemorative Services its workers’ compensation policy, which counties to Indian River because it is “qui-
WHEN YOU PLAN AHEAD named just one worker, the affidavit states. et” here, meaning the scam is not as well-

CrSeWekStWoanyy• Funeral Re-Planning Further investigation showed EAR Con- known as in South Florida.
SW Tradition Lakes Blvd. struction Services, a business registered to Lev Evans, assistant state attorney for
SW Hartwick Dr.Rosario in October 2016 at a Port St. Lucie
the 19th Judicial Circuit Court, is one of the
Get started on your personalized plan today & take advantage of spreesciidaenltsiaal avdindrgesss.,*received a total of $5.5 prosecutors gearing up to try the case. He
would not talk about the specifics, citing
Celebrating Lives million from similar check-cashing stores
with in less than eight months. obligations to the Florida State Bar.
Had the insurance company based EAR “There are two sets of victims in work-

Construction Services’ premium on a pay- ers’ compensation fraud,” Evans said. “The

AYCOCK FUNERAL HOMES roll of $5.5 million, a policy would have most immediate ones and the ones that
cost around $888,360, the affidavit states. complain are the insurance companies.
They don’t want to be paying out on claims
The Dignity Memorial professional provider network Instead, since only one employee was list- where they never took a premium on the
ed on the policy, Rosario was billed just un- worker.”
AYCOCKis here to guide you every step of the way der $4,800.
But Evans said workers, too, are victims.
EAR Construction Services was estab- Many times, laborers employed by
AT TRADITIONAn unforgettable lished by Rosario in October 2016, accord- scamming subcontractors are undocu-
ing to the affidavit. The business address mented immigrants in the country illegally
Our professiona1l2L, I5eF7xE1pCeSErWLiEeBTnRRcAAeTDdIIOaTNInmOdCNeEdNPmeTKdEoWiRcrYai.taeld who may be pressured to not report inju-
staff provides exceptpioonratl, sctot.malkpuaecssiesipolnaantencianrge. listed is a single-family home on southwest ries by the threat of exposure. In cases of
Citation Avenue in Port St. Lucie. insurance fraud, a worker who does report
his injury may not actually be covered.
Rosario told detectives that Hernandez The State Attorney’s Office routinely
helped him incorporate the business and handles insurance fraud cases, ranging
772-618-2336 obtain the insurance policy, the affidavit from disability payouts to automobile ac-
to families at a difficult time in their lives.WHEN YOU PLAN AHEAD, you*Subject to change without notice. Restrictions may apply. Please cancontact uds eforsdiegtainls. everyasdtwaeteetesak. HitloeocsaafsidhyHcoheuercnrkason.dwenz paid him $1,500
• Funeral & burial services of all faiths & culturesfinal tribute. That way, your loved onesSUPPLEMENT TO OCEAN MEDIA SOLUTIONS • 772-214-3663 • OMS407 won’t have to“Hgeuaedvsissedwhhisatcoymopuany is not a real
mindce.oesmWapnhandeyn,ctohnyedoyuuhcat’vrneeonroreeoaaflfdiwcyeo,rnko,” employ- cidents, Evans said. “Cases involving fake
• Persownoaulilzdehdavseewrvaincetesd,fr&omyouti’mll ehahvoentroureepdeace of Wolfkill corporations are more sophisticated and
rare.”
traditions, personal photographs to favoriteto get started, your Dignity Memorial® professionals can help.AycockFunwerarliHtoemse.-INSERT-0091-1517-OMS411 criminal of-
Rosario is a multi-state Hernandez’s bond is set at $400,000. He

readingsSE&RsVoICnEgSs INCLUDE: fender with numerous convictions and an has retained the legal counsel of Michael
outstanding arrest warrant from the Port Ohle, a private defense attorney with offic-

• Personalized Professional Planning Consult St. Lucie Police Department, the affidavit es in Fort Pierce. Ohle did not respond to a
request for comment.
• End of Life Commemorative Services notes.
Hernandez is part of family that also has Rosario’s bond is set at $300,000. He is
AYCO• CFunKeraFl RUe-PNlanEninRg AL HOMES being represented by a public defender.
a checkered past, the detectives said. The
His lawyer, Dorothy Naumann, said
Broward County Money Laundering Task shortly after his arrest that she had spoken
PORT ST LUCIE, FLORIDAGet started on your personalized plan today & take advaFmnoertmcaebgheearssoiodffeasnpctirefiimecdiianaalnldsnaaertvrweinostrgekd”s“.i*nmvuolltviipnlge to his mother and met with Rosario in jail.

Aycock at Tradition the Hernandez family, the affidavit states. He was respectful, friendly, quiet, she said.
Life Celebration Center Previous investigations show its members “They seem like good people. He’s pre-
established at least three construction shell sumed innocent.” 
Port St. Lucie
772-618-2336

Bayshore Blvd. AYCOCK Talk to
Aycock, Byrd, Young AT TRADITION your neighbors,
then talk to me.
& Prill Chapel 12LI5F7LE1iAfCeySECcWoLeclEekBbTarRRtaTtAAiroTaDndIIiCOtTieoNInnOtCeNrENPTKEWRY. Mike Rice, Agent
1170 SW Bayshore Blvd. port st. lucieSW Tradition Lakes Blvd. 974 SW St Lucie West Blvd See why State Farm® insures more drivers than GEICO
and Progressive combined. Great service, plus discounts
772-879-9300 772-618-2336 Port Saint Lucie, FL 34986 of up to 40 percent.*
Like a good neighbor, State Farm is there.®
Floresta Drive *Subject to chSaUnPgPeLEwMSiWtEShtoNnyoCTreuekTWtayOnoOtCicEeA.NRMesEtDriIcAtiSoOnLsUmSTW KIeaOatinygNDr.Sap•p7l7y2. -P2l1e4a-s3e66c3o•nOtaMcSt 4u0s7 for Bus: 772-878-7888 CALL FOR QUOTE 24/7.
1504 SE Floresta Drive detawilws.w.mikerice.net

Port St. Lucie Tradition Pkwy. SW Stony Creek Way
772-878-0049
SW Elsinore Dr.
Fernhill Memorial
Gardens, Stuart Tradition Pkwy.
772-283-6246
AycockFuneralHome-INSERT-0091-1517-OMS411
Aycock Funeral Home
Hillcrest Memorial Gardens,

Fort Pierce
772-461-8912

1001174.1 *Discounts vary by states. State Farm Mutual Automobile Insurance Company; State Farm Indemnity Company, Bloomington, IL

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | OBITUARIES August 11, 2017 9

IN LOVING MEMORY

FREDERICK E. BOYLAN, 74 He was preceded in death by three Treasure Coast Hospice
Port St. Lucie sons, Timothy Boylan, Michael Boylan Has Grown to Become
and Michael Hicks.
Frederick Edward Boylan, 74, of St. Treasure Health!
Lucie West in Port St. Lucie, formerly of ARTHUR D. ZANOTTI, 95
York, Maine, died Tuesday, Aug. 1, at York Port St. Lucie Treasure Coast Hospice has always treasured life. Now,
Hospital. we’re offering an expanded family of services, including
Arthur D. Zanotti, 95, of St. Lucie West
Born Feb. 26, 1943, in Portsmouth, Va., in Port St. Lucie departed this life Tues- palliative care, pediatric care and grief support, to
he is the son of the late Roy T. and E. Vir- day, Aug. 1. He was born in Bayonne, N.J., better meet the needs of our community.
ginia (Gerald) Boylan. and lived in Port St. Lucie for 18 years,
coming from Vero Beach. Licensed since 1982.
He was the husband of Patricia E.
(Brady) Boylan. They had been together Mr. Zanotti was a veteran of the United Treasuring Life | To learn more,
for 35 years. States Marine Corps, serving in the South visit TreasureHealth.org or call 866.999.4550
Pacific during World War II. He worked
Fred owned Custom Décor and Uphol- as a foreman for the Passaic Valley Water
stery. He was a member of St. Bernadette Commission in New Jersey before retiring
Catholic Church in Port St. Lucie and was to Florida in 1983. He was a 3rd degree
a trustee of Loyal Order of Moose Lodge Knight of Columbus, an usher at St. Ber-
#513 in Port St. Lucie. nadette Catholic Church and a member
of the American Legion.
Spending time with his family was very
important to Fred. In addition to his wife, He is survived by his son, Arthur L.
Patricia, he is survived by his three sons, Zanotti, and his wife, Lori; grandson,
Gregory Boylan of York; Scott and his wife, Arthur S. Zanotti and his wife, Vanessa;
Cathi Hicks, of Dallastown; and Robert two granddaughters, Denise Torres and
and his wife, Stacy Scott, of Tennessee; her husband, Lance, and Debbie Zanotti;
eight grandchildren, Nicole, Jamie, Jac- one great-grandchild; one great-great-
queline, Jessica, Trisha, Delaney, Finley grandchild; and many other loving family
and Taylor; 10 great-grandchildren; two members and friends.
sisters, Carole Wagner of York, and Priscil-
la King of York; three brothers, Frank Boy- Mr. Zanotti was preceded in death by
lan of New York, Jeff Boylan of Lancaster, his loving wife of 66 years, Lillian Zanotti.
and Kelley Posey, of Virginia; and numer-
ous nieces and nephews.

Enjoy Peace of Mind - With Pre-Planning

New • JEWISH GARDEN Pre Construction Mausoleum Prices

• Mausoleum and Niche Burial FWieneakl s!!
• Community Gardens

• Catholic Garden

• Star of David Garden

• Upright Monuments Here at Rolling Oaks, we understand these aren’t easy
• Veteran Garden decisions to make, and not decisions you make very
often. The worst time to make these decisions is
Veterans Benefits the day you have no choice. If you’d like some
information on what will be needed in the future, we
have family protection guides available to everyone. Pet Garden
We will help you make the hard decisions, so those Now
left behind don’t have to try to figure it out.
Available

2200 SW Del Rio Boulevard • Port St. Lucie, FL 34953

Office: 772-873-2441 • Fax 772-873-5019

10 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS www.stlucievoice.com

JOSH’S LEGACY SERVICES DISTRICT

CONTINUED FROM PAGE A1 CONTINUED FROM PAGE A1

support of Donate Life Florida. That orga- Sharon Schwabenbauer gives a keepsake bracelet to heart-transplant recipient Adelia Harris. PHOTO: MITCH KLOORFAIN Development District, which is a hy-
nization’s goal is to motivate Floridians to brid creation of the State Legislature.
register as organ, tissue and eye donors. that he’d broken his neck and aspirat- ron couldn’t speak about it. When she final- The districts operate as governmental
ed and drowned. They said he was brain ly volunteered, they said she wasn’t ready. bodies to deliver some municipal ser-
For Sharon Schwabenbauer, telling her dead. I’d love them to change that expres- vices, such as water and sewer. The
son’s story and encouraging organ dona- sion. He was an organ donor and the pro- “I was insulted,” she recalled. “Eight or services district also handles storm-
tion honors his life and keeps him close. cess started to find recipients. none months later, they asked if I’d like to water management in St. Lucie West.
speak at Memorial Hospital where Josh
Joshua David Schwabenbauer was “I could not believe it. He had so much was. I cried. People came up to me, in- Unlike other governmental bodies,
born on Dec. 13, 1985. going for him. There were over 1,000 peo- cluding the nurse who was on duty when such as school systems, the districts
ple at his funeral. To this day, they honor Josh was brought in. I wrote everyone’s don’t have state-mandated obligations
“He had gorgeous blue eyes and smiled him. Wherever we go, somebody knows names down. I wanted to send a picture to maintain fund balances, but can
all the time,” Sharon said. “He was a de- my son. The firefighters made stickers of what he really looked like. The nurses give themselves the requirement to
lightful child. When my daughter, Dana, of his badge and badge number. I made said we made such an impact. I spoke keep extra cash on hand.
was born, he was 15 months old. She fol- them and gave them to people. Wherever somewhere else a year later. The nurse
lowed him all over. He was her world.” they travel, they leave one and send me was there and she had seen his picture. “Your reserve fund should never dip
the picture.” She said he was gorgeous. He was known below that 17 percent (of your operat-
Josh had a stuttering problem that for his smile and his eyes sparkled.” ing budget),” Pickle said.
didn’t hold him back, and in 10th grade Sharon has also met people who have
he announced that he was going to be a become organ donors after learning Sharon has been with the support That’s about enough money for two
firefighter. After graduation, he attended about Josh. Sharon, who wasn’t an organ group Healing Hearts, which has helped months of operating should a gov-
the fire academy and became a paramed- donor herself, signed up. her. Still, the pain doesn’t go away and she ernmental body’s cash flows shut off.
ic. He started his career in 2009. worries about her daughter, who miss- That’s the amount Pickle is recom-
“Look at what he’s done,” she said. es Josh and is trying to be both son and mending that the board adopt as a
“He always told people to be organ do- “Four people are living their lives because daughter. minimum fund-balance. “Most gov-
nors,” Sharon said. “He always was one, of the gift he gave them. I’m lucky he was ernments like to keep 25 percent, a
even before he became a firefighter. He able to donate.” “If I were told I’d be given two children three-month fund balance,” Pickle
drove the other firefighters nuts until ev- and they’d live a long life, I’d rather go said. The district has done much bet-
eryone signed up. He traveled and tried Sharon has met the liver recipient, but through what I went through and have ter. It has a fund balance nearly double
anything. He was a diver, a lifeguard and it was something special to meet Adelia the same children,” she said. “You never that. “It’s about 45 percent at this point.
was going to work for a SWAT team as a Harris, the heart recipient. think your children will go first. When we We have built some of that up so we
paramedic.” met Adelia and listened to his heart, it was could do some stormwater projects.”
“We had been texting, but when we really hard to believe his heart was beat-
Josh, who was Jewish, traveled with met, she was the sweetest, warmest per- ing in someone else. Helping others helps The district is poised to approve an
his sister and cousins to Israel and had a son. She was so appreciative. She said me. He was compassionate. I know he’s about-$3.5 million operating budget
wonderful time. that this was not her donor family but her probably saying, ‘Good for you, mom.’” for the 2017-2018 fiscal year. That’s un-
gift of life family. She said she would take usually high and exceeds the expected
“He was very into a belief in God,” Sha- good care of Josh as he has taken care of For more information on organ dona- income, because the district is taking
ron said. “He always said when something her. She reached out to Dana, who has tion or to become a registered donor, visit care of some of those longstanding
was bothering him, he prayed to God and been having a rough time. His heart was www.donatelifeflorida.org.  needed projects.
God came through. He wanted to go to Is- given to a person a lot like him.”
rael to study.” For example, the district will build
The first year after her son’s death, Sha- a new office in coming months. That’ll
On Labor Day weekend 2009, Josh, cost about $1 million. The district has
Dana and friends went out on another been using a modular office building
friend’s boat. Dana took a picture of Josh since 2010. During that time, it’s kept
and the next thing anyone knew, his girl- utility rates and assessments steady.
friend was screaming and Josh was in the
water. No one saw what happened. An The operating budget doesn’t in-
off-duty firefighter saw him and pulled clude the utility fund, which is about
him out of the water. He was rushed to $9.1 million. That’s a separate account
the hospital. governed by bond issuances.

“I got a knock on the door,” Sharon For more, visit the district’s web site,
said. “They said Josh was in a very bad ac- www.slwsd.org. 
cident. I went to the ER and they said it
was not good. They took him to a trauma
Hospital and he was re-examined. They
called us in and said there was no hope,

Something New atTbis’AhvaCOMM8JE:0uMl0yOP3R1AMsTt
ION We are a full service Jewish congregation. We are Reform in our practice and renewal
in our full color joyous sense of community
Kabbalat
Shabbat - Friday 7:30 PM Sat. Morning: 9:30am Stolen Moments, 10:30am Shabbat Services

OPEN HOUSE! SPECIAL EVENTS! NOW ACCEPTING

Religious School - Ice Cream Social • Movie & Some Nosh! 2nd Sunday, August 13, 1pm HIGH HOLY DAY RESERVATIONS

Sunday, Aug. 13th, 11am • Havdalah Nights! 4th Saturday, August 26 Call or Sign-up on-line

6:30pm Pot Luck Dinner SLICHOT Saturday, Sept., 16th - 8:00pm

NEW LOCATION 540 N.W. University Blvd. #102 (front Building) West Park

For more info please go to: www.eitzchayim.org , or call 772-934-4110

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | NEWS August 11, 2017 11

BeWchoeremTruesttishaeFamDilyeTsraidgitinoner SAVE UP TO 30%

on Loose Diamonds
and Remounts!!

FREE 3D

Interactive Design
Consultation

Remount your Special Stone FREE Watch Battery*

Diamond, Dazzle & Design Ring Polish & Inspection 94¢ *Lithium
4+ Tax $ 00
• High Quality & Prompt Service • Competitive 1 PER CUSTOMER Unlimited
Pricing • Engraving • Custom Design • Appraisals With this ad. Expires 8-31-17 Excludes Invicta & Vicence
With this ad. Expires 8-31-17
WE BUY GOLD Silver, Coins, Bullion, Flatware

Visit our New Website: Isojewelers.com for Online Shopping!

906 SW St Lucie West Blvd. Walmart GAS West St. Lucie Blvd. S
Port St. Lucie Neighborhood Store W
H
772-621-7881(Walmart Neighborhood Store, Next to Dry Cleaners) Cody’s Original
Roadhouse

Cashmere

• INSTANT CREDIT • NO INTEREST • FINANCING AVAILABLE Bayshore Blvd.

let’s create your

Our all-inclusive together.

approach offers a Lic #CGC1507879
one-stop remodeling
experience for your COMING SOON!

entire project. Jupiter Design Center

Schedule Your 2151 S. Alternate A1A, Suite 900, Jupiter, FL 33477
Complimentary (South of Indiantown Rd. in the Three Palms Center)

Consultation www.DreamMaker-Jupiter.com
Today

Stuart
772.288.6255

Weekdays
9:00 a.m. – 5:00 p.m.

Stuart Design Center

6118 SE Federal Highway, Stuart, FL 34997
(South of Cove Rd. in the Tropical Smoothie Plaza)

www.DreamMaker-Stuart.com

12 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | HEALTH www.stlucievoice.com

‘If we can cure cancer I’ll change careers. I don’t mind.’

DOCS RAVE ABOUT ‘CAR T-CELL
THERAPY’ FOR BLOOD CANCER

BY TOM LLOYD | Staff Writer er places are so excited about is called out, this particular innovation in cancer Dr. Raul Storey.
“CAR T-cell therapy.” treatment has produced a stratospheri-
Physicians in general – and oncolo- cally high 82.5 percent remission and/or PHOTO: DENISE RITCHIE
gists in particular – don’t tend toward The Oncologic Drug Advisory Com- cure rate in early testing.
hyperbole. mittee for the FDA shares Storey’s sen-
timents. Just two weeks ago it unani- According to Storey, it could very well
So, when respected researchers and mously endorsed this first-of-its-kind make things like high-dose chemother-
oncology experts at institutions such as cancer treatment which uses a patient’s apy treatments a thing of the past in the
the Nationwide Children’s Hospital of own immune cells to fight a variety of not-too-distant future.
Columbus, Ohio, the Fred Hutchinson blood cancers such as leukemia and
Cancer Research Center in Seattle, and certain types of lymphoma, including Given the drug advisory panel’s un-
the Leukemia and Lymphoma Society non-Hodgkin lymphoma. usual unanimous endorsement, the FDA
of West Palm Beach start using phrases could approve this new therapy – devel-
like “the most exciting thing I’ve seen According to a front page article in oped by pharmaceutical giant Novartis
in my lifetime” and “a paradigm shift in the Washington Post, the advisory pan- and the University of Pennsylvania – as
treating cancer” to describe a new can- el concluded this new therapy’s benefits early as next month.
cer therapy, it’s probably time to take “far outweigh its potentially dangerous
notice. side effects.” Essentially, CAR T-cell therapy takes
a patient’s blood, separates and repli-
Treasure Coast Dr. Raul Storey, a Web- Those side-effects include “cytokine cates existing T-cells and quite literally
MD five star-rated hematologist and on- release syndrome,” which can cause re-programs them to hunt down and
cologist with Florida Cancer Specialists, fever and flu-like symptoms as well as attack what’s known as “CD19 protein”
certainly has. seizures and even delirium, but, accord- cells, a type of white blood cell that can
ing to the New York Times, “oncologists trigger both leukemia and lymphoma.
“It is fantastic,” Storey exclaims. “It’s have learned how to manage these acute
innovative. It’s like brand new. This is reactions and, so far, no long-term prob- In its current incarnation, this par-
like the new kid on the block.” That new lems have been detected.” ticular form of immunotherapy is not
kid Storey and the folks in Columbus, intended for use in treating cancers with
Seattle, West Palm and so many oth- More importantly, the Times points
CONTINUED ON PAGE B15

Each year, 40,000 women die from breast cancers.

What if that number was 0?

IItt wwoouulldd bbee Sheryl Crow
Nine-time Grammy Award-winning
artist Breast cancer survivor
Genius™ 3D MAMMOGRAPHY™
exam patient

Schedule Your 3D Breast Exam
Today at:

772-219-1080

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | HEALTH August 11, 2017 13

Why Suffer With Pain?

I Diagnose it, I Treat it, & I Control It!

SEE THE DOCTOR
THE FIRST TIME & EVERY TIME!

• Back, Neck & Spine Pain Your Plumbing and
• Herniated Discs, Sciatica, Water Heater Experts

& Pinched Nerves
• Arthritis & Muscle Pain
• Carpal Tunnel Syndrome

& More

Now David M. Glener, M.D.
Accepting:
• Board Certified - Anesthesiology
• Blue Care HMO & Pain Management

• Blue Medicare • Graduate of The Cleveland Clinic In Ohio
Advantage HMO • Faculty for Florida State University

School of Medicine

Stopping Pain on the Treasure Coast Since 1993

772.337.3350

561 NW Lake Whitney Place
Suite 102 • St. Lucie West

www.treasurecoastpaindoctor.com

• Battery - Ask About Our Save $50 ST. LUCIE CO.
Insurance - Billed RESIDENT SPECIAL,
Powered on
Portable Oxygen Service Call from the owner
PORTABLE OXYGEN Concentrators
(Reg $79) *This offer is good for any repair, Monday - Friday
• New/Used OXYGEN • MOBILITY • SLEEP RX • SUPPLIES 8am-5pm excludes holidays. May not be combined
with any other offers. All Ben Franklin Club Members
• Large Selection 970 SW St. Lucie West Blvd may combine their 15% discount. Expires 8/30/17.

Port St. Lucie $75 Standard Water Heater

(Across from Martin Health System Facility) Off Must be presented at time of
service. Expires 8/30/17. Excludes
Now Providing:
holidays. Coupons may not be
• Oxygen • Bathroom Aids combined with any other offer.

• Portable oxygen • Compression Stockings

• Hospital Beds • Scooters/Power Chairs $125 Deluxe Water Heater

• Wheelchairs • Medical Supplies Off Must be presented at time of
service. Expires 8/30/17. Excludes
Hours of Operation:
holidays. Coupons may not be
Monday - Friday 8:30am - 5:00pm combined with any other offer.

Saturday 9:00am - 1:00pm FREE Expert Plumbers For All Your Plumbing Needs.

Phone: 772-223-2825 Diabetic Socks CALL US TODAY! (772) 905-2600
Fax: 772-223-2824 Just for stopping
in - No purchase

necessary

The Premier Home Medical

Equipment provider on the Treasure Coast!

NEW PATIENTS WELCOME!

Summer Special Includes BEST PRICE ON CROWNS
Exam, Xray, Cleaning
845$
$49 NEW PATIENTS SC (0150) SLV SLV
(0272) (1110)
SC (2950) (2750) • Expires 8/31/2017 • Insurance Accepted
Expires 8/31/2017
Insurance Accepted

TAKE HOME FREE DENTAL
WHITENING KIT CONSULTATION /
SECOND OPINION
NEW PATIENTS ONLY
$89 Expires 8/31/2017 SLV (0140) NEW PATIENTS ONLY SLV
Expires 8/31/2017
Insurance Accepted

The patient and any other person responsible for payment have the right to refuse to pay, cancel, or be reimbursed for payment for any other service, examination or treatment
which is performed as a result of and within 72 hours of responding to this advertisement for the free or reduced fee service, examination, or treatment.

Call Now for Appointment 772-344-3300

1707 N.W. St Lucie West Blvd. Suite 126
St Lucie West (next to Tropical Smoothie)

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | HEALTH August 11, 2017 15

CAR T-CELL THERAPY ing, “This is the future.”
Then he pauses and says, “No, this is the
CONTINUED FROM PAGE A12
present. This is happening. We’re using it
“hard” tumors such as breast, prostate and and it’s working. We just need to be smart-
lung cancers, but Storey expects that, too, er and put more effort into applying these
may change quickly. kinds of techniques or modalities to treat-
ing cancer and refining the process in or-
If T-cells can be programed to attack der to provide more benefits and fewer side
CD19 protein cells, they can very likely be effects. … This is the starting point for the
“taught” to seek out other cancer-causing future of treating cancer.”
anomalies, Storey says.
Reminded that he would be out of a job
Still, if and when CAR T-cell therapy does if CAR T-cell therapy and subsequent vari-
become available to the general public, it ations succeed, Storey doesn’t miss a beat,
won’t be cheap. saying, “I don’t care. If we can cure cancer
I’ll change careers. I don’t mind. If we can
The Times estimates the cost will be in get rid of cancer I don’t mind changing ca-
the $300,000-per-patient range. reers at all.” 

Nonetheless, Storey is confident in say-

Tired of Cleaning Your
House?

Let Me Do The Cleaning!

Joanne’s House Cleaning Service

$10 OFF
1ST CLEANING Expires
8/31/17

Call Joanne 772-626-4967

Coastal Flooring LLC

• Cabinets FREE
• Granite ESTIMATES
• Flooring (Wood, Tile, Carpet)
• Window Treatments
18” TILE 49 /¢ Square
foot
WITH PURCHASE OF
INSTALLATION
$2195 FREE Under
VALID THRU 8/31/17 ONLY PLUS Cabinet
Lighting
50 SQ. FT. OF GRANITE
FOR 10’X10’
FREE KITCHEN CABINETS

$GRANITE With the Purchase of Cabinet Installation. Valid Thru 8/31/17

1595CUTTING

BOARD VALID THRU 8/31/17
Dream Kitchen • Great Prices3 ROOMS OF CARPET
799 • 772.380.4672 •INSTALLATION
$FREE Coastal Development Corp.

& FREE UP TO 40 SQ YDS. 8569 S. Federal Hwy. • PORT ST. LUCIE, FL • 34952
PADDING VALID THRU 8/31/17
www.CoastalFlooring.net
GC# CBC059814

Coastal Floors Granite-0081-0717-HI409

DISC OVER Y DAYS DISDCAOYVS ER
199$ 3DAYS

2 NIGHTS

Vitalia home has it all,
including stunning views

11214 SW Apple Blossom Trail in Vitalia at Tradition: 3-bedroom, 2.5-bathroom, 2,531-square-foot pool home
offered for $549,000 by Tony Reagan, 772-333-0025 of Lang Realty

18 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE www.stlucievoice.com

ExAspsiastendsLiivoinng inVciltuadliianghosmtuenhnainsgitvaielwl,s
Su2m01m7er
BY SHELLEY KOPPEL | Columnist then coming in to watch a movie or have a
[email protected] snack. Conveniently, the kitchen is adjacent
to the great room, and at 14-4-by-12, it has
The house at 11214 SW Apple Blossom plenty of room for the home chef. Here are
Trail, in the Vitalia community of Tradition, granite countertops, pull-out and soft-close
has terrific appeal both inside and out. In- drawers, 42-inch upgraded cherry cabinets
side, the Levitt-built house is anything but with a crown molding border, a five-burner
cookie-cutter, with architecturally interest- self-cleaning gas range, and four-door re-
ing archways and other features that you frigerator. There is also a dining area that’s
expect to find in a custom-built house. Out- perfect for informal meals.
side, there is lush landscaping at the front
and sides of the house, but at the rear, you To the right of the entryway is the master
have a preserve that looks like a botanical suite. There is a half bath and then the mas-
garden and ensures privacy. ter bedroom, 17-10-by-14. It has the French
doors that open to the pool. Along the hall-
You step into the house through double way are (sigh) really generous his-and-hers
entry doors with charming etched glass, California-style closets. Closets are a weak-
into an entryway with porcelain tiles on the ness for me and these were special. As you
diagonal. To the left of the entryway is a for- continue down the hall, there’s a surprise,
mal dining room, 13 feet, 2 inches by 10 feet, an area that could be a dressing space but
9 inches. It has the crown molding found that the present owners have made into a
throughout the house, and the fixtures and home office. The space is private and there’s
shutters remain here and in all the rooms.

GREAT NEWS Straight ahead of the entryway is a formal no need to give up a bedroom for office
living room, a spacious 22-2-by-15-4 that space. The master bath, just beyond, has a
We Heard You. has one of the three sets of French doors soaker tub, his-and-her vanities, a frameless
leading to the lanai and pool. shower and linen closet. The entire suite is a
Instead of extending our waitlist, terrific use of space.
Brennity at Tradition is expanding our The family or great room is really the
Assisted Living community. Construction heart of the home. The room is 27-10-by- To the left of the entryway, there are two
is nearly complete and a few brand new 15-6 and has a built-in electric fireplace bedrooms that share a bath. For the owner, it’s
apartments are still available, but won’t last long. that gives off heat and crackles. There is also the view outside that draws her to the rooms.
a built-in entertainment unit. It, too, has
Come see what the Brennity French doors opening onto the lanai and “I love the view out of these bedrooms,”
Difference will mean for you. pool area and you can visualize guests or she said. “You see all of the plantings. I love
grandchildren hanging out at the pool and the palms.”
Call today for your personalized tour.
CONTINUED ON PAGE 25
772-345-2700

SENIOR LIVING

INDEPENDENT COTTAGES•ASSISTED LIVING•MEMORY CARE
10685 SW Stony Creek Way, Port St. Lucie, FL 34987

BrennityTradition.com AL#11796

A SAGORA SENIOR LIVING COMMUNITY

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE August 11, 2017 19

Imagine your home,
totally organized!

Custom Closets Garage Cabinets Home Offices Pantries Laundries Hobby Rooms

FEATURES FOR 11214 SW APPLE BLOSSOM TRAIL

Neighborhood: Vitalia at Tradition
Year built: 2007
Construction: CBS

Square footage: 2,531
Total square footage: 4,263

Bedrooms: 3
Bathrooms: 2.5

Flooring: tile
Security: manned gate
Additional features: 55+ community, plantation shutters, im-
pact glass, heated in ground pool, fireplace, laundry room with
LG top-of-the-line appliances, furniture negotiable
Community amenities: basketball, billiards, business center,
clubhouse, community room, exercise room, game room,
library, pool, putting green
Listing brokerage: Lang Realty
Listing agent: Tony Reagan, 772-333-0025
Listing price: $549,000

TEAM NAPOLITANO 40% Off

YOUR COMMUNITY REALTORS WITH RESULTS Plus Free Installation

OPEN HOUSE! SUN. AUG. 13, 1-4PM Call For 40% off any order of $1000 or more. 30% off any order of $700 or more. Not valid with any other Follow us:
Your FREE offer. Free installation with any complete unit order of $500 or more. With incoming order, at time
429 SW Coolwater Court of purchase only.
Home
Fabulous home in Cascades Evaluation! Call for a free in home design
(55+ Community in St. Lucie consultation and estimate
West). Features 3BR/ 2.5 BA/
2CG. Upgraded kitchen w/ SS 772-210-3104 SLV
appliances & granite. Hardwood
floors throughout. Large patio www.closetsbydesign.com
opens to private yard. Accordion
shutters & whole house Licensed #CGC1509325 #MCNS6658 and Insured 2017 © All Rights Reserved. Closets by Design, Inc.
generator. $274,000

Call AnnMarie Today! [email protected]
www.annmarienapolitano.kw.com
954.675.2804 (Cell)
9700 Reserve Blvd. SLW
Keller Williams Realty

20 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE www.stlucievoice.com

TRADITION AND ST. LUCIE WEST REAL ESTATE SALES

TOP SALES OF THE WEEK

Activity picked up in the regional real estate market as the calendar turned to August, as 17 sin-
gle-family residences and lots changed hands from July 30-Aug. 4 (some shown below).
The top sale of the week in Port St. Lucie was the home at 7417 Laurels Place. First listed in
March 2016 for $725,000, this 3-bedroom, 4-bathroom, 3,337-square-foot house sold for
$692,500 on July 31.
The next-best sale was the residence at 8048 Links Way. Originally listed in March for $475,000,
the 3-bedroom, 3-bathroom, 2,853-square-foot house abode fetched $440,000 on July 31.

SINGLE-FAMILY RESIDENCES AND LOTS
ORIGINAL SELLING
PRICE
TOWN ADDRESS LISTED ASKING PRICE SOLD
$692,500
PORT SAINT LUCIE 7417 LAURELS PLACE 3/1/2016 $725,000 7/31/2017 $440,000
PORT SAINT LUCIE 8048 LINKS WAY 3/6/2017 $475,000 7/31/2017 $395,000
PORT SAINT LUCIE 10661 SW VISCONTI WAY 6/3/2017 $399,000 8/1/2017 $385,000
PORT SAINT LUCIE 8841 FIRST TEE ROAD 3/30/2017 $394,900 8/3/2017 $380,000
PORT SAINT LUCIE 8000 LINKS WAY 1/19/2017 $419,900 7/31/2017 $350,000
PORT SAINT LUCIE 5920 NW BATCHELOR TERRACE 4/14/2017 $365,000 7/31/2017 $269,000
PORT SAINT LUCIE 106 NW ROCKBRIDGE COURT 6/12/2017 $274,999 7/31/2017 $250,000
PORT SAINT LUCIE 12131 SW RUNNING OAK COURT 4/8/2017 $259,000 8/4/2017 $247,000
PORT SAINT LUCIE 5125 NW WISK FERN CIRCLE 4/21/2017 $249,000 8/2/2017 $240,000
PORT SAINT LUCIE 718 SW SAINT VINCENT COVE 5/9/2017 $244,000 8/1/2017 $235,000
PORT SAINT LUCIE 587 NW LAMBRUSCO DRIVE 5/26/2017 $237,000 7/31/2017 $230,000
PORT SAINT LUCIE 6124 NW EAST DEVILLE CIRCLE 3/25/2017 $275,000 8/2/2017 $230,000
PORT SAINT LUCIE 550 SW INDIAN KEY 3/6/2017 $244,000 8/3/2017

OPEN HOUSE Enjoy A Happier, Healthier, More Well Rounded
Lifestyle with our NEW Lifestyle 360
NEW MODEL GRAND OPENING
THE PALMS OF ST. LUCIE WEST
INDEPENDENT, ASSISTED & MEMORY CARE

Visit our newly-decorated Avalon model Our new Lifestyle 360 brings the Five dimensions of wellness into perfect
located at 2814 SW East Louise Circle in
harmony for a more balanced & fulfilled life. Intellectual, Social, Physical,
Port St. Lucie just off of Gatlin Blvd. Emotional & Spiritual. Come & Check out the various programs
we offer to our residents.
Sat. 10am-5pm & Sun. 12pm-5pm
• Independent, Assisted • Weekly house • Active social,
Ask about our Move-in Ready Homes, Lot Inventory & Memory Care keeping and recreational and
and Build on Your Lot programs • From the $240s personal laundry
• Five Star Rehab educational programs
on-site service • Scheduled local

• Fine Dining to include • All utilities and transportation

three nutritious meals basic cable available

per day, plus snacks

561.327.7199 • GHOHOMES.COM/SLC 501 NW Cashmere Blvd. Port St. Lucie West, FL 34986

All dimensions, features, specifications and square footages are approximate and subject to change without notice. Maps, plans, landscaping and elevation 772-344-7441
renderings are artist’s conceptions, are not to scale, and may not accurately depict the homes or lots as they are built.
www.ThePalmsOfStLucieWest.com

License #AL10438 © 2012 Five Star Quality Care, Inc.

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE August 11, 2017 21

HERE ARE SOME OF THE TOP RECENT TRADITION AND ST. LUCIE WEST REAL ESTATE SALES

8048 Links Way, Port Saint Lucie 10661 SW Visconti Way, Port Saint Lucie

Listing Date: 3/6/2017 Listing Date: 6/3/2017
Original Price: $475,000 Original Price: $399,000
Sold: 7/31/2017 Sold: 8/1/2017
Selling Price: $440,000 Selling Price: $395,000
Listing Agent: Chris Miret Listing Agent: Melinda Cann

Selling Agent: Keller Williams Realty Selling Agent: Cann Realty

Joanne McCurdy Lynda St Julien

McCurdy and Company Realty Keller Williams Realty

8841 First Tee Road, Port Saint Lucie 8000 Links Way, Port Saint Lucie

Listing Date: 3/30/2017 Listing Date: 1/19/2017
Original Price: $394,900 Original Price: $419,900
Sold: 8/3/2017 Sold: 7/31/2017
Selling Price: $385,000 Selling Price: $380,000
Listing Agent: Cesar Trujillo Listing Agent: Donald Baetzold

Selling Agent: Keller Williams Realty Selling Agent: Lang Realty

Meryl Kramer Kay Rodriguez

Realty Connection Int’l Lang Realty

YOUR FINAL CHRIS CHAPDELAINE
DESTINATION
REALTOR
faolrl Your Cabinet, Flooring and Granite Needs
Committed to making your Buying or Selling
The Most Aggressive experience an enjoyable one.
PRICE, QUALITY AND SERVICE!

CABINETS EMBRACE THE BEAUTY!
3 FABULOUS PGA VILLAGE POOL HOMES.
All American Made EMBRACE THE BEAUTY!
Laminate Floors FABULOUS POOL AND PGA VILLAGE

Largest Selection of In LAKE VIEW HOME!
Stock Materials
Popular Extended St. Andrews floor plan has it all!
GRANITE 3 Bedrooms, 3.5/ Baths, Den and a Golf Cart Door!
Attention to detail and custom features throughout won’t
40 EXOTIC
GRANITE SLABS disappoint. Call to view this lovely home today!

ON DISPLAY $478,000 8901 One Putt Place

PGA VILLAGE FORT PIERCE

VISIT THE LARGEST “A REAL BEAUTY” CentraPllyRlocIaVtedAtoCmaYny aAmeNnitDies. 3AbdrPmO2 btOh hLome has

GRANITE SLAB YARD! FLOORING Lovely 2 Bedroom + Den pool home. Spec- so much potential! Large rooms and floor plan presents many
tacular Golf Course View of the Wannamaker options. The family room/sunroom overlooks the pool & lanai.
APPLY FOR FINANCING ON OUR WEBSITE IN THE PRIVACY OF YOUR OWN HOME course. Beautifully maintained inside & out. Parquet and terracotta floors and built in cabinets. Bathrooms
WWW.JAYSFLOORSANDMORE.COM have granite countertops.With a little TLC this home can be a
$379,900 8905 First Tee Road
772-408-9522SE HABLA STORE HOURS: gem. New roof in 2004. $175,000

ESPANÓL MON - SAT 9-6 • SUNDAY 10-4

SHOWROOM: 1720 SE PORT ST. LUCIE BLVD. • MORNINGSIDE SHOPPES Specializing in PGA Village, Verano, St Lucie West, Torino, Tradition

SLAB YARD: 1661 SW SOUTH MACEDO BLVD. and the surrounding communities

772-529-3748 [email protected]

22 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE www.stlucievoice.com

SENIOR LIVING Add beauty and
natural light to your
EXISTING entryway

in about an hour!

• Glass patterns • Patio & Sliding
for every style Glass Doors
and budget
• Framed /
• Customize to Frameless
your style Shower Units

• Impact Glass • Etching

• Wood Interior/ • Schlage &
Exterior Doors Fusion Hardware

• Fiberglass • Mirror Wraps
Doors

Rewarding

Independent Living

Begin your Brennity at Tradition carefree lifestyle
in one of our spacious cottage homes and enjoy the
bonus of new friends, organized activities, outings, health
and wellness classes, transportation, and chef-prepared
meals all within our beautiful pet-friendly community.
Golf and tennis membership included.

Come see what the Brennity Difference 463-6500
will mean for you Regency Square
2426 SE Federal Hwy, Stuart
772-345-2700
Licensed & Insured
BrennityTradition.com

10685 SW Stony Creek Way, Port St. Lucie, FL 34987

A SAGORA SENIOR LIVING COMMUNITY AL#11796

Pine Trace in Port St. Lucie
Own from high $100s

• 1,366–2,506 sq ft, 3–5 bdrms, 2–3 baths
• no CDD fees
• commuter friendly; near I-95 and Florida Turnpike
• hiking, fishing and canoeing nearby at

Savannas Preserve State Park

5050 NW Pine Trail Cir., Port St. Lucie, FL 34983 From I-95, exit St. Lucie West Blvd.
heading east. St. Lucie West Blvd. becomes Prima Vista Blvd. Turn left on Airoso Blvd.,
right on St. James Dr. and left on Pine Trace Ave. to community entrance ahead on the right.
(772) 336-7007

888-KB-HOMES | kbhome.com

KB VALUE PUTS
THE BEACH IN REACH

Pine Trace is conveniently located near St. Lucie beaches.
It’s time for fun in the sun—visit KB today!

KB ValueYour Needs. Your Wants. Your Satisfaction. THAT’S

Broker Cooperation Welcome. ©2017 KB Home (KBH). Plans, pricing, financing, terms, availability and specifications subject to change/prior sale without notice and may vary by neighborhood, lot location and home
series. Buyer responsible for all taxes, insurance and other fees. Sq. footage is approximate. Photo may display decorator items/furnishings not available for purchase and may not represent lowest-priced homes. Photo
does not depict racial preference. See sales counselor for details. CGC1509034 JAX-145909

Real Estate • Mortgage • Title

Residential • Luxury • Commercial • Property Management

772.343.7261

1850 SW Fountainview Blvd. Suite 200, St. Lucie West — South Florida’s Real Estate Leader Since 1926

INDUSTRY- $62 BILLION MORE U.S. HOME SALES VOLUME
LEADING
SALES. Volume shown in billions of dollarsLeading Real Estate Companies of the World® / The Keyes Company, Network Affiliatesn Leading Real Estate
WORLD-CLASS $368 Companies of the World® /
SERVICE. The Keyes Company, Network Affiliates
$306
$260 n RE/MAX
$225 n Coldwell Banker
n
n Berkshire Hathaway Home Services
n Century 21
n Sotheby’s International Realty
n ERA
n Better Homes & Gardens
n Realty Executives
n HomeSmart

Real Living

$127

100

1.1 MILLION TRANSACTIONS $68
$368 BILLION IN HOME SALES
565 COMPANIES 50
4,100 OFFICES
130,000 SALES ASSOCIATES $21 $19
65 COUNTRIES
$17 $12 $9 0

Actual member statistics for LeadingRE and estimates for other networks using average sales
units per agent and average sales price for firms in each respective network from published
sources for 2016 production.

Sources: REAL Trends National Network 2016 Totals Final Report, REALTOR® Magazine 2015
Franchise Report, and various website research.

As an affiliate of Leading Real Estate Companies of the World,® our
brokerage is a local and global market leader working on your behalf.
LeadingRE’s world-class marketing resources and connections allow
us to provide you with a truly exceptional real estate experience.

© 2017 Leading Real Estate Companies of the World.® All Rights Reserved.

C–Sales Volume. 05.17 Equal Housing Opportunity.

Deborah Shockley CRB Founding Member & Affiliate of KEYES.COM

District Sales Manager Interested in a career
in Real Estate?
[email protected]
Call 772.343.7261
KEYES.COM KEYESLUXURY.COM
KEYESCOMMERCIAL.COM

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | REAL ESTATE August 11, 2017 25

CONTINUED FROM PAGE 19 tanical garden. The preserve extends all
the way to Village Parkway and will never
Finally, you step out onto the covered be built on.
lanai, with the maintenance-free stamped
concrete floor. The pool is screened in, but This is a house that has had every de-
it is the view of the preserve beyond that tail thought out, both inside and out. The
catches the eye. Tony Reagan, the agent rooms flow well and it’s meticulously main-
for Lang Realty, calls is a “tropical oasis”; tained. It really is in move-in condition and
my thought was that it looked like a bo- it will give you a lot of pleasure. 

w

wat e r c r e s t
st. lucie west

Now Accepting Reservations!

An engaging lifestyle awaits you filled with outstanding dining and unsurpassed personal care
in an environment purposefully designed to enliven the senses and instill well-being.

279 NW California Blvd. Port St Lucie, FL 34986
Sales Office

1555 NW St Lucie West Blvd. Suite 203 Port St. Lucie, FL 34986
772-877-2596

www.watercrestseniorliving.com

Real Estate. Redefined

TREASURE COAST FEATURED PROPERTIES

PGA VILLAGE PGA VILLAGE PGA VILLAGE PGA VILLAGE

SPECTACULAR FAIRWAY & WATER VIEWS. Pristine WATER AND GOLF VIEWS! The Arlington by Kolter POOL HOME with STUNNING LAKE & GOLF VIEWS ELEGANT POOL HOME ON CUL-DE-SAC. 3br, 3ba
‘Arlington’ home, pool & spa, 4BR, 3.5BA, formal living & Homes, 4BR, 4.5BA, pool & spa, beautiful upgrades in- Spacious 3br, 3ba PLUS den, newer kitchen, newer A/C PLUS den, 3CG Exceptional quality finishes thru-out,
dining rms, kitchen w/granite, SS appls, wall oven cluding porcelain tile, granite, SS appls & crown moldings & water heater, screened lanai heated pool. oversized lot, preserve & partial golf views
Kay Rodriguez 772-486-2126 Linda MacCormack  772-812-0469 Moira Feely Rekus 772-626-7812 Elise Danielian 772-418-2992; Ingrid Hewitt 772-203-7800
RX-10355464 New Listing! $559,900 RX-10351133 $589,900 RX-10349132 $349,900 RX-10324825 $579,900

LAKE CHARLES / ST. LUCIE WEST PGA VILLAGE TRADITION / VICTORIA PARC PGA VILLAGE

LAKEFRONT. 5BR, 3.5BA, loft/media/game room ground 3BR+office, Kinsley Model, All upgraded w/gourmet IMMACULATE WATERFRONT HOME BEAUTIFUL POOL & LAKEVIEW HOME. Endless
floor master-suite, over 3,300sq ft. living area. Major granite island kitchen, glass tile backsplash, newer SS 3br, 2ba, 2cg on oversized corner lot, beautiful upgraded upgrades in this 2782 sq. ft home, 3br, 3.5ba + Den, 2cg
upgrades, beautiful lake view Appliances, PGA Golf Course & water views finishes throughout w/golf cart door, great rm w/fireplace.
Joe McDuffee  772-529-5245 Donald & Lisa Baetzold 772-618-0026 Donna Finley 772-985-3830; Damaris Alamo 772-631-7887 Chris Chapdelaine 772-529-3748
RX-10305275 $379,000 RX-10355887 Just Listed! $419,900 RX-10325613 Just Reduced! $249,900 RX-10340895 $469,000

BECKER RD AREA FT. PIERCE PGA VILLAGE ST. JAMES GOLF CLUB

CBS HOME WITH PRIVATE FENCED YARD 3BR, 2BA BEAUTIFUL POOL HOME ON 5.6 ACRES. 4br, 2ba, POOL HOME ON THE 17TH FAIRWAY 4br, 3ba includ- GOLF VIEWS & FENCED YARD. Great family home,
2CG. soaring ceilings, brand new SS appls inc. washer/ 2cg, screened lanai with large pool, 5.6 acres with pond ing the cabana bath tile in living areas, SS appls, pool & 4BR/2BA, granite, large master suite, accordion shutters
dryer screened patio, private yard w/fruit trees. Shed conveys and fenced in area for horses spa overlooks the Legacy Golf Course on all windows & doors. Low HOA fees
Pam Misiano 772-224-9691 MaryLynn Ninesling 772-370-6466 Diane Gault 772-342-7455 Isabelle Lendl 772-713-3221: Elise Danielian 772-418-2992
RX-10353684 $198,000 RX- 10210098 $389,000 RX-10341937 $329,000 RX-10347895 Just Reduced! $299,900

PGA / VERANO PGA / VERANO TRADITION / VITALIA PGA VILLAGE

POOL HOME with STUNNING WATER and GOLF SHOWS LIKE A MODEL HOME Bella floorplan w/2/ VITALIA– SPECTACULAR ‘SEASPRAY’ MODEL WITH YOU’VE BEEN WAITING FOR THIS HOUSE! Beautiful
VIEWS “Isabella” Model, covered & screened patio w/ BDs, 2BAs, PLUS den, beautiful upgrades thruout, crown, POOL 3br, 2.5ba home, tile on diagonal, crown moldings, 3br, 2.5ba w/upgrades built-ins, quartz counters, SS,
custom Salt Water Pool plantation shutters,seamless shower,prem water lot custom built-ins, dbl door entry, pool screened patio overlooks 7th hole of The Ryder Cup
Donna Finley 772-985-3830; Damaris Alamo 772-631-7887 Kay Rodriguez 772-486-2126 Ryan Reagan 561-308-0807; Tony Reagan 772-333-0025 Dave Cullen 772-418-0778
RX-10331986 $377,900 RX-10334039  $324,000 RX-10353659 New Listing! $549,000 RX-10343086 $320,000

PGA VILLAGE LAKE FOREST TRADITION / HERITAGE OAKS PGA CASTLE PINES

POPULAR MEDINAH FLOORPLAN. Like New, 3BR, FABULOUS 3BR, 2BA, 2CG. HERITAGE OAKS – BEAUTIFUL 3BR HOME tile OPEN HOUSE 1-4/ 8125 Carnoustie Place
2.5BA, private preserve & lake views. all tiled, new SS appls, screened covered patio throughout living areas, screened in patio with add’l paver 3BR, 2BA, 2cg. Fabulously furnished & decorated.
Elise Danielian 772-418-2992 w/private yard patio, beautiful landscaping. 2nd flr balcony, 1st flr patio
Ingrid Hewitt 772-203-7800 Michelle Agrusa 772-263-6131 Becca Layne 772-224-6994 Donald and Lisa Baetzold 772-618-0026
RX- 10280113 $359,000 RX-10315734 $189,900 RX-10337864 $189,900 RX-10355249 Just Listed! $189,900

888.420.5828 | Visit: Langrealty.com to view our portfolio of properties

Port St. Lucie Office | 8305 Holley Tree Trail, Port St. Lucie, FL. 34986 | 772.467.1299

Agent Exclusives THE MARKET
IS HOT,
RANKED #1 IN SALES & LISTINGS IN PGA VILLAGE
INVENTORY
IS LOW!

CONTACT KAY
TO LIST AND
SELL YOUR

HOME

Kay Rodriguez

When you are looking for the best, give me a ring!

LOOKING TO SELL OR BUY???

YOU NEED TO CALL KAY!!!

Call Kay Rodriguez @ 772-486-2126

krodriguez.langrealty.com

PVGILALAGE $479,000 PVGILALAGE $264,900

OUTSTANDING GOLF and WATER VIEWS! UPGRADED “MOVE IN” READY HOME!
It has all been done for you in this 3BD, 2BA, 2CG home with tranquil water views from
A St. Andrews floorplan with 3BDs,2.5BAs and a 2+ side load garage. Stunning screened your covered and screened lanai! Other than kitchen and baths,all new wood patterned
rock waterfall pool and spa with interior landscaping. A covered side lanai with extended tile floors and fresh interior paint throughout including the garage! The eat-in kitchen
automatic awning plus electronic rainguard privacy blinds. Electronic hurricane shutters! boasts all new stainless steel appliances and the laundry room offers brand new washer
Formal dining room w/builtin server open to large great room. kitchen w/granite, walkin and dryer. Large lot well landscaped. PGA Village offers a clubhouse membership
pantry and designated dry bar w/wine cooler. Wired for sound outside and in great room. with property ownership. Amenities include pool,tennis, gym, basketball,
billiards and much more!
Crown molding throughout, diagonal tile floors, plantations shutters. Dual zoned
heating/AC. Large master suite. Private office/den off foyer entry. Great curb appeal! 7230 marsh terrace
RX-10303086
8636 One Putt Place
RX-10332816

PVGILALAGE $309,900 PGA VVEILRLAANGOE $324,900

PREMIUM CORNER LOT PLUS LAKE VIEWS! SHOWS LIKE A MODEL HOME!

Beautiful corner lot on the lake! Walk to the Island Club! A true 3BD,2BA Mid-Ocean A beautiful BELLA floorplan barely lived in with all the right upgrades! Offering 2BDs,
floorplan and move in ready! Exterior painted in 2016! NEW 30 gallon water tank, 2BAs plus and office den with double doors. Step up to brick paver front porch and enter
through custom impact glass decorative doors into the foyer. An open concept awaits you
NEW stainless refrigerator,microwave, range, sink,garbage disposal and sink fixtures! with large eat in kitchen, upgraded appliances, custom cabinetry,granite counters, a cook’s
2017 NEW carpeting with upgraded padding. Roof underlay w/NEW plywood as needed and pleasure! A master suite w/large bath boasting seamless glass shower and custom closets.
resecured tiles. Dryer vent cleaned from roof to laundry. Enjoy the lake views from your
Large great room with crown molding, plantation shutters and glass sliders to a
covered/screened lanai. Room for a pool but take the short walk to the Island Club covered screened lanai w/sunset views over the water!
and make that pool your own! An opportunity NOT to be missed!
19027 POsitanO Way
9102 chamPiOns Way RX-10334039
RX- 10338263

8305 Holley Tree Trail, Port St. Lucie, FL 34986

Real Estate. Redefined

TREASURE COAST FEATURED PROPERTIES

THE REAL ESTATE LEADER
SERVING THE TREASURE COAST.

QUALITY VS QUANTITY
LANG AGENTS OUTPERFORM THE
COMPETITION IN PER AGENT SALES

LANG REALTY

$2.3 million

per agent 33 agents

Remax
Masterpiece
$1.5 million

per agent
63 agents

Berkshire Atlantic KW-PSL Colwell KW
Hathaway Shores $850k Banker – Realty
$808k Thos J White $500k
$704k per agent $656k
per agent 133 agents per agent
per agent 108 agents per agent 103 agents
48 agentss 16 agents

Stats obtained from Metrographics for the 6 month period Between 1/1/2017 thru 6/30 2017

LOCAL • TRUSTED • PROVEN

800-628-5551 | Visit: Langrealty.com to view our portfolio of properties

Port St. Lucie Office | 8305 Holley Tree Trail, Port St. Lucie, FL. 34986 | 772.467.1299

fun, food SECTION
festivities
FRIDAY, AUGUST 11, 2017 YOUR INDEPENDENT LOCAL COMMUNITY NEWSPAPER

Coming Up! THE GUYS HAVE IT THIS SEASON AT RIVERSIDE

TAKE FLIGHT WITH ALLEN CORNELL. BY MICHELLE GENZ | Staff Writer
‘HIDDEN FIGURES,’
FREE AT SUNRISE PHOTOS: DENISE RITCHIE Riverside Theatre may want to add
a cigar bar to its just-opened outdoor
BY SAMANTHA BAITA | Staff Writer cocktail bar, with a testosterone-target-
ed season that spans rockabilly, strip-
1 The free summer movie at pers and football.
the Sunrise Theatre in Fort
Pierce this Sunday is one you For the second year, the Vero Beach
don’t want to miss. “Hidden Fig- facility is staging a play amid its usual
ures” is the critically acclaimed lineup of musicals. And lineup is the
2016 biographical drama about operative word in “Lombardi,” a play
female African-American mathe- about a week in the life of legendary
maticians who worked at NASA in football coach Vince Lombardi who in
the 1960s, during the Space Race. the mid-1960s led the Green Bay Pack-
They are considered, says Wiki- ers to a championship. The play is based
pedia, “the brains behind one of on the 1999 book by Pulitzer Prize-win-
the greatest operations in U.S. ning Washington Post journalist David
history,” having risen in the ranks Maraniss, “When Pride Still Mattered: A
alongside many of science’s great- Life of Vince Lombardi.”
est minds to calculate the histo-
ry-making launch of astronaut The story of great leadership has par-
John Glenn into orbit – and back. ticular meaning today, says Riverside
“Hidden Figures” starts at 3 p.m. CEO Allen Cornell, who will be direct-
ing the play. “I think a lot of men would
2 If you can’t imagine watch- be interested in coming to the theater
ing a movie without pop- to see this,” he says. “Most importantly
corn and a soda, this one’s for you. in this day and age, it’s about who are
The 1941 screwball comedy “The the winners and who are the losers and
Lady Eve” screens at the Kane what does it take to be a winner.”
Center in Stuart Wednesday, Aug.
16, at 1 p.m. The ’40s saw a num- Cornell has cast Richie Zavaglia
ber of fabulous flicks of this genre, in the lead role. Along with bearing a
none more satisfyingly hilarious physical resemblance to Lombardi, Za-
than this one, starring Barbara vaglia’s own Italian heritage led Cornell
Stanwyck as a beautiful con artist to think of him. “He was in a play I di-
and Henry Fond as her rich, naive rected several years ago, and I thought
of him. He’s really a fine actor.” That
CONTINUED ON PAGE B2 play was “Breaking Legs” in 2009.

CONTINUED ON PAGE B5

Gift DINNER SPECIALS
Certificates
4pm to Close
Always
Starting at 6pm Available Tuesdays & Thursdays
Tues - Various Artists SAVE $20
Wed. - The New Yorkers
Thur/Fri - Shawn Langford When you Bring your own Bottle of Wine to Dinner (No Corking Fee)
Sat - Jack Marazell
On Our Patio WEDNESDAY 10% OFF Early Bird Specials
WINE SPECIAL
SUNDAY ENTIRE BILL !! from $13.95
BRUNCH Order two entrees for $13.95 each
or more and receive a FREE bottle of Dinner only. Must present coupon. Fresh Seafood, Chicken, Beef, Pasta, & More. Choice
SERVED house wine. Must Present Coupon. Does not include tax or gratuity.
FROM Cannot be combined with any other Cannot be combined with any other of Potato, Vegetable & Dessert of the day • Available
discount. Expires 8/31/17 SLV
discount, Expires 8/31/17 SLV 4:00pm~6:00pm (Must be Seated by 6pm)

10AM - 2PM 772-343-1146

Family Owned & Operated • Support Your Local Merchants 1680 SW St. Lucie West Blvd., Port St. Lucie (Across from Walmart) www.pslwestendgrill.com

2 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | ARTS www.stlucievoice.com

’TIS THE SEASON FOR ‘WHITE HOT SUMMER GROOVES’ COMING UP

BY SHELLEY KOPPEL | Staff Writer PHOTO COURTESY OF THE LYRIC THEATRE White and Groove come to the Lyric CONTINUED FROM PAGE B1
[email protected] with a band from Clearwater, the same
“If you take your own song or a pre- band that has accompanied them on mark, whom she meets on an ocean liner.
Many of us are so accustomed to seeing viously recorded song and make it your their Christmas tour. It includes Ron Re- Find out how Stanwyck’s well-laid plans go
Peter White and his band of Merry Prank- own, it’s all the same,” White said. “I nev- inhardt on keyboard, his brother Dave on astray. Tickets are $7 and include popcorn
sters for “A Peter White Christmas” at the er try to copy the original. I’m not trying drums and bass player Tom George. and a drink.
Lyric Theatre every year. It’s always a sell- to copy the sound or the sound of an era. I
out, whether he brings Rick Braun, Mindi do the songs of yesteryear in my own way, At the end of the interview, White Counting Crows.
Abair or, this past year, Braun and saxo- taking the melodies and adapting it to my mused about a career that took a 20-year-
phonist Euge Groove. White and Groove own style. People’s faces light up when old from a small town in England. Since 3 Fans of 1990s though the mid-2000s
are coming back to Stuart’s Lyric Aug. 26 they hear the songs of the ’70s. That was he’ll be coming to Florida in August for pop rock: Plan to head down to Per-
for “White Hot Summer Grooves,” and a great time for music. They start singing the first time, he mentioned that he grew fect Vodka Amphitheatre in West Palm
I had the opportunity to talk with Peter along and it’s priceless. The whole point up without air conditioning. this Wednesday, Aug. 16, for the Count-
White about a show that is pure tin and is to get everyone else singing.” ing Crows concert. The Berkeley, Calif.,
no tinsel. “When I came to Hollywood it was rock band that some initially labeled de-
White loves the Lyric and is always summer and I went into a grocery rivative wowed fans and became one of
“We have opted before to play more glad to return. store,” he said. “It was cool, and outside the most popular groups of the era with
Christmas music than our own (music),” it was hot. That was different for me. I hits such as “Mr. Jones” and their cover
he said. “A guy sent me an email that there “Ten years ago, I’d never heard of Stu- was in my early 20s when I started tour- of Joni Mitchell’s “Big Yellow Taxi.” Count
was too much Christmas music and I said art or the Lyric,” he said. “We got an of- ing and I had never lived in a house with on the Crows to bring nothing but hits to
that it was a Christmas tour. The show fer from John (Loesser, then the Lyric’s a telephone. There was a pay phone at the Perfect Vodka stage. Also on the bill
we’ll be doing is all our own music. It’s executive director), and it appeared on the corner. Having a telephone was not is Matchbox Twenty, a rock band out of
different, but with the same dynamic and our Christmas tour schedule. It’s the a necessity in 1960s England. ... I’d al- Orlando. Their debut album, “Yourself or
humor. For the last Christmas tour, Euge smallest, most intimate place we play and ways been a homebody and here I am Someone Like You,” was certified double
took the place of Mindi and did great. He they’ve got a good crew.” traveling the world. It was an eye-open- platinum in the U.S. and multi-platinum
brought a lot of humor and we like to do er, but I’m still here.” in Canada, New Zealand and Australia,
that. We’ve done a lot of shows together according to their website. Music starts
and we’re talking about doing an album “White Hot Summer Grooves” with Peter at 6:45 p.m. 
for next summer.” White and Euge Groove comes to the Lyric
Theatre, 59 SW Flagler Ave., Stuart, Aug. 26
In addition to their own works, White at 6 and 8:30 p.m. Call the box office at 772-
and Groove, whose real name is Steve 286-7827 or order online at www.lyricthe-
Grove, will play covers, but they will have atre.com. 
a twist.

$5 OFF $25 PURCHASE Serving Sunday Brunch
CODE: DH 5OFF25 10am-2pm
Expires 8-31-17

Limit one per table, per visit. Cannot be combined with any other offers,
coupons or specials. Cannot be used for taxes, gratuity, cash back, gift
cards or alcohol. No cash value. Valid only at St. Lucie West Location

TEACHERS, STUDENTS NOW OPEN 7 DAYS
AND PARENTS
The NGeawstersotpFulborHidaasKLeaynsd-Iends!pired
BRING IN A COPY OF YOUR RECEIPT FOR SCHOOL
10% OFFSUPPLIES AND RECEIVE
YOUR ENTIRE BILL. $5.00 OFF
$25.00 or More
772-873-4234 529 NW Prima Vista Blvd.
Limit one per table, per visit. Cannot be Port Saint Lucie, FL 34983
1319 NW St Lucie combined with any other offers, coupon or
West Blvd. specials. Cannot be used for taxes, gratuity, 772-207-7530
cash back, gift cards or alcohol. No cash

value. Expires 8/31/17

Making Dreams Come True for 43Years

HELD OVER BY POPULAR DEMAND!

Summer Customer Appreciation Event!

Get out of the heat and make the drive!

Come visit Diamonds By Terry and reward
yourself with a complimentary glass of
wine, sangria, beer or tea.

Enjoy our beautiful air conditioned, custom
jewelry design center with over 2000 custom
designed pieces to explore and experience.
Receive a gift certificate for a free lunch to the

Diamond Tearoom & Bistro with every
$100 purchase.

Terry & Frederick Country Club Plaza Diamond
Rieger 3868 SE Dixie Hwy, Stuart Tearoom &
772-781-1133 • Bistro 772-781-5153 Bistro
Hours: Tues. Wed. Thur. & Fri. 10am - 5:00pm
www.DiamondsbyTerry.com
www.diamondtearoom.com

4 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | ARTS www.stlucievoice.com

Bottle Shock $2A0n.y002! for DISCOUNT OFFICE FURNITURE

WINE TASTING SAVE! NEW & USED
HOME & OFFICE
FRIDAY, AUGUST 18TH 6-8PM OPEN 6 DAYS
MON - FRI 9AM - 5:00PM
Held annually in more than 600 communities nationwide, the Alzheimer’s Association Walk to End SAT 10AM - 4PM
Alzheimer’s® is the world’s largest event to raise awareness and funds for Alzheimer’s care, support and SUN. CLOSED
research. This inspiring event calls on participants of all ages and abilities to join the fight against the
disease! For a $5.00 donation at the door, please help to raise awareness and funds for Alzheimer’s care. INTRODUCING OUR NEWEST
TEAM MEMBER, SHANE LEWIS
SPECIALTY PRODUCTS FROM AROUND THE WORLD
OUTSIDE SALES REPRESENTATIVE Shane Lewis
NEW
SELECTIONS 398-0085OFFICE FURNITURE
TO CHOOSE
DISCOUNT CENTER
FROM!!
10997 US HWY. 1 • PORT ST. LUCIE
RECOMMENDED BY • JUST SOUTH OF WALMART

MAGAZINE

MICHAEL 1707 NW St. Lucie West Blvd
OWNER/OPERATOR Suite 186 (Next to Panera)

772-224-2317

Mon - Sat 9-8pm • Sun 11-4pm

WELCOME TO

Delicious

VISIT YOUR LOCAL CULVER’S RESTAURANT: FREE Double Deluxe
ButterBurger
...................................................................
With purchase of a Double Deluxe ButterBurger
Culver’s of Port St Lucie
Expires 12/31/17 Electronic versions of this coupon are not accepted.
NOW10770 SW Tradition Pkwy
Please no substitutions. Not valid with any other offer.
Port St. Lucie, FL 34987 Value 1/200 cent. Limit one coupon per person per visit.
Valid only at Culver’s of Port St. Lucie restaurant.
(772) 345-2874 624-07/17

OPEN!© 2016 Culver Franchising System, Inc. PEPSI and the Pepsi Globe are registered trademarks of PepsiCo, Inc. 12/16

1116_GEN000_General Ads-H.indd 1 12/28/16 6:06 PM

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | ARTS August 11, 2017 5

RIVERSIDE SEASON came out with a UPI photographer. Allen Cornell with The third jukebox musical in the
The story and photo ran the next day Rebekah Baumgartner. Riverside lineup, this one threads to-
CONTINUED FROM PAGE B1 under the headline “Million-Dollar gether the songs of the Swedish pop
group Abba. There is a plot as well, a
“Lombardi” opens Jan. 30, perfect timing Quartet.” paternity whodunit with the setting
for a ticket as a stocking stuffer. a destination wedding on a Greek is-
The stage musical written about land.
Before that are two more main-stage
shows likely to please the patrons with that afternoon premiered at Dayto- Don’t feel left out yet, dudes.
pickup trucks. “Hank Williams: Lost High- There are a couple more options for
way” opens the season in late October, na’s Seaside Music Theatre ten years the XYs in Riverside’s smaller Wax-
followed by “Million-Dollar Quartet,” the lax stage. For the subset who live
tale of the chance recording session of four ago, opening on Broadway in 2010. and breathe Barbra Streisand, there
massive country and rockabilly legends. is “Buyer and Cellar,” a 90-minute
Riverside’s production will be di- one-man comedy about Streisand’s
The two shows, while featuring simi- real-life basement, which is appar-
lar music, “are very different stylistically,” rected by Keith Andrews, who direct- ently crammed to the gills with her
says Cornell. “The Hank Williams piece has myriad possessions, meticulously mer-
more of a narrative thread. You really fol- ed “The Full Monty” here in 2012. chandized as if in a mall. That image,
low Hank’s journey of how he became a leg- which appeared in a Streisand coffee ta-
end along the lost highway. ‘Million Dollar There might have been a quintet ble book, inspired the lone actor to fanta-
Quartet’ is more of a spontaneous interac- size minding that store.
tion of these guys when they came together had that serendipitous studio session And finally, for the classic man, a
this one time.” musical comedy mystery with multiple
taken place three years earlier, be- endings based on Charles Dickens’ un-
That famous session took place in De- finished last novel: “The Mystery of Ed-
cember 1956, at Sun Record Studio in fore the stunning early death of Hank win Drood.” With book, music and lyrics
Memphis. Owner Sam Phillips had called written by Rupert Holmes, Broadway’s
in his latest artist, the then-unknown Jerry Williams. His story is told in “Hank “Drood” has been trimmed to a cast of 12
Lee Lewis, to help out on piano on a track to fit into the intimate Waxlax. For that,
Carl Perkins was recording (Perkins’ most Williams: Lost Highway,” a tribute to the time greatest Broadway musicals. director and choreographer DJ Salisbury
famous hit was “Blue Suede Shoes”). As worked directly with Holmes. While the
the session got underway, Elvis Presley, country-and-Western legend who died at “Gypsy” was first envisioned by produc- version the two collaborated on has been
then 21 and a former Sun artist, dropped staged a couple of times, the Riverside
by to say hi and decided to join in the jam. 29 on a snowy New Year’s Eve in the back er David Merrick and Ethel Merman, who production may be “the most serious
Meanwhile, Johnny Cash had come to lis- regional theater stab at this point,” says
ten to Perkins; he grabbed a guitar, too. seat of a Cadillac. Williams, cited by Bob starred in the original version. With a book Cornell. 

In the middle of the jam, Phillips called Dylan as a major influence, is known for by Arthur Laurent and music by Jule Styne,
the local paper’s entertainment writer. He
hits including “Hey Good Lookin’” and “I’m the musical launched songwriter Stephen

So Lonesome I Could Cry.” Sondheim’s career and has always been

Key in the Vero cast is David Lutken; he considered one of Broadway’s greatest. Riv-

co-created and performed in “Woody Sez” erside hasn’t staged it for “a million years,”

at Riverside as well as in the original Broad- says Cornell, but when he saw the movie

way cast. “He’s an old friend and one of the version on TV last year with Rosalind Rus-

most talented acting musicians I’ve ever sell, his favorite Rose, it sparked his interest

known,” says Cornell. “If anyone can find to stage it again. “Gypsy” will be directed

the truth in Hank Williams’ music, he can.” and choreographed by Riverside veteran

Cornell says so far, it’s the stripper’s Jimmy Brennan.

story that is reeling in the reserved seats. The other big seller so far is “Mama Mia!”

Never mind that the strip-teasing in And that is likely not because it appeals to

“Gypsy” was a century ago; the musical, men; its chick shtick has driven droves of

based loosely on the 1957 memoir of Gyp- women to see it in both stage and film ver-

sy Rose Lee, is regarded as one of the all- sions.

LyricTheatre.com 772-286-7827TICKETS AVAILABLE ONLINE, BY PHONE AND AT THE LYRIC BOX OFFICE!

6 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | PEOPLE www.stlucievoice.com

TEACHERS NEEDED INDEFATIGABLE AUTHOR TACKLES
WIDE RANGE OF ARTISTIC PURSUITS
For A+ Rated School
BY SHELLEY KOPPEL | Staff Writer
Somerset Academy St Lucie [email protected]

& Lydi Pallares is almost 80 years old but
she has more energy than those around
Somerset College Preparatory Academy her.

K-12 educators are needed at the Somerset Academy A dyslexic who types with one finger, PHOTO COURTESY OF LYDI PALLARES
St. Lucie (SASL) & Somerset College Preparatory she has written a book of poetry about
Academy(SCPA). addictions and has just finished a book playing with me. We had fun and I nev-
about the cosmos. She holds several pat- er won. He was considered a genius way
We want you to be a part of our talented team! SASL & SCPA is ents for lingerie designs she did for Per- back then. We went to the Yerkes Obser-
a rapidly-growing organization that offers our teachers and staff ma-Lift, has run many marathons and vatory and I got to see the Andromeda
members the excitement of exploring an emerging concept in was featured in Sports Illustrated maga- Galaxy. It affected my whole thinking.
education. Daily, our talented teachers and staff experience the zine’s “Faces in the Crowd,” for breaking My next book of poetry is ‘A Cosmic Col-
impact they make on the lives of children. Join us, and be inspired the record for the 100-kilometer run at a lage.’”
by the potential of our students. AS A TEACHER, YOU WILL race in Miami and posting the fifth-best
ENJOY... Leading students through successful course completion time ever by a woman. She sells prod- For the book on addictions, Pallares
Building an environment conducive to learning Prioritizing student ucts featuring snippets of her poetry on found a husband and wife who took her
needs so that each child may reach their fullest potential Partnering the website Zazzle. It should surprise no poetry, poor typing, misspellings and all,
with parents and colleagues to manage course goals, curriculum, one that she was named Ms. Moxie in the and became her editor and publisher.
and materials that best benefit the individual needs of each student. Florida Senior Pageant of 2016.
Creating strategies to engage and nurture student learning and Writing is not Pallares’ only artistic en-
student relationships Promoting creativity and excitement in the Tiger Lydi, as she styles herself, joined deavor. She is a painter and she showed
learning environment AA 33 years ago. “I was grateful it got me her art as her talent in the senior pageant.
back on sobriety,” she said. “I decided to She is working on a painting about the
WHO ARE WE? help others in a different way. I started my solar eclipse. Ever the entrepreneur, Pal-
book 20 years ago.” lares will introduce “Cosmic Collages”
Somerset Academy St. Lucie (K-5) & Somerset College Preparatory on the Royal Caribbean Oasis of the Sea’s
Academy( 6-12) located in vibrant and scenic Saint Lucie West in That book, “Addictions A to Z: Alphabet Aug. 20 cruise to see the solar eclipse Aug.
Port St. Lucie, Florida (St. Lucie County). Our A-rated school is a Soup Bowl,” is a book of poetry that be- 21. Pallares has written several poems for
tuition-free, public charter high school of choice open to all students gan dealing with alcohol and then other the event. She will give poetry workshops
residing in St. Lucie County in Florida. forms of addiction. Every chapter starts and will also introduce art done for the
with A and runs to Z. It is the result not occasion.
Our school opened in August 2012 with 120 9th graders, adding only of her desire to help people with ad-
10th grade in year two, 11th grade in year three, and 12th grade dictions, but of her love affair with poetry. Lydi Pallares’ book, “Addictions A to Z”
in year four. We are searching for Highly Qualified teachers who is available at www.lulu.com/spotlight/ti-
are committed to improving the educational opportunities for our Pallares always felt at a disadvantage ger_lydi 
students. in school because of her dyslexia. She
failed fourth grade and was bullied in her
Our school this year to include K-8. We are now a K-12 school hometown of Toledo because of learning
and more than doubled in sized. disability. Then, in the fifth grade, she
discovered poetry. Poetry gave her a way
to express herself and she won an Ohio
state poetry contest. After she graduated
from high school, she attended the Art In-
stitute of Chicago, which was connected
to the University of Chicago for academ-
ics. She met astronomer Carl Sagan when
she dated one of his fraternity brothers
and the two started playing chess.

“Because I was dyslexic, I made wild
moves,” Pallares said. “He said it was fun

Currently Seeking: “Sip ‘N Shop” Trunk Show

K-5 grade level teachers 6-12 Chemistry Browse Tables Vendors -
$10/hr Janitorial 6-12 General Science A Little Bit of Everything - For Everybody
ESE Facilitator 6-12 Social Science
Bus Drivers Part Time 6-12 Math Enjoy Fine Wines & Craft Beers
6-12 English IT Tech Support at Happy Hour Prices!
6-12 Reading
Sat. Aug 19 2pm - 5:30pm FREE to attend
Interested Teachers should contact Erika Rains:
Visit our website for all upcoming events
[email protected]
Including Car Show, Aug. 13

Stuartwinebar.com

872 Colorado Ave., Stuart, FL.

772-320-9039

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | PETS August 11, 2017 7

Bonzo says cheerful Rocky’s one happy camper

Hi Dog Buddies! Forever Family.” lost his job an couldn’t keep me. Mom and Rocky.
“Mom had a German Shepherd for a long Dad (he’s Walter) went to Loxahatchee to see
This week I yapped with Rocky Janke, a me an, well, everything worked out great. I PHOTO: GORDON RADFORD
big, easygoing Goldendoodle who works time. When it went to Dog Heaven and she was just 7 months old.”
with his Mom at a place called Camp Ha- got through being real sad, she decided she “I try to be, speshly here at work. I help
ven. I was thinking, since it was a camp, wanted another dog. But, cuz she’s working “Woof,” I said. “It’s a good thing your niece humans become more responsible. Mom
there’d probly be a lake an, maybe, canoes an here all the time, she ree-lized she needed a and nephews kept that other pooch.” tells ’em it’s their turn to walk me so I can
marshmallows, but there weren’t. It was this pooch who’s more easy-going than a German exercise and Do My Doodie. Sometimes
long building with lotsa doors in a row and Shepherd.” “Fer sure. There was just one tiny problem. they don’t want to. But Mom’s firm. She tells
the office up front. Mom an Dad already had a pet. YumYum. An ’em I’m their responsibility during my walk.
“What DO you do here?” Only Cat. She’s a rescue who’d ruled her for- They also get to learn Patience cuz, as Mom
We knocked. This real frenly lady opened “We help homeless humans who wanna mer home and now ruled her big new home. says, I’m a ‘Potty Dancer.’ It’s just that I hafta
the door, and there Rocky was, tall, giant work and not be homeless. They usually have Well, here I was alluva sudden, this curious find The Right Spot, an it’s not always easy,
paws, thick gold coat an a snazzy red ban- PROBlems, and while they’re livin’ here, they puppy, disrupting her life. I’d sniff her an it takes time. But the humans always come
dana. He came right up for the Wag-and- learn how they can not be so sad an hope- chase her cuz I wanted to play, but she was back feelin’ happier. When Mom’s in her
Sniff. less, how to Plan an Be Responsible, an also Not Amused. It was kinda a cat-tastophy.” office talkin’ to people, I can tell whether
how to get ready to find a job. I’m the Camp they’re Okey-Dokey or not. It’s an Instink. An
“Welcome to Camp Haven, please come Haven Unofficial Therapy Dog. Don’t tell, but “So, how’d you figure it out?” if they’re not, I let ’em know. Not in a mean
on in. I’m Rocky Janke and this is my Mom, I get paid Under the Table. (Mostly snacks an “Mom put YumYum Upstairs and me way, just firm, like Mom.
Lalita.” people food from the residents.) Downstairs. There’s a gate at the top so I
“Woof! That’s very Important work!” I ex- can’t go up. An I don’t wanna, anyway. And “Mom says walkin’ me (she akshully says,
“Great to meet you both,” I replied. “I hafta claimed. YumYum totally doesn’t wanna be anywhere ‘bein’ dragged by an 87-pound Goldendoo-
admit, I was piksurin’ a different kinda camp. “True. Anyway, my human sister Anjali near me. She sometimes peers ominously at dle’) is also good for her. She calls it a Total
I can’t wait to hear all about you, an I appre- saw pictures of Goldendoodles an fell in love me through the banister, when I’m snoozing Body Workout. I like walkin’ with Mom, too,
ciate your time.” with our breed. I mean, who wouldn’t, right? on my couch. ’specially at night, cuz there’s lotsa bunnies
Speshly when we’re pupsters. So Anjali told “Another thing I had to learn: See, me where we live. I like bunnies. Mom hasta
Rocky smiled. “It’s my pleasure. We are Mom and Mom picked out a puppy. It was an this other pooch grew up on a farm. We hold on really tight when I see those bun-
an unusual camp, as you can see. So where s’pose to be for her, but Anjali’s kids Alex, were outside all the time. Didn’t even know nies.”
would you like to start?” He got comftubble Ian an Luke wanted to keep it. Mom was what Inside was. Did Our Doodie outside,
next to me, on the floor. duh-termined to get her own Goldendoodle, too. Didn’t have to ask permission or notify “I imagine she does,” I commented.
so she searched an searched an discovered anybody first. So, when I got to Mom and “My special human friend here is our Pro-
“Well, first off, tell me how you found your a piksure of ME on Craigslist. My owner had Dad’s house, I looked all around an there gram Director Jeremy. He just started taking
wasn’t any ground or handy bushes or any- some really strong medicine called KeyMo,
EXTENDED GROOMING HOURS! thing, nothing that looked like where I usta which he hasta take for a long time (even
Do My Doodie, just a buncha square flat longer in Dog Time). It isn’t easy At All. So I’m
Mon,Tues,Wed, Fri until 6pm, Saturday - until 3pm things. (Later I found out it’s called tile). Well, gonna do my doggonedest to keep him All
I thought that must be where I was ’spose Cheered Up by leaning against him a lot and
PROVIDING EXCELLENCE SINCE 1986 to go. So I did. But it wasn’t. Took me a little stuff like that. An doing a good job helpin’ the
while to figure it out. Mom an Dad helped.” humans who live here.”
A FULL SERVICE VETERINARIAN CLINIC “I expect they did,” I smiled. “What’s life Heading home, I was thinkin’ about how
We at Kelly’s Animal Hospital are the like Downstairs?” Rocky cheers up the humans at Camp Hav-
one-stop practice for all your best friend’s needs: “Fun! We have a big family an when ev- en, and promised myself I’d do an even bet-
erybody’s here it’s real exciting. But I remain ter job cheerin’ up my Very Own Mom when
• Computerized state of the art facility, Patrick A. Kelly, D.V.M. calm. When things get too loud, I go some- she’s feelin’ Gloomy.
with 4 large exam rooms Jessica Khodadad, D.V.M. where quiet, like my couch. I even have a Till next time,
blanket with big paw prints on it, like mine.
• Digital radiography I also enjoy restin’ in the shower, cuz it’s nice The Bonz
• Cancer medicine an cool.
• Affordable vaccine packages “On my leash walk, sometimes little dogs DON’T BE SHY!
get scared cuz of I’m lots bigger. So I scooch We are always looking for pets
available way down for the Wag-and-Sniff.” with interesting stories. To set
• Wellness plans from all stages of life “That’s thoughtful,” I commented.
up an interview, email
for dogs & cats. [email protected]
• Fully stocked pharmacy
• In house laboratory which allows us

to do most blood- work in house
and have results in 30 minutes

772.336.8111 150 NW CENTRAL PARK PLAZA
• PORT ST. LUCIE

visit our website @ www.kellysanimalhospital.com

Hours: Monday 7:30-8:00 • Tuesday 7:30-8:00 • Wednesday 7:30-8:00
• Thursday 7:30-5:30 • Friday 7:30-8:00 • Saturday 8:00-4:00 • Sunday - Closed

8 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | PEOPLE www.stlucievoice.com

Neon will be on at ‘Glow for HANDS’ party not-for-profits. The Jewelia Project partici-
pant got the idea for a black light neon party
BY PATRICK McCALLISTER | Correspondent drinks, music. And? book tells the true at a recent wedding. The marrying couple
“We do have a lot of good raffles and si- decided to have a neon wedding reception.
Jennifer Wiggins is lighting up St. Lucie story of a California It was right up Wiggins’ alley.
West. lent-auction items,” Wiggins said. Includ-
ing a Caribbean cruise to raffle off. woman who got 12 “For me to have to sit still at an event,
Wiggins is The Jewelia Project’s Ms. Au- that’s boring to me,” she said.
gust. Part of the honor is coming up with “We have a painting booth, so people can others to go in with
a fundraiser for HANDS, a local not-for- get painted on to glow in the dark.” Upcoming Jewelia Project honorees are
profit that provides healthcare services for her on purchasing a Gail Fleshe, September; Veronica Tempone,
low-income residents. So, what’s Jewelia have to do with that? October; Maria Seidel, November; and Pa-
After all, Jewelia is a $12,500 necklace creat- $37,000 necklace on mela Tempone, December. Each will have a
“It’s a glow-in-the-dark party,” she said. ed by jeweler Greg Alan Childress, owner of unique fundraiser.
“Our Title is ‘Glow for HANDS (of St. Lucie G. Alan Fine Jewelry & Coin in Fort Pierce. the agreement they’d
County).’ It’s a dance party, but the whole Well, there’s an interesting story about it. At press time, about 100 have signed up
room is going to be black light and neon.” share it. The experi- for the neon party. Wiggins said tickets
In 2015, Sydney Leibman, director of won’t be sold at the door, but people have
There’ll be food and drinks at the party. fund development at HANDS, called sev- ence changed their until the day of the event to sign up online.
DJ Liv2Party Entertainment will spin the eral women to a meeting. She had an inter-
songs. The song selection is going to make esting offer. The women could wear Jewelia lives and inspired The party will be this Saturday, 6 p.m. to
many feel like they’re back at their high for a month each, but they had to commit to 10 p.m. at the St. Lucie Trail Golf Club, 951
school prom. “Anything before 1995,” Wig- raising at least $1,000 each during that time. them to give more. SW Country Club Dr. It’s open to those 21
gins said. “The age group we have, this is and older. Participants are urged to wear
the music they grew up with.” “The Necklace: Thirteen Women and the Wiggins is CEO Jennifer Wiggins. white and neon colors, to maximize the
Experiment That Transformed Their Lives,” of Clear SEM Solu- glow effects.
So, black lights, neon highlights, food, by Cheryl Jarvis, inspired the idea. The PHOTO COURTESY JENNIFER WIGGINS
To sign up or learn more about the Jewelia
tions, an online marketing company. Her Project, visit www.thejeweliaproject.org. 

husband, Chris, and she moved to Port St.

Lucie nearly by accident about six years

ago. The couple got off the wrong exit when

house hunting for a place in Florida. The

two loved PSL, moved here from North Car-

olina, and quickly got to work helping area

Daily Lunch Specials Diamond
Tea Room &
FINE ITALIAN FOOD
Bistro
MONDAY & TUESDAY Sun. & Mon. EVERY THURSDAY
YES WE ARE A RESTAURANT TOO! Come
18” Cheese $800 KIDS EAT FREE TRIVIA NIGHT! visit, have a glass of wine or cup of Tea or coffee
Pizza or even a fine six course, High English Tea lunch
One free child’s meal 7PM-9PM and view our beautiful custom designed, one of a
with coupon with each adult entrée. kind pieces of jewelry for that one of a kind person
below. HAPPY HOUR in your life. Or bring in a picture of your favorite design
Kids choose from: ALL NIGHT or subject and I will make it for you.
WEDNESDAY Kids Spaghetti Diamond Tearoom & Bistro has a selection of 33 fine teas. We offer something
ON HOUSE WINES for every taste with classic teas from England to the spice of the orient.
18” Supreme $1400 & Meatballs & DOMESTIC BEERS
Pizza $600 Whether it’s a power-lunch for ten or a wedding party of 50, Diamond
Dozen Garlic Chicken Fingers Tearoom & Bistro offers the perfect, intimate space for you
Knots
Mac & Chesse We take Great pride in arranging a custom tailored menu to fit
your theme, your timetable, & your vision.
Fettuccine Alfredo
Call And Leave Message For Reservations
Kids Make Your
Own Pizza Country Club Plaza
3868 SE Dixie Hwy • Stuart
Check Out Our Daily Specials FREE DELIVERY
772-781-1133
LARGE 18” EARLY 3PM-6PM FREEBUY ONE Hours: Tues, Wed. Thurs.
Choice of
$800CPHIEZESZEA BIRD 13 Entrees — ENTREE — & Fri. 10am-5:30pm
Monday & Tuesday With this coupon. includes Soup www.diamondsbyterry.com
Not to be combined with any other offers. GET 2ND UP TO $14.00 VALUE www.diamondtearoom.com
Dine-In or Take-Out Only. Expires 8-18-17 $ 99 or Salad, Garlic
Rolls, Coffee & Mon., Tues. & Wed. w/beverage purchase Only! Bistro 1-772-781-5153
1/2 SUB 14 Dessert
WITH Not for Take-Out or Delivery. Veal Not Included
FRENCH FRIES BUY A LARGE 18” PIZZA Dine-In Only. Not to be combined with any other
offers or daily specials. One coupon per order
$ 99AND A SOFT WITH TWO TOPPINGS
DRINK per person. Expires 8-18-17
GET A 12” CHEESE PIZZA
5(LUNCH ONLY) $LUN9C9H SPECIALDINE-IN
FREE
With this coupon. Not to be combined with any 5 ONLY
other offers. Take-Out Only. Expires 8-18-17 With this coupon. Not to be combined with any 2 SLICES OF
other offers. Take-Out Only. Expires 8-18-17 PIZZA

1 TOPPING
& BEVERAGE

11:30AM TO 4PM

With this coupon. Not to be combined with any
other offers. Take-Out Only. Expires 8-18-17

WE CATER 10472 SW Village Center Dr, Port St Lucie
(Tradition Sq in Publix Plaza)

Hours: Sun. 11:30AM - 8PM • Mon.-Thurs. 11:30AM - 9PM

772-345-0500• Fri. & Sat. 11:30AM - 10PM

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | DINING August 11, 2017 9

All our Seafood comes Fresh from DSFeelrrievveiecrey*
New Bedford Mass!!

Pasta • Salad • Ipswich Steamers • Oysters
Lobster Rolls • Belly Clams

Chef Bernard

Oyster Basket Ristorante

$13.50 Check Out Our New Menu!
reg. $15.50
Exp. 8/31 Locations: The Best Pizza on the Treasure Coast!

Fried Shrimp Basket 4595 Northlake Blvd, 962 SW Saint Lucie West Blvd, Chef Ryan & 30” EXPERIENCE
Palm Beach Gardens Port Saint Lucie Owner Jeremy THE LARGEST
$10.00 561-622-2259 772-871-5533 PIZZA IN SLC.
reg. $12.00
Exp. 8/31 181 N US Highway 1, 860 SW Federal Hwy, Enjoy 5 Star Dining at Affordable Prices
Tequesta | 561-406-5000 Stuart | 772-219-3340
Beer & Wine Available
www.lolasseafood.com
• Appetizers • Salads • Pasta Dishes • Calzone’s & Stromboli’s • Subs and more
Summer
You like Seafood? We got Seafood!
Prix-Fixe
Must be seated by 6pm 7 days! First course: Mahi Mahi over Risotto • Seafood Risotto
$1595per person Zuppa Di Pesce and Linguini with Red &
Every day starting at 2 pm. Must be Choice of: Soup of the day,
House Salad or Caesar Salad white Clams • Mussels and More!
seated by 6:00pm Menu not available
on Holidays or Specials Events ENTREES (choose one):

WEDNESDAY Rigatoni a La Cremini, Shitake, and chicken, sautéed in WEEKEND & DINNER SPECIALS DAILY!
Aug. 16TH Vodka Portobello mushrooms, a sweet Marsala and
with Asiago cheese and mushroom sauce Enjoy our Famous Italian Dinner Bread
Wine & Dine Rigatoni tossed with white truffle oil Egg Plant Rolitini and Penne Ala Vodka
prosciutto, peas, and Salmon Piccata
A 5 Course Chef Tasting mushrooms, finished in Chicken FREE APPETIZER
Dinner & Wine Pairing a vodka cream sauce Florentine Grilled salmon, topped
Wine: Jackson Family Estate with capers, artichokes, Get one Free appetizer with any entree purchase
Eggplant Thinly-pounded chicken sun-dried tomatoes, and of equal or lesser value. Only one coupon per
6pm Seating, Reservations Required Rollatini topped with spinach and mushrooms, in a white table - Dine in only. Expires 8-18-17
goat cheese, served in a wine lemon herb sauce
Regular Menu Always Available Two pieces of eggplant, sherry wine sauce $10 OFF EARLY BIRD
Private Parties & Special Functions stuffed with Ricotta, Lasagna SPECIAL!!
topped with melted Chicken w/ purchase of $35
Accommodated! Mozzarella in a San Parmigiana Handmade pasta sheets or more w/coupon
Marzano tomato sauce layered with Sunday
Breaded chicken cutlet meat sauce and Mozza- Not valid on holidays or
Spaghetti and topped with melted rella Cheese. with Specials Offers.
Meatballs Mozzarella cheese in a
San Marzano tomato Chicken Italia Expires 8-18-17
Home-made meatballs sauce
tossed with spaghetti in Stuffed with broccoli
a San Marzano tomato Chicken rabe, fresh mozzarella,
sauce Francese and roasted peppers
topped with a marsala
Cheese Egg-battered chicken, glaze
Manicotti finished in a white wine
lemon herb sauce Rigatoni
Pasta stuffed with Bolognese
Asiago, Mozzarella, and Pork Chop
Ricotta cheeses, topped Veal, Pork, and Beef
with San Marzano 10oz center cut chop, with san marzano
tomato sauce breaded and topped tomato sauce tossed
with a MarsalaDemi with rigatoni pasta and
Wild Mushroom glace sauce ricotta
Risotto
Chicken 4pm - 6pm Everyday
Arborio rice, tossed with Marsala
Any 2 Pasta Dinners
Thinly-pounded

Live Entertainment 9pm to Close Plus 1 bottle of HS Wine
on Patio

Fri. Aug. 11th Sat. Aug. 12th 35$ 99
Curtis DJ
Hill Louie G Only
Dine in only. Not valid w/ any
HAPPY HOUR other specials. Expires 8-18-17
2:00 pm - 6:00 pm Daily
NEW HOURS Delivery to St Lucie West
$3.75 Well Liquor Cocktails $2.00 Domestic beers Sun. - Thurs., 4pm - 9pm go on-line to
$3.75 Copper Ridge house wines • Budweiser Fri. 4pm - 10pm • Sat. 11am - 10pm
• Bud Light For Delivery To Tradition
$5.00 New Amsterdam Vodka • Miller Lite Special or Catering Orders Call Labby’s
can be fulfilled w/ one day notice
$5.00 Bacardi Rum • Coors Light
• Yuengling
$5.00 Tanqueray Gin • Michelob Ultra
$5.00 Jack Daniel’s Whiskey • Coors Cutter

$5.00 Dewar’s Scotch (Non-alcoholic) Call 344-4748

$3.00 Import Beers (Just 3961 S.W. Port. St. Lucie Blvd
• Corona • Corona Light • Heineken • Stella Artois North
of Paar) *Delivery to 34987
• Peroni • Amstel Light

9501 Reserve Blvd. • St. Lucie West • 772-464-8988 • www.tuttofrescopsl.com

10 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | DINING www.stlucievoice.com

Beautiful Water Front Dining WATERCREST AWASH IN COMMUNITY UNITY

FREE MENU ITEM! Watercrest St. Lucie West recently honored Keiser University massage therapy
Enjoy One FREE Menu Item with the purchase of a students with West End Grill Certificates for giving back to Watercrest with
second item of equal or greater value. Dine-In Only wonderful massages to their residents and family members. Diann McDonough,
(Up to a $10 value) Expires 8-18-17 w/Ad Watercrest Community Relations Director, presents the certificates to Carole
Rifflard and Ross Hoffman, message therapy instructors at Keiser University. 
“Daily lunch & Dinner specials”

Happy Hour Tues-Fri
4pm-5pm

121 Early Bird
121 Melody Ln. Fort Pierce Sunday

4pm-5:30pm

Tues - Thurs 11am-10pm
Fri & Sat 11am-11pm
Sun 11am-9pm

772-781-0943

MCAhGaigkrcaeikniaengtn!! 1 FREE APPETIZER!

Fried Chicken, Chops & Waffles With Entree Purchase
*The Wings*
10 Whole Wings (Chicken Only)……..…$22 W/1 Large side $25 Platter 1 coupon/table, Not valid w/any other offers.
20 Whole Wings (Chicken Only)……..…$35 W/1 Large side $38 Platter 3 Whole Wings Special $6 Expires 8-18-17
……..Add Mini Waffle $8
Hand-Cut Steaks AND...
Game Time Wing Platter 50 whole
“Just Plain Good Food!”

Made From Scratch...

Daily!

Delivery Now Available

*The Funky Platters* wings & 2 Large Sides $100

P1 - 3 Whole Wings & Waffle......….$12 P4 - ¼ Chicken Dark (leg/thigh) & Waffle………….…….………….......$12 Daily Specials at the Bar!
P2 – 2 Drumsticks & Waffle.....…......$12 P5 - Chicken Breast & Waffle (Grilled or Fried)….…………………..…$12
P3 - ½ Chicken 4pieces & Waffle....$20 P6 - Bone-in Center Cut Pork Chop & Waffle (Grilled or Fried)….$14

Individual Single Waffles $6.00 • Individual piece price: Whole Wing=$2, Leg =$3, Breast=$5, Our Popular Bar Burger $3.59 Bar Chicken Tenders $4.99
Thigh=$4, Pork Chop= $6

SUNDAY with lettuce, tomato, onion, served with honey mustard
pickles, and fries dressing and fries

Shrimp Basket $6.99 Fried Ribs $6.99

with fries with fries

Bar Chicken Sandwich $3.99 Four Potato Skins $4.99

*The Funky Sides* with lettuce, tomato, and fries with fries

Waffle Fries, Collard Greens, Green Beans, Mac & Cheese, Fried Pickles with fries $3.99
Sweet Potato Fries, Corn on the Cob, and Mashed Potatoes
SPECIAL Bar Specials Not Available For Takeout.
Sides: Reg. $2.00 Lg. $3.50
Coca Cola
*The Entrees* Fountain Drinks $2

E1- 3 Whole Wings 2 Reg sides.....................................……………..……...…..…$10 Sweet Tea $2
E2 – 2 Drumsticks 2 Reg. sides……………………………………….……………….$12
E3 – ½ Chicken 2 Reg. sides…...…..…………….………………...……..….…..…….$20
E4 – ¼ Chicken 2 Reg. sides.…..………...………………..........................................$12
E5 – Chicken Breast (Grilled or Fried) 3 Reg. sides..…....………...…...........$12
E6-Bone-in Center Cut Pork Chop (Grilled or Fried) 3 Reg. sides…..… $14

EVERYDAY SPECIAL!!!
$5 Wing Things!

4 Wings and Mini Waffle or Waffle Fry Only $5 all day, everyday! Choice
of sauces, Creamy Buffalo, Honey Mustard, Barbeque or Naked.

OPEN 11:30 - 9:30PM TUES - SAT • NOON - 4PM SUNDAY

772-301-1839

1184 S.E. Port St. Lucie Blvd, PSL (The old Tutto Fresco location on PSL Blvd.)

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | COMMUNITY August 11, 2017 11

‘Dad the Mom’ author speaks to, inspires teens at Boys & Girls Clubs

Young people need to work toward ca- “I got a lot out of this presentation,” said vice president of development. dadthemom.com, a website on which he
Miller, who also is a Realtor, is the author discusses such issues as child entitlement
reers they are interested in and passionate Tyrell, one of the teen members of BGCSLC. and parenting tips. 
of “Major Lessons for Minors,” based on his
about, Chad Miller, author of “He told us that in business, we own life experiences. He also runs www. ­– CONTRIBUTED

“Dad the Mom” recently told need to provide good customer FRESH FRUIT AMAZING
ENTRÉES DAILY
more than 30 teenage mem- service and focus on making
AVAILABLE! SPECIALS!
bers of the Boys & Girls Clubs the client happy, and not just

of St. Lucie County. on making money.”

Miller, who lives on the “It’s always great to have

Treasure Coast, conducted two guest speakers talk with our

talks on the responsibilities in- youth. Chad was able to real-

volved in becoming an adult, ly connect with our teens and

including the importance of provide useful advice. We look

having great character, pursu- forward to using his book, ‘Ma-

ing an education, and saving Author Chad Miller. jor Lessons for Minors,’ as an

money. He used his life experi- opportunity for our teens to learn

ences to provide lessons that both inspired even more. After hearing Chad talk they are

and informed. all excited to read it,” said Maygan Johnson,

CULVER’S IS TASTY Simply Delicious!
NEW OPTION IN PSL
$10 OFF Buy 1 Order Buy 1 Ny Steak
Homemade Hashbrowns or
Blueberry pancakes grits, 2 eggs, choice
with purchase of $30.00 or Receive 1 FREE! of pancakes or toast
The wait is over: Culver’s of Port St.
more Cannot be combined Dine In or Take Out Dine In or Take Out
Lucie is now open. Culver’s is known for with any other offer.
No Purchase required, one
its famous ButterBurger and fresh frozen No Purchase required, one

custard; the restaurant serves fast casual Expires 8/31/17 SLV person one order. Expires 8/31/17 person one order. Expires 8/31/17

food cooked-to-order. “Your Full Order Famous Buy 1 Buy 1 Spinach
Full-Service Cinnamon Swirl /Feta Omelette
The restaurant is located at 10770 SW 99¢Buttermilk French Toast
Salon” Receive 1 FREE! with hashbrowns, grits or fresh fruit
Tradition Pkwy. Hours of operation are 10 Pancakes , pancakes or toast Receive 1 FREE!
Hair Stylists • Colorists
a.m. to 10 p.m. every day, with the excep- Hair Texture & Nail Technicians
All Chemical Services Include Style
tion of a few holidays. Dine In or Take Out Dine In or Take Out Dine In or Take Out
Specials*
“We are thrilled to bring handcrafted, No Purchase required, one No Purchase required, one
• Haircut & Style,
high-quality meals and desserts to the No Purchase required, one
$35.00
community of Port St. Lucie,” says own- person one order. Expires 8/31/17 person one order. Expires 8/31/17 person one order. Expires 8/31/17
• Haircut, Gloss & Style
er/operator Gerald Smith. “We think it’s a
$45.00
wonderful area and we are excited to be-
• HiLite Lowlite Special
come a contributing and active member
$75.00 Partial
of the community of Tradition and the
*New Clients Only
great growing city of Port St Lucie.”
398.8300
“My wife Susan and I are relocating
1006 Port St. Lucie Blvd. • Port St. Lucie
from Chesterton, Indiana, a small rural

community in Northwest Indiana,” says

Smith. “We look forward to meeting and Monday - Sunday • 6am - 4pm • Open on All Holidays

welcoming the community to Culver’s to 6643 Okeechobee Road • 772-242-1827
(Next to Red Lobster, in Between I-95 & Turnpike) Formerly on US 1
enjoy friendly hospitality and fresh qual-
DINE-IN • TAKE-OUT • BREAKFAST CATERING
ity food.”
OPEN ALL HOLIDAYS!
Culver’s signature sandwich and

guest-favorite, the ButterBurger, is made

with 100 percent fresh, never frozen, U.S.

beef made cooked-to-order and topped

with a lightly buttered and toasted bun.

Culver’s Fresh Frozen Custard gets

its legendary creamy decadence from

high-quality, fresh Wisconsin dairy from Solutions from Games Pages
in August 4, 2017 Edition
which every batch is crafted throughout ACROSS DOWN
7 LISTEN 1 HIGH
the day. In addition to making their own 8 EMPLOY 2 STONES
9 SHINBONE 3 SNOOKER
creations, guests can customize their 10 EVEN 4 SEVER
11 DRESSER 5 SPHERE
desserts with more than 30 mix-ins and 13 DECOR 6 FOREWORD
15 SPEAK 12 REPORTER
toppings. Every day Culver’s offers three 17 OUTSIDE 14 CUSTARD
20 FRET 16 ASTUTE
flavors of frozen custard: vanilla, choco- 21 INTEREST 18 STRIVE
23 GENTLE 19 FILES
late and a Flavor of the Day. 24 REVIEW 22 STEM

Connect with Culver’s of Port St. Lucie

via eClub and Text Club. Sign up via www.

culvers.com/connect and look forward to

delicious discounts, coupons, menu news

and a special treat for becoming a mem-

ber.  Sudoku Page B12 Sudoku Page B13 Crossword Page B12 Crossword Page B13 (MAIM THAT TUNE!)

­– CONTRIBUTED

12 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | GAMES www.stlucievoice.com

SOLUTIONS TO PREVIOUS ISFSOURES(OALUUGTUISOTN4S), OSENEPPAAGGEEBB1511

ACROSS DOWN
7 Illusion (6) 1 Boring (8)
8 Charm (6) 2 Conflict (6)
9 Trial (4) 3 Small falcon (7)
10 Riches (8) 4 Fables (5)
11 Eternally (7) 5 Go after (6)
12 Disorganised (5) 6 One-tenth of a decade (4)
15 Barrier (5) 13 Bones (8)
17 Soft toffee (7) 14 Light (7)
20 Game bird (8) 16 Talkative (6)
22 Quarry, target (4) 18 Seem (6)
23 Fort (6) 19 Committee (5)
24 Cause (6) 21 Warmth (4)

The Telegraph

EVJAEZNZTS How to do Sudoku:

Fill in the grid so the
numbers one through
nine appear just once
in every column, row
and three-by-three
square.

JAZZ JAMS

SUNRISE THEATRE’S
BLACK BOX

117 S. 2nd Street, Ft. Pierce
Full Bar available • 7-10PM
$7 Cover, Member $6
TUESDAYS

Aug. 22 • Sep. 5, 19 • Oct. 3, 17, 31

PORT ST. LUCIE
BOTANICAL GARDENS

2410 Westmoreland Blvd., PSL

6:30 -9:30PM

$6 Cover, Members $5

WEDNESDAYS
Aug. 16, 30

Sep. 13, 27 • Oct. 11, 25

For more information, and/or updates go to: www.jazzsociety.org

The Fort Pierce Jazz & Blues Society is dedicated to its mission of keeping two
great American music art forms alive in our communities and schools through

Jam sessions, concerts, festivals, master classes and scholarship awards.

See you there! Web: www.jazzsociety.org The Telegraph
Email: info.jazzsociety.org
For more info, contact Phone: 772.460.JAZZ (5299)

the FPJ&B Society.

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | GAMES August 11, 2017 13

ACROSS 61 Criticizing as 12 Pride of Mr. 71 Marks with
worthless Universe chimney dirt
1 One who
makes and sells 63 Medical grp. 13 Hosp. unit 73 Smug one
fashionable 64 Summer ermine 14 Cousins of ant 74 Russia or Idaho
dresses and 66 Signs up for
hats for women 67 Fabric store lions city
15 Levin et al. 77 Straight talk
8 Irritable bargains 16 Ending for black, 80 Unfruitful
19 From within, in 72 Like card tables 81 Waist nipper
74 Simple brown, or burn 83 Woman of the
Latin 75 Setting of Martin 17 Beneficiary of a
20 Singer who Doones
Scorsese’s After lawsuit, at times 84 With 90 Down, A
survived the 1906 Hours 18 Plants grass
San Francisco 76 Misjudges, in a 20 Whole Different World
quake way 22 Erased actress
21 Gluey 77 No basis for 24 Vergil verse 85 Nervous moment
22 Short on discrimination 26 Shots (at) of silence
schooling 78 Vincent’s brother 27 Principle 86 A bettor opening
23 Roman emperor 79 Chuck Yeager, 29 TV host Perkins 87 Foreign-wd. type
who saw a e.g. 88 Golfer Tom
flaming cross in 80 Washing-up pot and 89 Certain bass note
the sky 81 Making ex-White House 90 See 84 Down
25 Double-curve crosswords, aide Fitzwater 92 The pauper, not
shapes for one 30 Whirled, as water the prince
26 Reenacts 82 Maturing agent 31 Frigg’s hubby 93 “Give Peace A
28 No smoking in the 83 Knight’s weapon 33 Mountainside Chance” video
office, for example 84 Supports a kid? debris participant
29 Manx thanks 85 17-syllable poem 34 The Wizard of Oz 94 Casablanca’s
32 Sea swallows 89 Appellation in lyricist country: abbr.
33 Dorm sound Handel’s Messiah 35 Heavily satirical 96 Werner Erhard’s
34 Claimed, in a way 91 Announcer’s 36 “And he was self-awareness
39 Followers of The signoff never ___ heard program of the
King 95 Shoe parts from again” 1970s
40 Director’s cut? 98 Deejay employer 37 Prophet at Delphi 97 Peter, Paul, and
41 Ornamental flower 99 Appear, to 38 ___ lion, beast Mary: abbr.
stand Shakespeare slain by Hercules
42 Symbol of 100 Star of Show Boat 40 Music for 7 The Washington Post
redness on stage and 41 Actor Curt
43 Railroad that screen 44 Radial, e.g. WORDCURRENTS By Merl Reagle
Jay Gould 101 Certifies 46 Un ___ (a little)
and Cornelius 47 32-quart units Do You Miss Your “Tin Fish” Fix?? WHEIXLECWUSEEPROLEUENAROSVMEAETSES
Vanderbilt fought DOWN 50 Recommended
over choice WE’RE STILL OPEN!
44 Group that slides 1 Dallas player, 51 Talk loudly
stones on ice at for short 53 Lopped lousily 327 SE Port St. Lucie Blvd.
the Olympics 54 Chant
45 Sharpened, as a 2 Part of Alec 55 Viragoes Our sign is temporarily down, but we are on the NE corner of
razor Guinness’s name 56 Alpine home PSL Blvd and Airoso Blvd in the Lakeside Shopping Center.
47 Ken’s friend in Star Wars 57 Broom room
48 Inasmuch as bigwig The Original Tin Fish in the State of Florida!
49 Hiver opposite 3 Rummy player, 59 Boris * Family Owned & Operated * Daily Specials
50 Wine region often contemporary * 130 Indoor Seats * Over 65 beers to choose from
52 The Big Easy, in 62 Kind of real estate * Wednesday Nights Trivia @ 6:30 pm
shorthand 4 Under an alias deal, * Live Music Thursday - Saturday 6 pm - close
53 Error 5 Slingshot missiles for example
57 Court cutups 6 Tie (up) 63 Wading bird
58 A Walk on the 7 From Eden to Nod 65 Waterproof cover
Wild Side author 8 Robert Frost 67 Disaster aid
Nelson 68 1992 GOP
60 Barometer unit poem, convention site
Fire ___ 69 Credit union
9 The Council of promise
___ 70 Larceny
10 To laugh, to Lalo
11 Bandage maker

The Telegraph Directions From Tradition - East on Gatlin Blvd. - lEft at Port st. luciE
Blvd. to just Past airoso Blvd - on lEft in lakEsidE shoPPinG cEntEr

772-879-3900

See Our Menu at Tinfish-psl.com

14 August 11, 2017 ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | GAMES www.stlucievoice.com

NORTH

ALWAYS COUNT LOSERS AND WINNERS A63

Alan Stein, a basketball coach and fitness trainer, said, “A winner works hard to achieve K 10 8
success. A loser works hard to find a shortcut.”
52
At the bridge table, a winner works hard to count winners and losers. In most trump-suit
contracts, counting losers is best; on others, tallying winners makes it easier to see the AJ874
right line; but on all deals, it is optimum to do both.
WEST EAST
In this deal, how many losers and winners does South have in four hearts? How should he KQJ9
play after West leads the spade king? 62 10 7 4
A 10 7 4
In the auction, I think North was right to start with a takeout double. Yes, if South does K52 5
not have a five-card or longer major, a two-club overcall could work out better, but that
aims at a small target. The double is more flexible. East’s jump to three diamonds was KJ983
pre-emptive. With at least a limit raise, he would have responded two no-trump. (Note that
some pairs invert these meanings over a minor, so that if the opening side has the values Q 10 9 6
to try to make three no-trump, the stronger hand, the opener, will be the declarer.) South
bid what he hoped he could make. SOUTH

Declarer could see four losers (two spades and two diamonds) and nine winners (one 852
spade, seven hearts and one club). His only chance was to establish dummy’s club suit
so that it would provide a 10th trick. However, he needed all three of dummy’s trumps as AQJ9743
entries. The play went: spade ace, club ace, club ruff, heart to dummy’s eight, club ruff
high, trump to dummy, club ruff, heart to the king, cash the club jack (discarding a spade Q6
or a diamond), claim. Success!
3

Dealer: West; Vulnerable: Both

The Bidding:

SOUTH WEST NORTH EAST OPENING
4 Hearts 1 Diamonds Dbl. 3 Diamonds
Pass Pass Pass LEAD:
K Spades

Clocks Make It’s Back To School Time - 7 DOAPYESN!
Wonderful Don’t Be Late!

Family Are Your Watches & Clocks In
Heirlooms Good Working Order?

We Make House Call Us For Complete Fast Service
Calls For
30% Off
Grandfather Silver
Clocks
HURRY SALE
ENDS SOON! Six Packs are Back

Specializing in Fine Watches For Two Days Only! 8/12 & 8/13

• ROLEX • OMEGA • TAG 6 Plays for $174 + Tax

• CITIZEN • SEIKO WE BUY GOLD! DON’T MISS OUT! Use Anytime before 12/20/17.
AND MORE! Includes Cart & Range Balls. Limited Quantity Available

THE WAT CH & J EWELRY CURRENT 25$ ALL DAY
RATES ANY DAY
NOW AVAILABLE!
Expires 8/30/17 FUN FOR ALL AGES
CALL TO RESERVE
HOSPITAL YOURS TODAY!

MARIO STEISEL CERTIFIED LUNCH & DINNER WITH FULL BAR AVAILABLE

Your Trusted Source for Watch, Clock and Jewelry Repair. ROLEX WATCHMAKER VOTED THE BEST LOCAL GOLF COURSE FOUR YEARS IN A ROW

1680 ST LUCIE WEST BLVD. STE 104 CALL US TODAY AT 772‐286‐2113

www.watchandjewelryhospital.com 772.343.9411 To book your preview round and see for your self why The Evergreen Club is your perfect golf‐get‐away.

Home of the Kevin Perkins Golf Academy www.theevergreenclub.com

To Advertise (772-559-4187) ST. LUCIE VOICE | ST. LUCIE WEST AND TRADITION | SPORTS/CALENDA R August 11, 2017 15

May’s day! GET CENTERED ON THE SWEET SPOT Kevin’s
Kures
PGA golf club member Marilyn May It probably goes without saying, but strike the shot, you will be able to see the
scored an ace last week at the Wana- golf is an object-to-object game. You have mark on your clubface indicating the exact gling to do that, make the task easier. Strike
maker course, putting a 9-iron shot in to swing the golf club back and forth and spot of contact. small chip shots and short pitches. Once
the bottom of the cup on the 89-yard make solid contact with the ball. An often you achieve solid contact, and now armed
par-3 sixth hole. Congrats, Marilyn!  overlooked fundamental is what we refer to 2. Make adjustments or corrections for with more confidence, move on to longer
as centeredness of contact. In other words, off-center contact: There could be multiple and more difficult shots.
striking the ball on the sweet spot – or cen- reasons for off-center hits. The hands and
ter part – of the clubface, technically called arms are a great source of redundancy and Kevin Perkins is a PGA Master Profession-
the percussion center. The sweet spot is ap- subconscious compensatory moves. What I al. He operates his Golf Academy at The Ever-
proximately the size of a dime and is very mean by that is, even if you make mistakes green Club, has hosted and produced his own
difficult and challenging to find. However, with excessive head movement, improper television and radio shows, and has authored
it is somewhat responsible for a lot of us spine movement or errors in your set up, the golf instructional book “Golf Everyone,”
getting hooked on the game and having so your hands and arms are able to make ad- published by Hunter Textbooks. Perkins may
much passion for our sport. Let’s get into justments for these errors. For example, be reached at 561-301-3783. Email: dkper-
a few “Kures” on how you become can be- if you are hitting the ball off the toe of the [email protected] or visit his website at www.
come more consistent in striking the center club, simply try to swing your arms closer kevinperkinsgolfacademy.com. 
of the clubface: to your body. Or, if you are striking the ball
on the bottom of your clubface, simply try
1. Analyze what part of the clubface you to swing your arms lower as you go through
are striking: This can be done with face the ball. So trying to make the correction
tape, which adheres to the clubface. You with your arms and hands is a good place
can obtain face tape from your local PGA to start.
professional. Another option is to visit your
local drug store and pick up a can of aerosol 3. Make the task easier: There is no other
foot powder. Simply spray a light amount of place that you can get greater confidence
the foot powder on your clubface. After you than hitting the ball solidly, as a result of
contacting the sweet spot. If you are strug-

AUGUST of many benefactors of Kindred’s 13th Annual 11 Summer Splash Party. The St. Lucie 12 Summer Splash Party. The St. Lucie
Food Drive. Food collection bags will be placed County’s Parks and Recreation De- County’s Parks and Recreation De-
11-31 Kindred’s 13th Annual Food at healthcare and other facilities in their re- partment is hosting a free pool party with an End partment is hosting a free pool party with an End
Drive. Staff members from spective communities and will collect their of the Summer Splash. All ages are encouraged to of the Summer Splash. All ages are encouraged
Kindred at Home will be blanketing the Trea- “harvest” during the entire month of August. join us for music, games, prizes and more. 5:30 to join us for music, games, prizes and more. 6
sure Coast area throughout August, distribut- To learn more about Kindred at Home’s ser- p.m. to 7:30 p.m. at the Lakewood Park Pool, p.m. to 8 p.m. at the Ravenswood Pool, 400 SW
ing food collection bags and gathering dona- vices, contact Katherine Howard at 772-223- 5990 Emerson Ave., Fort Pierce. For details, call Ravenswood Lane, Port St. Lucie. For details, call
tions for the Treasure Coast Food Bank, one 2116. 772-462-3772. 772-871-2183.

Island Dunes Enjoy The Island
Country Club Breeze

Ph. 229-2739 Cool rate reductions for August CURRENT RATES Iinlasdln_iHOneigtEh_060917 Ask About Our
From $25 to $15 for 9 holes Frequent
8735 S Ocean Drive From $35 to $23 for 18 holes $25 $20 $15
Jensen Beach From 8am-1pm Player Programs
Before 11 AM After 11 AM After 3 PM
Located on Hutchinson Island, (regular rates apply at 1pm) (All Rates Include Cart and Tax)
3 miles south of the Power
Plant (closed Mondays) Clothing Golf Bags 1600 SOUTH 3RD ST., FORT PIERCE 772-465-8110
Up to Footjoy Shoes
From US1, turn East on Ohio Ave., Directly behind TD Bank
50% OFF 30% OFF

SERVICE DIRECTORY - ADVERTISING ST. LUCIE AND TRADITION SERVICES

Our directory gives small business people eager to provide services to the community an opportunity to make themselves known to our readers at an affordable cost.
This is the only service directory mailed each week. If you would like your service to appear in our directory, please call 772-370-7983.

Michael R. Repoli, CPA, EA Stuart NEARLY 75,000 EYEBALLS

INCOME TAXES. ROOT CANAL. LANDSCAPING SEE EVERY
THESE WEEK
Fortunately, we can help with the • Lawn Maintenance • Planting • Re-sodding • Land Clearing PAGES
more painful of the two.
• Tree Service • Mulch • Storm Clean-Up • Hauling
Call: 772-878-3703 FAX: 772-343-7287 • www.repolicpa.com
561.702.5836 Licensed 772.528.1953 GET YOUR BUSINESS NOTICED - CALL 772-370-7983
Insured

SUMMER SAVINGS

for our St. Lucie West & Tradition friends!

FREE DENTAL IMPLANT 59$ DENTAL CLEANING
CONSULTATION* SPECIAL*

Code:D6010 Includes: Cleaning (Prophylaxis or Full Mouth Debridement),
Full Mouth X-Rays & Comprehensive exam.

Code: D1110, D4355, D0150 & D0210

85$ TAKE HOME 899$ DENTAL CROWN
WHITENING KIT* SPECIAL*
Includes: Porcelain/Ceramic crown & Core Build up.
Code: D2740 OR D2750

*Special offers cannot be combined with any other special and are available for a limited time only. Only one special offer can be used per patient.

Port St Lucie Office
672 SW Prima Vista Blvd #202

Port St. Lucie, FL 34983
(772) 905-2741

Jupiter Dental Office
3889 Military Trail #102

Jupiter, FL 33458
(561) 406-6070

www.DBDFL.com

A Financing Program by Allegro Credit ®

OPEN 7 DAYS A WEEK

Mon - Fri 8:00am-8:00pm

Sat & Sun 9:00am-4:00pm

We are here for life’s unexpected urgencies! We treat acute medical conditions, injuries from car
accidents, at work, while playing sports & so much more. We accept most insurance carriers,
Medicare & Medicaid. Uninsured? Please ask about our Self Pay rates.

Back to School Savings
for our St-Lucie West and
Tradition residents:

Sports or School
Physical

NOW ONLY 35!$
(Reg $40)

Book Your Appointment Online. 772-905-2560

XpressFL.com 672 SW Prima Vista Blvd. #102


Click to View FlipBook Version
Previous Book
Unipac Service
Next Book
BendPak Ranger General Catalogue