WCS_305_21

FANTASTIC VALUE – SAVE ££S + WIN PRIZES! Stitch a vibrant

kitchen scene

Taste of Mexico

100EASY-TO-USE © Frederick Warne
CHARTS & Co., 2021
TO START
TODAY

TRY ART NOUVEAU DESIGNS

PLUS

R40ELCAAXFÉWMITOHTIFS

Religious cards Fun felines Herb labels Spring sampler

Easter wreathMakeseasonaldécor ENJOY OUR ROARSOME DINOSAUR ABC!

LOVE

BEING YOU

The Make Arcade Midi Cross Stitch Kit - You’re Fab

Get stuck into a brand new kit by Make Arcade - exclusively at lovecrafts.com

FREE delivery + 15% OFF YOUREFAB15
on orders over £25 with code:
*terms & conditions apply

Welcome Editor’s Letter

W e’re thrilled to welcome back Peter Rabbit as 84 18
the cover star this month! I know you are fans 62
of the lovable bunny too, so I hope you enjoy
stitching this fab spring scene (p10). We’ve got plenty more
seasonal patterns to keep you busy – celebrate
Easter with Heather Nugent’s fun wreath (p84), enjoy Nia
Rhind’s delightful spring sampler (p62) and make
handy labels for your indoor plant pots with Jenny van de
Wiele’s 12 delicate herb designs (p18).

I’m a big fan of William Morris and so I asked Amanda
Butler to create a set of charts inspired by the 19th century
designer. She’s truly captured the bold repeating
patterns William Morris was known for in the stylish
dining set on page 56 – sure to impress guests!

At the time of writing, we’re still in lockdown here in
the UK and I’m missing café catch-ups with friends. With
that in mind, Durene Jones’ café-themed Design

Library (p47) is the perfect
way to let a pal know you’re
thinking of them, and to
plan where you’ll meet for
your next cuppa as soon as
it’s allowed!

Hope you’re all staying
safe and well.

The World of Cross Stitching

Meet some our designers... STITCHING www.facebook.com/
theworldofcrossstitching
HELP!
www.instagram.com/
worldofcrossstitching

Don’t forget to send all We will try and answer your
your stitchy questions and questions as soon as we can, but
design requests in to us! if you’re working to a specific
deadline then do let us know!
Email us at:
LESLEY TEARE LISA REAKES HEATHER NUGENT theworldofxstitching@
immediate.co.uk
Escape to a vibrant Lisa has created a Bring the joy of the
Mexican kitchen kaleidoscope of pattern season into your home Write to:
featuring succulents, and colour with her with Heather’s brilliant Ask the Experts,
tropical fruit, colourful abstract cats chart Easter wreath (p84). The World of Cross Stitching,
crockery and a woman (p68). This eye-catching Stitch as many motifs as Immediate Media Co,
at the heart of Lesley’s design will keep you you like to create your Eagle House, Colston Avenue,
stunning design (p36). mesmerised for hours! own unique design. Bristol BS1 4ST

Send in queries via social media:

www.gathered.how/woxs TheWorldofCrossStitching 3

In Your Issue

Contents We bring you all the best projects, advice,
news and offers for the month ahead!

YOURFAB COVER
GIFT!
STAR!
Stitch two delicate moths, designed by
Cheryl McKinnon, and frame them to
create beautiful wall art for your home.

Turn to
page 9

10 PETER RABBITTM IS READY
FOR A SPRING ADVENTURE

Gift available with print edition only. Overseas gift(s) may vary Projects

Subscribe 10 Peter RabbitTM
You’ll adore this sweet scene
and save Turn to
money page 44 18 Herb planters
Mark your pots with rustic labels
HALF 36 TAKE A PEEK INSIDE
PRICE 27 Dino ABC THIS VIBRANT KITCHEN
Kids will love this roarsome set
Subscribe today and you’ll save 50% The World of Cross Stitching (ISSN 1460-
on the shop price for a whole year’s 36 Mexican lady 1970) (USPS 015-630) is published 13 times
worth of your favourite magazine! Escape into this sunny portrait a year (monthly, with a Christmas issue in
Don’t miss out on this limited offer! November) by Immediate Media Bristol LTD,
47 Café Design Library Eagle House, Colston Avenue, Bristol
This ‘save 50%’ subscription offer is available to new UK print Relax with cake and a cuppa BS1 4ST, UK.
subscribers paying by Direct Debit only. Offer ends 2 April 2021. Distributed in the US by NPS Media Group,
56 Dining set LLC, 2 Corporate Drive, Suite 945, Shelton,
Try William Morris-inspired designs CT 06484. Periodicals postage paid at
Shelton, CT and additional mailing offices.
62 Spring sampler Postmaster: Send address changes to
Welcome the new season The World of Cross Stitching, PO Box 37495,
Boone, IA 50037-0495
68 Colourful cats
Create mesmerising patterns

74 Eid and Ramadan cards
Celebrate this Islamic festival

84 Easter wreath
Make fun seasonal home décor

92 Quick challenge
Get to grips with goldwork

4 TheWorldofCrossStitching www.gathered.how/woxs

In Your Issue

100
NEW
CHARTS

68 COMBINE ABSTRACT
PATTERNS & FAB FELINES

74 STITCH FOR THIS SPECIAL Fun & advice
ISLAMIC FESTIVAL 6 Meet our guests
Say hello to this month’s panel 47 DESIGN LIBRARY:
24 CREATE A CUTE, MINI 40 FAB CAFÉ IDEAS
LONG-HAIR DACHSHUND 7 Furry Tales
Collect a chart from Lucie Heaton Much more than a magazine…

14 Your letters APPS TO GO!
Stitchy gossip & photos from you
Here at The World of Cross Stitching,
31 Ask the experts we’re proud to be online! Download our
Our pros solve your queries apps at the Apple newsstand, Google
Play, Zinio and Amazon for Kindle Fire.
42 Best buys
The latest products, kits & offers

44 Subscription offer
Save 50% when you subscribe

72 In the spotlight
We chat to Perry Abdel-Hadi about
her design style & inspiration

83 Enter to win
Win kits & a stitch subscription box

90 Stockists
Suppliers of everything in the mag

91 Back issues
Complete your mag collection

94 Next month
What’s coming up in issue 306?

96 How to stitch
Beginners start here

98 Take a break
Crossword and sudoku puzzles

TheWorldofCrossStitching 5

Reader Panel theBpeaonnel!

Meet our guests Getasneakpreview
Appear in the magazine
Receive a stitchy gift

Get to know this month’s reader panel, and look out for their favourite projects throughout the issue

Dawn Rebecca Roxanne
Paget Smith Birmingham

is an Early Years is a community is a school
practitioner from nursery nurse coordinator and
Oxfordshire from Worcester lives in Trinidad
and Tobago
What is your fave project? What are you stitching?
My mum bought me ‘Creative Dog’ Each year, I design and stitch cards Who do you like to stitch for?
by Joan Elliott. It says, ‘I’m creative, for charity, this year it’s Christmas Myself, my home and I like to stitch
don’t expect me to be neat too’. trees for the Hereford and Worcester gifts for family and friends too.
What has been your worst Dyslexia Association.
stitching disaster? Fave cross stitch designer? Fave WOXS design?
A card for a friend I stitched when Jo Verso. I use designs from her I’ve been practising lettering
I was 13 years old, not long after books to create cards and gifts. and love the medieval ABC
I became visually impaired. It has in issue 290 (Feb 2020).
taken me years to relearn cross Fave WOXS design? What do you love most
stitching, now I mostly cross stitch The Design Library in issue 302 (Jan about cross stitching?
by touch rather than by sight. 2021), my daughter starred in the The quiet concentration and the
What is your idea of cross local panto last year great feeling you have when
stitch heaven? so I stitched the a piece is completed.
At home with my latest project, rock starry name plaque Your best compliment?
music playing in the background and for her birthday. I stitched a floral piece and used it to
a box of chocolates next to me. What drives embellish a pocket on a denim dress.
you mad about My mom, who is 77 years old, was
Fave WOXS design? cross stitching? pleasantly surprised and awed.
The advent calendar by Durene Backstitch – I hate it with a passion. What is your idea of cross
Jones from issue 299 (Nov 2020), I know it makes an image pop but I stitch heaven?
it has lots of cute characters. tend to avoid patterns with too much. All the threads I need – and lighting!
Which designer would you Proudest stitching moment? Memorable stitching moment?
A family tree design that I stitched Adding glitter wings to the angels
like to meet? for my father-in-law. He likes family I stitched for my students. I made
The late Margaret Sherry, history and telling us all stories from ballet angels to match each of their
I’d ask her where she got the past, so he loved it. characteristics and used sparkling
the ideas for her creations. glitter thread for the wings.

We need you! Gift
worth
To be on the panel, email theworldofxstitching@ £31!
immediate.co.uk with your name, where you’re from
and a good-quality photo of yourself. Panellists get a THANKS! This month’s panel
preview of the magazine and a gift worth at least £30! members each get a Vervaco ‘Blue
Tits & Spring Flowers Tablecloth’ cross
stitch kit from LoveCrafts. The kit
contains everything you need to stitch

this beautiful design.

6 TheWorldofCrossStitching www.gathered.how/woxs

Collectable Chart

Furry Tales

Collect a chart from the adorable Furry Tales® family, designed by Lucie Heaton

Rollerskating Mouse key Flossie
Mouse turns
Cross stitch in two strands rollerskater girl
in a carefree
DMC Anchor Madeira design that’ll
brighten
Z blanc 2 2402 white someone’s
tan day. So quick
H 436 1045 2011 light tan – get your
pink skates on
g 437 362 2012 yellow and stitch
cream her before
X 604 55 614 peach she whizzes
light peach away in her
i 726 295 109 grey trademark
turquoise brights and
; 739 366 2014 light turquoise multi-coloured
polka dots.
c 754 1012 305 grey

m 948 892 306

k 3799 236 1713

f 3845 1089 1102

n 3846 1090 1103

Backstitch in one strand

––––– 3799 236 1713

STITCH COUNT 40 high x 38 wide
DESIGN AREA 14 HPI (28-count evenweave)
– 7.5x7cm (2¾x2¾in)

This design was stitched using DMC stranded cotton

10 10 20

Missed a chart? 20 ggggg in
ggggggggggg X
ISSUE 304 ggHHgggHHHHHg
Stitch Monty Mouse the ggHHggHHcccccH
Medic to say thanks to a key gHHHgHHcmmmmmcH
worker for all their care. gggggHcmmmmmmmc
ggggggHcmmmmmmmmc
ggggggHcmmmmmmmmc
g;;;ggggcmmmmmmmmc
;;;;;ggggcmmmmmmmc
10 ZZ;;;;gggcmmmmmmc

ZZZ;;;gggHcmmmmcc
kZZ;;;ggHH cccc
ZZ;;;ggH ggg

gggg ;;;ggHffffnnnnggg
ggggnnnnnnfHHfffnnninfHgH
ggHHnnXnnnnfffnZnnnnffHHH
HHHHnnnfffZnnnnnnfffffHH
Hfffffffnnnnnn
ISSUE 303 ffnninnnn ii
Wearing a rainbow cardigan,
Flossie Mouse wants to make fnnnnnXfiiiiiii
fZnnnffiiiiiii
sure everyone stays safe. ffffiiiiiiiii
iiiiiiiiiiiiii
ISSUE 302 iiiiiiiiiiiii ZZn
Monty Mouse is getting the
New Year’s Eve party started iiiiiiiiiiiiiinZZZiZnii
with balloons and streamers. iiiiiiiiiiiiiiinZiZZZnXi
iiiiiiiiiiiiiiHgfnZZZiZnii
For back issues, call ☎ 03330 162 137 iii iiigHgggHffZZZZZn
or visit http://bit.ly/1NwX3Rv ggHHH HHHXXXXZZXn
10 X XXZXfii
Xnnff
XZXfXi
Xnnff
ZXfii
XZZZZ
ZXfXX
ni XXZZiZ
XXZZZZZ n XX

ZZZZZZiZiZ X
XXXXXZZZZZ
nnnnnnnfff
XXiXi iXi i

20 XXiii iii

www.gathered.how/woxs TheWorldofCrossStitching 7



Exclusive This Month

Your EXCLUSIVE gift!

New to cross stitch? Start with these easy-to-stitch moths with fun felt frames. By Cheryl McKinnon

Moths key

Cross stitch in two strands

DMC Anchor Madeira

i 307 289 104 yellow
orange
I 608 332 206 light orange
brown
Y 740 316 204 dark orange
green
} 898 360 2006 antique mauve
light yellow
U 900 326 208 pink
purple
M 955 206 1210 grey

s 3041 871 806 brown

z 3078 292 102

X 3609 85 710

S 3746 1030 2702

k 3799 236 1713

Inside your kit... Backstitch in one strand

Here are the colours and Whole ––––– 898 360 2006
number of lengths of thread stitches
Factb MAXIMUM STITCH COUNT 27 high x 35 wide
Yellow x1 only DESIGN AREA 14 HPI (28-count evenweave)
Orange x3 – 5x6.5cm (2x2½in)
Light orange x1 Stitching Time
Brown x5 Approx. 8 hours STITCHED BY Laura Boyter
Dark orange x2 Type of Stitches
Green x2 Cross stitch, backstitch These designs were stitched using stranded cotton from your
Antique mauve x2 Ease of Stitching coverkit
Light yellow x4 Beginner
Pink x2
Purple x1 TOP TIPHdcioghnhay’ltroitgluoah’srsteetyhysoteouiutrgcorhowpisnlsaogcoyenoatushe
Grey x1

Total: 24 lengths 10 10 10

10

MMMss ssMMM

MzzUIIs sIIUzzM

10 10 zzzIUUssX XssUUIzzz
zzUUIUsXz} }zXsUIUUzz

UIIUsXz}Is sI}zXsUIIU

III IIsXz}IIs sII}zXsII
sI}}}}XsUU
IkkkI UUsX}}}}Is
UsXMMMM}Is zz zz sI}MMMMXsU
kkkkk IsX}MMM}Is zz zz sI}MMM}XsI

kkkkkkk UIsX}}M}Izszz zzszI}M}}XsIU

}}kkkkk}} UUUsXz}IzUUsz zsUUzI}zXsUUU
zzz}kkkkk}zzz
}}z}}}kkk}}}z}} IIsXz}IIzUUsz zsUUzII}zXsII
zz}}z}zIIIz}z}}zz IsXz}IIIzzzIIIzzzIII}zXsI
}}z}}zzzIYIzzz}}z}} UXUUUUUUIIIUUUUUUXU
zz}}}}z}}YYYYY}}z}}}}zz sUsXzzzUUUIIIUUUzzzXsUs
}}z}}}z}}}IiYiI}}}z}}}z}} sUsXz}}}zUUzzzUUz}}}zXsUs
}}}}}}}z}}}IiYiI}}}z}}}}}}} sUUsXz}MM}zUUUUUz}MM}zXsUUs
zzz}}}}z}}}}SiYiS}}}}z}}}}zzz sUIIsX}MM}z zzz z}MM}XsIIUs
}}zzz}zzzzzzSSi}iSSzzzzzz}zzz}} sIUUsXz}}UU UUU UU}}zXsUUIs
}}}}zz}}}}}zzYYiYiYYzz}}}}}zz}}}} sUUIUsXz}UU z UU}zXsUIUUs
zzz}}z}}}}}}}IYYi}iYYI}}}}}}}z}}zzz U}zXsIUIIs
}}z}}zz}}}}}IYSSiYiSSYI}}}}}zz}}z}} sIIUIsXz}U U}zXsIIUIs
sIUIIsXz}U
}}}zz}}z}z}}YSSSS}SSSSY}}z}z}}zz}}} sUIIUsXXz zXXsUIIUs
z}z}}}zzzzSYSSSSYSSSSYSzzzz}}}z}z 10 sIUIIsXz zXsIIUIs
10 }}}}zISSYYSSIIISSYYSSIz}}}}
sIIIUsX XsUIIIs

iYYYYYiiIIIiiYYYYYi sIUUs sUUIs

iiiii I iiiii ssU Uss

www.gathered.how/woxs TheWorldofCrossStitching 9

Project Peter RabbitTM

INSPIRED BY BEATRIX POTTERTM

Enjoyed by generations, bring Beatrix Potter’s tale and
illustration of a lovable bunny to life in cross stitch

A h, Peter! If you’ve ever read Factb Cute
the classic Beatrix Potter character
story, you’ll know that this
mischievous bunny drove his mother, stitch
Mrs Rabbit, to distraction with his
antics, but she loved him so very Stitching Time
much. It’s a story that will ring true Approx. 45 hours
with parents and grandparents to Type of Stitches
this day, we’re sure! This cross stitch Cross stitch, backstitch
portrait shows Peter looking clean Ease of Stitching
and smart in his signature blue coat Beginner/advanced beginner
and black plimsolls – but with those
potted flowers in his hands, we can’t We’d love to finish this design as a
imagine he’s going to stay that way drawstring bag to store toys, for little
for very long. Stitch this to decorate ones to carry books to school or for
the bedrooms and nurseries of your it to take pride of place on a hook
own cheeky little ones, or as a treat on the back of the door as the go-to
to remind you of the charm and joy bag for everyday adventures. Why not
of Beatrix Potter’s timeless stories. personalise your make with a name
to make it even more special?

Meet the auth

Beatrix Potter

Beatrix was a British writer and illustrator
who is best known for her 23 exquisitely
drawn children’s books about animals. As a
passionate naturalist, Beatrix took inspiration
from her surroundings in the Lake District.

10 TheWorldofCrossStitching www.gathered.how/woxs

Peter RabbitTM Project

STITCH
A CLASSIC

TALE

www.gathered.how/woxs Worked in easy
whole cross stitch
and backstitch, this
design is within the
reach of all stitchers

TheWorldofCrossStitching 11

Project Peter RabbitTM

Peter RabbitTM key

Cross stitch in two strands

DMC Anchor Madeira TOP TIP

Z blanc 2 2402 white wCporaeernkabcitanieclgpktirlhstlouhtejisietfstccerdhtaee-tloisinoniggnlynobafysa
very dark blue
E 312 979 1005 dark grey
grey
J 317 400 1714 dark blue
coral
4 318 399 1801 light coral
dark tan
f 334 977 1004 tan
light tan
< 351 10 214 light cream
cream
q 352 9 303 yellow
light yellow
l 435 1046 2010 light grey
baby pink
7 436 1045 2011 pink
ginger
v 437 362 2012 light ginger
light blue
; 712 926 2101 very dark green
dark green
h 739 366 2014 green
light green
u 743 302 113 blue
very dark grey
i 744 301 112 dark ginger

3 762 234 1804 very dark grey

b 818 23 501

c 963 73 502

1 976 1001 2301

V 977 1002 2302

8 3325 129 907

{ 3345 268 1406

9 3346 267 1407

p 3347 265 1408

M 3348 264 1409

6 3755 140 1013

k 3799 236 1713

G 3826 1048 2306

Backstitch in one strand

––––– 3799 236 1713

STITCH COUNT 120 high x 89 wide
DESIGN AREA 14 HPI (28-count evenweave)
– 22x16cm (8½x6¼in)

ILLUSTRATION CONVERTED BY Fiona Baker

STITCHED BY Angela Ottewell

This design was stitched using DMC stranded cotton

Shopping list Rebecca READER PANEL

Zweigart 14-count white aida measuring I’ll be stitching this for my friend’s little
39x33cm (15¼x13in) boy’s bedroom. A few months ago she asked
Stranded cotton as listed in the key me to stitch a Peter Rabbit design for her but
Size 24 tapestry needle we couldn’t find one she liked, so thank you
Frame of your choice with a minimum The World of Cross Stitching!
aperture of 24x18cm (9½x7in)
www.gathered.how/woxs
Thread & fabric cost

Approximately £38

*For stockists see page 90

12 TheWorldofCrossStitching

Peter RabbitTM Project

40 30 20 10 10 20 hh30 40
hh

60 7vhh
7l7vh

7lvvh

7l7hvvh

7lvhhvh

; 7l7vbhvh
7lvbbhvv
;hl 7lvbbbhhvv
hll7
MMMMMMMMMMpMMMpMMMppqppMMpMqpqqMppppqqpqMMMMqpppMqqqqqpMpMMZppq<MqqqqpqZqpq<qq<Zq3qqqMMZZ<Z33ZZZZq<MMMpMqZ<<<<qqqqqZ33ZZM3ZZqq<<p<qqqqMMppMZZppMM<q<<kpZ<qqq333M3ZZZZZpMq<<pkpp<qZZZ33iu<333MZZ333uui33ZZMqq<<<q<qpMppG<1GGZ1<Z33i3ZZZZMqqqMpppppqqqqqGV111GZZ33Z33ZZZMMpMpppppM1qqq<qqqqMZ3ZZ93GG11VVGG11VVMppMpppMMqqqqqqqqqMpMZZ3VVVVVV11GVV111G199MMpMpppqqqqqqqqq9pMpMppZ3Z3ZZZV1VVG11VVVVVVVVVVV1MMpMpqqqqqqqqqq99pp9p9pZZ9ZZ99{{GGVVVVVVVVVVV444444VMMMpMpq<qq<qq<qqqqq999{99qqq99{{91GG11VGG1VVV{4444444VVVVVVVVVVMMMMMpppMqq<<<q<q<<qqq{{qq4{qqqq{9{{11G1VVVG1VVVVVVVV4444433VVVVVVVVVV4MMMppppp9qqq<<<<<<qqqqqqqqqqqq<qq9{99111VVVG11V1VVVVVV4443433JVVVVVVVVVVpMMpMppp99qq<pM<q<<qqqq<<q<q<qqq{{{{1111VVGG11V1VVVVVVpMpMMMJVVV3VV3VVV3344V<ppppq<<pkp<<<qqqqqq<<<4<qq9{{9MM1MMMVGG11V11VVVVVVVVVVVVVVJJJJ33444pMppMMppp9p9qq<pMM<qqq{{{qq<ppM<<<<qMMMMMMMpGGG11VV1VVVVVVVVV<J4444JJJJJVVVVVpMpMMppppMp9Z9qqq<<<<<qqq{{9{<MkpJ<<qqMMpMMppppGG111VVVVVVVVVVVVVVG44J447vvvJJJVVVpppppMpppMpp9ZZqZ<<<<q<<qq{9{<<MMp<qqqMMpMppppGGVG1G1V1VVVVVVVVVVVVVJVvhvhhvv744444JpMMpppVpppMpZZpZZZ3q<q<qq<q{{ZZ<<<<<<<qqMpppppGpGGGGGG11VVVV1VVVVVV1VV1Vh444J7vvvhvhvVVVMMMMMpppppppZZZZZZ3<<q<<{<<{9ZZZZZ<<<<<pppppppGGG1GGG1111V1V11VVVV11VV1JV7vhhhvJvv77J4JVMMpppp9pppppZZZ333ZZ<q<{{{{9{ZZZZZZZZ{ppppMMGG111GG1G11V11VV11VV11VV1VVJJ7vvvhh;v7711VJMMMppp9pppZ33ii3ZZZ<qq9{9ZZZZ3ZZ3ZZZ{9pppMMG111VG1GG11V11VV111111V11VJJ77vvhvh;;v7111MMpppp9ZZZ3iu3ZZ399{9{{Z33Z3333Z3Z{{ppppM111VVGGG1111111V111111111V;77vvh;h7f111111MMMMppppZZ33iu333ZZ9{{99{933uuuu3Z{9{pMMpp1VV1VGG11G11111111111117111fh;3;hhvvv71MMMppMZZZZui3ZZZpp9{9ZZZ33uiiu133Z9{pMMp111VVGG;;hGG1111111111117111f6h;hhhvv77MMpMZZZ33Z3ZZZppp99ZZZZZ33iui3ZZZZ9{{{111VVVG;;hhhvG11111111G1111111fhhhhvv7v7fMpZZpp33Z3ZZpp9p99ZZ3Z33333{{9{{{{911VVVVG;;hhvhvG1111111G1111344443466f1111pppMppZ39ZZ3Zp9{9p99ZZZZ333ZZ{{9p99{1VV1VVG;h;hhv7G1G1G111G11G711f6643p444441pMMpppZZ9ZZpppp99pp9ZZZZ3Z3ZZ9p91ppM1V11VG;;;hvhvv7GGGG11GG11G411ff6433444444pMppMpZ999Z99ppppp999pZZZZZ9Z99pppMM11G1VG;h;;hvv77GGG111G11G11144444334J646ffpMppMpppppppp{9ppp99{p99Z9ZZ{9p9ppMM11GG11G;;hhvv7v7GGG11GG11G1111f6JJ433344444G;;;;hh;;MMpMMpM9ppppp9{9ppp{{9p99{Z99{9ppM{G11G111G;;hvvvv77GGf1GGGGGG1111f34444334JJJfffhllllhhh;;MpMMpp99pppppp99vvvvhhhhhp{{99{9ppMpGGG1GGG1;hhv7v77GGG1G1G1G11111f4hJ4JJ39333444hll7777vhhh;pM99pvvvvvv77vvvhhh;hh{{{96pppMMG1GGGG1;;hvv7v7GGGGGG11G1111fff4J4JJJ33344443M77777v7vhhh;;Mvvv7vv7777vvvvvvh;;;hh9{9ppMppJGGGGG1Gh;hhv77lEGGGGG1111111ff6hhh34JJJJ3344J3347J77v7777vhhh;;vv77vv77777v77v7vvvh;;;hh9{9pMMppGGGGG1GGhhv777EEEE1G1111111hh;;hhhhJp334JJ4JJJJ44J7777vvv77vhhh;vv7vvv77v77777v777vhhv;h;hh94pGMMMGGGGGGGGhhvv7lEEEE11111h;;h;;;h;hvhh44444JJJvvvvvv7777vvvvhvhh;;v77v7v77777v7v777vvvhv;;h;;hpppGGGGGGGGGGGGEhhv7lEEE6hh;;;;;;;;h;;;;hvvhhJ4JJ477vvvvhh77v7vvhvhvhh;v7vv7777777v777vvvvvhhh;h;;hhhpGGGGGGGGGGhhh8Ev77l6666h;;h;;h;;h;hvhvvv;;vJJJ477vvvvhh;7777vvvvvhhhvv777v7777v7vvvvhvvvhh;h;;;;hhGGGGGGGGhhh;h;8666668666;;;;h;;hhhhv;;;;;;;;vJ477vvvhh;;h;7v7vv7vhvhh;v77777777v77vvhhhvvvhhhh;;;;;hhGGGGGGh;h;;h;h8868688666h;;h;;hh;;;;;hh;;;J;h;;hhvv77774;v7v7v7vvvhh;v77v777777vvvhhvvvvhvhhhhh;;h;hl7l7v7vh;;;;h;8686886666hvh;hh;;;;;hh;;hhh4h;hh;hvhv7v77h7v77v7vvvhh777v777777vvvvvhhvvhhhhhvh;;h;hhl7v77vh;;;hh;v8888888666vhvhhv;h;h;;hhhhhh7v7vvhhhhvh;hv777v7vvhvhh777777v77v7vhhhvvhvhvhhvhhh;;;;h;l77vh;h;hvv88888888886666888888hhhhhhhhh77vvvlhhhhhhhh7777v7vvvvhhl7v777v77vvvvvvvvhvhhhhvhvhhh;h;;h7vvvvhv88888868886888666666668888hhhhhhhvvvvhhhhhhhvhv777v7v7vh7hhll7v7v77v7vvhvvhhhhhhhvvvvvhh;hv;hl77vv888886666688688666f66666688688hvvhhhvvvvhhvhhvhhhv7777v777vvvhll7l7777v7vvvvhhhh;;;;hhvhvhvhh;h;hll7888666ff66f668868666f6666668688888vvhvhhvvhvvhvvvhvv7v77v77v7vhv7l77v7v77vhhhh;;;;;;hhvvvvvvvhh;hhlf888666f6686ff66886666ff6666886888888vvhvvhvvhv7vvvvvvv7v77777v77ll7l77vvvvhhh;;;kkk;hhhhvvvvvhh;hh;f888666f666886ff6666666f66668888888888vvvhv7v7vv8hvhhvvvvvv777777l7ll7vv7vvhvhh;kkkkk;hhhvvvvhhvhh;h;f86666f666fvf86ff666666ff66668888888888vvvh8v7vvvvhvhvvvv77777lll77777vvvvhh;;Zkkkk;hhvvv7vvhhh;h;f76666f666ff8f886fff666fff66666888888688vhvvhvvvvv7vv77vvvv777llvlll77vvvvhh;;kkkkk;hhhhvv7vvhhh;hhf6666f6668f866f88686666ff6666668888888688vvvv6vvv77vvvvvvvvvvvvvvvll7vvvvhhh;;kkk;;hvhvv77vvvhh;hhf76666668f8666f88866666f666666888888886687vv7vvv7vvvvvvv777vvv77777vvvvl7vvvhvhhh;;;;;hhhvv77vvvhhhh;f666666688888666ff66666ff6666668888888868877vvvvvv7v7v7vf777vvvvvvv77777v7vvvvvhhhvhh;hhhhvvv77vv77vh;;hf66f6666888666666666666vf6f66688868888668867vvv7vv7v7vv7f7777vhhhhhhhv777777777vhhvhhvhhvhvv7v7777v7vhhh;7f66f666888686666666666ffff6666686688888668677vvv7v7777vv7v777vvhhcccccc;;hhvv777vvvvvhvvvhvvhv777v77777vvhhhf66f6666888866666666666fff66668686668888666f77v7v;v7v7v7v7777vhccccccccccc;;hhvhhv77vvv7v7vvv7777777777vvhh7hf66f666f88866666666666ff666666688f666888866ff77vv777v7vvv77vcccbbcccccccccc;;hvv777777777v7vv77777v77777vvhff66f666f8888866666666fff666686888f6688888866f7777v7v77vvbccbbbbbbbbccccccchhvv777vv77v77v777777v77777vv7hff66f6866f88866666666f6f666666888f66688886886677vv7v77v77bbbbbbbbbbbbbccc;hvvv7vhhvvv77vv77v77777777v7v7hff66f68666ff888666666f6f6666668888f666868886866l7v777v6666fbbbbbbbbbbcccc;;hvvvhhhvhhvv777777vv77v7777vvv6ff66f668866fff8866667v7v766688688f6668888888868ll7v777b7bbbbbvbbbcc;;;hhvvhhvhvvv77vv77v77v777vff66fff668666666886666666666888888f6668688888688ll7v77v7776;;bbbbbb;;hhhvvvvvvv77v7vv6686688886666666676868888866666888888888l7l77v77v7hh;;;;;;;hvvhhhh88888866686688888f66668888888888ll7777v776vhhhhhhhhvhhhv88888666668688v666688888886888lll77v7v778vhhhhv888886666888866668888886668lll7777777vvvvvv8666668666688888666668ll77l77l7;8hhhhhh8v8668866666666lll7l77;;66l66668886666f666lll7l67;;;;6666886l668866ll7ll7;;l;;8888666Z866ff666;;Z;;;;l;;88666f7fffffff7;f6f;;f666;Z;;;Z688ZZ;f;Z;Z;ZZZ;;8866f;6ff6;Z;;;Z;;Z;Z8866f66;8;;Z88666;ZZ8ZZ;;Z;ZZZZ;;886ZZ68ZZ68ZZ;;8Z88
50
40
30
20
10

10
20
30
40
50

4JJ

60

www.gathered.how/woxs TheWorldofCrossStitching 13

Over to You LYNNE

Your letters

We love to see what you’ve been stitching
and hear your news, so send in your
photos, letters and tips today!

SUE HANNAH

Star Letter TINA

HERE BE DRAGONS Feather the nest

H ere is my current WIP. It’s called ‘Kindred Spirits’, from I ’ve just finished stitching backstitch. I’m now starting
Heaven and Earth Designs. I really like dragons and the blue tit and great tit the bullfinch and I plan to
I fell in love with it when I saw it. I never believed I’d be able from the bird quilt in issue 283 frame them individually to
to handle and finish such a big project, but I wanted to try. (August 2019). Lucie Heaton hang in my new home.
The photo shows you the size, it’s 65x85cm (25½x33½in) and has designed them beautifully, Elizabeth Chessell,
525 by 679 stitches – incredible! I started to stitch the piece they look so lifelike. I loved via email
in January 2016 and, at the time the photo was taken, I’d stitching these designs
stitched 54 pages out of 81 in 603 days. I’m so happy that because there’s minimal Sue: We’d love to see the
I didn’t lose patience or motivation. I often work on other framed collection Elizabeth!
cross stitch projects as well so it’ll probably take another year
until it’s finished, but I’m looking forward to the rest of the
journey. I’ll definitely get it framed, this masterpiece deserves
the most beautiful framing possible, and then I’ll hang it on
the wall in our living room above the place where I stitch.
Johanna Hauptmann, Germany

Hannah: It’s looking fantastic so far, Johanna. Let alone the
size, stitching the many shades of green is an achievement in
itself. Do send us a photo when it’s finished and framed.

Feather the nest
Elizabeth stitched these
for her new home

Worth
over
£55!

Here be dragons Win! at £27.56, these fun designs
Johanna’s pacing herself measure 37.5x10cm (14¾x4in).
with this impressive stitch Our Star Letter writer wins
‘Cat Show’ (KCCS1539) and MORE:: For more details visit
‘Chicken Run’ (KCCR1592) www.hcrafts.com
kits by Karen Carter from
Heritage Crafts. Priced

WRITE TO US AT: Letters, The World of Cross Stitching, Immediate Media Co, Eagle House, Colston Ave, Bristol BS1 4ST

14 TheWorldofCrossStitching www.gathered.how/woxs

Over to You

Fun times with Furry Tales PPerrefseecntt

I thought you might like to Fun times Happy home
see what I’ve been doing to Spot the unicorn among Angelique’s gift, celebrating
help keep myself sane during Suzanne’s Furry Tales cards her daughter’s first year of
lockdown – stitching mice! living with her partner
I decided to stitch a mouse CRAFTY STITCHES
every day and here are the HAPPY
results. Thank you to Lucie D urene Jones is my favourite designer so when I saw HOME
Heaton for her fabulous Furry that the free gift in issue 292 (April 2020) was a
Tales collection, I look forward booklet of her designs I couldn’t wait to make a start. J ust finished my
to seeing them every month. I I decided to embellish the black frame with some die cuts latest project for my
stitched the footy mouse from and added gilding wax. I’m so happy with them, and I was lovely daughter and her
issue 294 (June 2020) on the proud to hang them on my craft room wall. partner to celebrate the
day I received the magazine. Linda West, Isle of Man first year in their first
It was just what I needed as Lynne: Decorating the frame with die-cut embellishments home together. After
I’m a massive football fan and is inspired, Linda, and the gilding wax effect looks luxe! looking through my large
really missing my footy. And collection of your many
yes, I know there’s a unicorn Crafty stitches wonderful magazines I
hiding in there – I randomly Linda got creative for her favourite designer found the perfect design
decided to stitch it one day. in issue 141 (September
Why? Because I could! Thanks Highs and lows 2008). I posted their gift
for keeping us going and for to them and they were
all the wonderful designs. E arlier this year my daughter surprised me on over the moon. Thanks
Suzanne Lee, Redruth Mother’s Day with a subscription to Cross Stitch again for this wonderful
Tina: Haha! We enjoyed Crazy. Yay! Then came lockdown and the end of Crazy design, which they’ll
spotting the unicorn, Suzanne, – collateral damage of Covid-19 (sob!). How relieved treasure forever.
it makes a fun addition to the I was to find the subscription had been automatically Angelique Wright,
Furry Tales collection. We’ve transferred to The World of Cross Stitching – another Staffordshire
been waiting for a reader favourite of mine. I received your 300th birthday Sue: How thoughtful of
to stitch a selection of Lucie celebration issue – congratulations and well done! you to celebrate a year
Heaton’s adorable mice, so I enclose a pic of my last stitch from Crazy – backed in of them living together,
congratulations, and thank blue for my daughter – for her new house. She finally Angelique. They look
you for sending us a photo. moved after a lockdown hold-up. I hope you like it! thrilled with their gift,
We’re pleased you enjoyed Marie-Therese Kielty, Clydebank which looks beautiful
Monty as a footballer, and Hannah: It’s been a trying time, Marie-Therese! We’re in its mount and frame.
hope you like Flossie as a so glad you’ve joined The World of Cross Stitching
rollerskater in this issue. family. We love the way you’ve finished the welcome
Stitching Flossie and Monty banner – what a wonderful gift for your daughter.
in all their different guises is
a brilliant thing to do during
lockdown, and now you have
a stash of cards ready to send.

Highs
and lows
A final design
from Crazy by
Marie-Therese

EMAIL US AT: [email protected] or join our Facebook group: The World of Cross Stitching

www.gathered.how/woxs TheWorldofCrossStitching 15

Over to You

Monkey around

I love both The World of Cross Stitching magazine and Cross
Stitch Crazy and I’ve stitched many animal pictures from
Crazy. I stitched this amazing orangutan for my father’s birthday
and mounted it in a green aperture card. My dad’s as fun to
be around and listen to as the orangutans at the zoo! I love to
spend my time at my parent’s home – or at the zoo!
Jenny Minichino, via email

Tina: Your dad looks happy with his card, If you’re Monkey around
Jenny, he obviously shares the joke. If included in the Big smiles – Jenny’s dad looks
you like stitching animals then you’ll photo holding your pleased with his orangutan card
be pleased to know that we featured stitching, then we’ll
some animal thank you cards in issue boost the size of the Moonlight
289 (January 2020) and some cute prize as it’s always
animal 3D cards on perforated paper lovely to see your
in issue 302 (November 2020). friendly faces!

Cuddly bears Stitched in honour I spent two years stitching
Helen’s giving out Rebecca stitched this epic ‘Moon Hare’ from issue 232
bear hugs in stitches picture for her mum (September 2015) and got it
framed just before lockdown.
Cuddly STITCHED IN HONOUR I love the soft focus, as I’m not
bears a big fan of lots of backstitch.
I wanted to show you my latest project, it is the hardest I’m now on the last bit of a
I ’m really pleased with my thing I have ever done. I like to call it my ‘Covid-19 SAL sampler, it’s amazing
latest cross stitch so Pandemic’ project in honour of my mother, Silva Young, what can be achieved with just
I thought I’d show you what who had Covid-19 and survived. The picture took me more whole cross stitches.
I’ve been working on. The than seven months to complete, it’s a stamped cross stitch Jan Farebrother, London
first one is called ‘Happiness kit (11-count) by Joy Sunday called ‘The Last Supper’. The Lynne: It’s a beautifully
Bears’ by Design Works, outlining and backstitching was by far the hardest, especially atmospheric picture, Jan, well
which I stitched for my niece for my eyes, even with a magnifying light. done. How lovely to be able to
and nephew-in-law’s 20th Rebecca Young, New York appreciate it during lockdown.
wedding anniversary. They
were delighted with it and Hannah: It’s a truly stunning stitch, Rebecca, well done! Moonlight
have found a special place Jan was drawn to the soft
for it, so I can’t wait to visit focus element of this hare
them once lockdown is lifted
to see where they put it. The Su Stars Each month we randomly To
second piece is the Beefeater select three subscribers to subscribe
bear from issue 168 (August Worth win a prize as a thank you
2010) and was requested by over £30 turn to
my grandson, even though he This month’s winners are: page 44
is 15. I guess you’re never too each!
old to want something special ` Alena Sabova, Northampton
stitched by your Nana!
Helen D’Ovidio, ` Karen Garland, Swansea
Somerton
` Deborah Wheeler, Ware, Herts
Sue: Ah bless! It just goes to
show you’re never too big for Prizes every month!
a bear. You might also like the
sunflower bear, Helen, which The lucky winners will each be receiving this ‘Happiness
was featured in issue 297 is a Way of Life’ kit designed by Margaret Sherry.
(September 2020).
Immediate Media Co., publishers of The World of Cross Stitching, Subs Stars giveaway
Terms and Conditions:
Prizes were dispatched before the on sale date of this issue. There are no cash
alternatives. Winning entries will be chosen at random from all current subscribers.
The draw is final and no correspondence will be entered into.

WRITE TO US AT: Letters, The World of Cross Stitching, Immediate Media Co, Eagle House, Colston Ave, Bristol BS1 4ST

16 TheWorldofCrossStitching www.gathered.how/woxs

Cover gift that keeps on giving Over to You
Kate treated her family and friends
to these stunning stitched gifts Birthday
cat
THE COVER GIFT THAT KEEPS ON GIVING
I stitched Margaret Sherry’s
H ere are a few of the things I’ve made bookmarks to my family and friends, and I’m birthday cat from issue 294
recently using your patterns and planning to make the peacock Art Nouveau (June 2020) for my mum’s 80th
magazine cover gifts. I enjoyed stitching bookmark next. The cupcakes are from birthday. Lockdown meant
these little projects and adding my little issue 293 (May 2020), the birdcage from that we weren’t able to see her
personal touches here and there, they were issue 280 (May 2019) and the Art Nouveau so I adapted the pattern and
so fun and relaxing to do while listening bookmarks from issue 283 (August 2019). stitched the number 80 onto
to an audiobook or watching my favourite Kate, via email the cake band. It’s my first
TV episodes. I gifted the Art Nouveau Margaret Sherry design.
Sue: What a gorgeous selection, Kate! Nancy McInally, via email
Tina: What a fantastic gift!

Birthday cat
Nancy personalised the
cake band for her mum

Sending smiles across the miles SEND US YOUR

Sending smiles T his is my version of the NEWS
Patricia translated a Mother’s Day card from
greeting into Dutch Emma Congdon from issue 291 Don’t forget to send all your
(March 2020). I let my children letters and photos in to us!
choose the design and then Email us at:
I translated it into Dutch – I theworldofxstitching@
used the programme PCStitch. immediate.co.uk
Unexpectedly, our government or write to:
decided that we could visit our The World of Cross Stitching,
family for Mother’s Day but by Immediate Media Co,
then I had already sent the card Eagle House, Colston Avenue,
by post. My mother sent me a Bristol BS1 4ST
picture of herself with the card Get in touch on Facebook, too!
– you can see she loves it.
Patricia Bartholomevis, Each letter printed only
Belgium in The World of Cross
Stitching and not in any
Lynne: Asking your children other cross stitching
to choose the magazines will win
design for a crafty mystery prize!
your mum’s
Mother’s *For stockists see page 90
Day card is a
lovely touch,
Patricia, I bet
she appreciated

that. It’s nice to
see the greeting
in Dutch too –
it’s a beautifully
stitched card!

EMAIL US AT: [email protected] or join our Facebook group: The World of Cross Stitching

www.gathered.how/woxs TheWorldofCrossStitching 17

Project Herb Planters

DESIGNED BY JENNY VAN DE WIELE

Herbal
remedies

With 12 delicate labels to choose from, you can tailor
your stitching to pot up your dream herb garden

L ike cross stitching, growing Factb Perfect
your own is good for the soul, for
even if it doesn’t extend any
further than the herbs gracing your beginners
windowsill. Make them look even
more beautiful by stitching each of Stitching Time
your culinary superstars its own label, Approx. 2-3 hours
to complement its colours and stems each
and create a really special display. Type of Stitches
There are 12 different designs in this Cross stitch, fractionals,
set, from everyday favourites like backstitch
parsley to the more exotic lavender Ease of Stitching
and fennel, so you are sure to find the Beginner/advanced beginner
motif to suit your own potted patch.
love the idea of these stitched herbs
Each of these rustic labels sits arranged in a row on a length of aida
within a frame of 22 by 27 stitches, so band, too – string the stitched piece
you could easily stitch them in a three along kitchen shelves or a dining
by four design grid to work your very room dresser for a touch of country
own herbal sampler or cushion. We cottage cross stitch chic, even if you
don’t grow herbs yourself.

Meet the designer

Jenny van de Wiele

Growing herbs has become a real interest
of mine, so it will be lovely to cross stitch
them. I hope these plant labels will add a
special touch to the potted herbs you have

growing in your kitchen, too.

18 TheWorldofCrossStitching www.gathered.how/woxs

Herb Planters Project

CREATE
FOR THE
KITCHEN

www.gathered.how/woxs Combine aromatic
herbs with delicate
stitching for a kitchen
garden display you
can enjoy in your

home every day

TheWorldofCrossStitching 19

Project Herb Planters

10 10 10 10
10
L 10
LL LL
[ [[
L LL
nn L [[[[[[
nnnLLnL
[[ [ [[[[[[
nLLnnLL
LL n L [[[[[[ [[[[
LLL nn nn
[[[[[[ [[[[[
LLnnn nnn
nn nn [[[[ [ [[

LL LL [[[[[ [
LLL LLL
LL LL [[ [ [[

[ [[[[[

[ [[ [[[[

[[[ [[[[[[

[[[[[[

[ [[

10 10

10 10 10 10

10 10

[ < <<
[[[
LLL[[[[ << <<
LLLL[[LL
LLLL[LLL[[ <<
[LLL[LL[[[[
[[[[[L[[[[[ S`
[[[[LL[LLL[
[[LLL[LLLL C <SS C <
LL[[LLLL
[[[[LLL C S`< CC <<
[[[
CC <SS` CC < <<
[
C C `S`< C `<S`<<

C C `SS C<S`S`SS

CC CS`` S`SSSS< C

CC SS CSS``< CC

9C 9CC CCC

999 99 CC

10 10

How to... add backstitch Shopping list
to your design
Zweigart* 14-count rustico oatmeal aida
When you’ve finished all the cross 3 1 measuring 10x10cm (4x4in) for each design
stitches, load your needle with one 2 Stranded cotton as listed in the key
strand of thread as indicated by the Size 24 tapestry needle
key. Following the backstitch line on Kraft backing paper, double-sided tape and
the chart, make your stitches as in this pots of your choice from local stores
diagram. Bring your needle up at 1,
down at 2 then back up at 3, stitching Thread & fabric cost
in a two steps forward, one step back
motion. Use short lengths to prevent Approximately £16
them fuzzing up with wear.
*For stockists see page 90
20 TheWorldofCrossStitching
www.gathered.how/woxs

10 10
10
[
[
[
[
[
[
[
[
[
[

10

10 10

10

L

Ln

Ln

LLn L

L L n L [ LL

n L n L[

n LL n [[ nn

n L [[ LL n

n [[[ nn LL

[[[ nn nn L

[[ nn nn n

[ nn L

n

10

10 10

Herb Planters key 10

Cross stitch in two strands bb

[[ P b`b`b

[ [ P `b`b

DMC Anchor Madeira [ P L [`b`b

[ P L[[`b

b 151 73 404 pink [P [L

[ PP [[ L

< 153 95 710 lilac [PP [[

[PP [[[ PPPP

9 163 876 1703 pine green PPPP [[[ PPP P

[[[ PPPP[[

L 164 240 1209 light pine green [[[[

[

P 319 212 1313 green

[ 367 217 1312 dark green

C 966 206 1210 sea green 10

n 989 241 1401 forest green

S 3835 98 712 violet 10 10

` 3836 90 2713 light violet

Backstitch in one strand 10

––––– 163 876 1703 pine green nn

nn n nn

––––– 164 240 1209 light pine green nnn n nn n

nnnn nnnnn

––––– 311 164 1006 navy blue n nnn nnn n

nnnn nnnn

––––– 319 212 1313 green nn n

nn

––––– 367 217 1312 dark green nn nnnn

nnn nnn n

––––– 989 241 1401 forest green nnnn nnnn

nnn

nn

STITCH COUNT 22 high x 27 wide 10
DESIGN AREA 14 HPI (28-count evenweave)
– 4x5cm (1½x2in)

STITCHED BY Julieanne Charles

These designs were stitched using DMC stranded cotton

www.gathered.how/woxs TheWorldofCrossStitching 21

Project Herb Planters

How to... patch stitching
onto a card

1 Once you’ve finished stitching the design, cut it out,
leaving two squares of aida all the way around the edge.

2 Fray the outer block of the aida all the way around, using
tweezers, to make a fringe. Using acid-free double-sided tape,
attach a slightly smaller piece of white paper to the back of the
aida to prevent Kraft card from showing through holes in fabric.

3 Stick your patch to the centre of a piece of Kraft card with a
1cm (½in) border, then stick onto pots of your choice.

10 10 10 10

10 10

LL SC

LnnL LL S

Lnnn LnnL 9 9C CS

Lnn Lnnn CP9S 9 S

n nnn S9P99C CP C

LLn nn C99C S9P9S

LnnnLL n LLn PC C99C99

nnnnnn n LnnnnL S9P9S9CP9 C

nnnnnL n nnnnnn 99PC99 PC9

nnnn n Lnnnnn C 9P CP9S

nn nnnn C P9 P99

nn 9 PPC C

n P

n

10 10

10 10 10 10
10
10

CC9

CCC9 CC9

CCC9 CCC9

CCC99CCC99

CC99CCC99 [
[
CC9CCC999 [
[
C999999 [ [[[
[ [[[
C 9 9CC9CCC999 [[[[[
[[
9 CC99C CC99CCC99 [[

999 C CCC99CCC99

CC CCC9 CCC9

CCC9 CC9

CC9

10 10

TOP TIP

deasBsniagtdicnckmskptswlohaauinetsnthsdtptieoirotconckonhecr-eosaodctnkihvvteeairliebl ne

22 TheWorldofCrossStitching

Save 60%

WHEN YOU SUBSCRIBE
TO

bir thday
offer!

Get 13 issues for just £32.49!*

20+ inspirational projects, step-by-step stitch
guides and expert-led tutorials in every issue
Exclusive embroidery gifts, including iron-on
reusable pattern transfers and hoop kits

2 easy ways to subscribe

ORDER ONLINE AT
WWW.BUYSUBSCRIPTIONS.COM/LVEMHA1
CALL NOW ON 03330 165 408† AND QUOTE LVEMHA1

†UK calls will cost the same as other standard fixed line numbers (starting 01 or 02) and are included as part of any inclusive or free minutes allowances (if
offered by your phone tariff). Outside of free call packages call charges from mobile phones will cost between 3p and 55p per minute. Lines are open

weekdays 9am-5pm for orders and enquiries.*60% saving is only available to UK Direct Debit orders and is subject to availability. All savings are calculated
as a percentage of Basic Annual Rate. The UK Basic annual rate is £81.87 which includes any event issues (issues charged at higher than standard cover

price) published in a 12 month period. After your first 13 issues, your subscription will continue at just £44.99 every 13 issues thereafter, saving you 45% on
the shop price. Your subscription will start with the next available issue. Offer ends 30th May 2021.

Project Pet of the Month

Pet of the month

We know you’re huge fans of pets, so have us design a cross stitch of a beloved animal

OF THE MON TH
PET
Npoe.t1PET Design
NTH my pet!
OF THE MO
Q I’d love a chart of
my mini long-hair
dachshund. My dog is
black and I don’t know how to show long
hair in cross stitch, so I’d be most grateful
if you could help me. Here’s a picture of
Chloe, she visits a nursing home every
week and brings many smiles while there.
Thank you so much.
Carol Potvin, via email

A Durene says: With the help of
some carefully placed single stitches
around the silhouette of the design, and
some subtle highlighting and
backstitching, I hope I’ve managed to
capture Chloe’s distinctive long-haired
coat in this chart. Mini long-haired
dachshunds have delicate features, which
I’ve recreated here using shading, and
I think the different tones of grey mixed
with black really help to get this across.
With those soulful brown eyes, Chloe is

Fun facts about dachshunds Shopping list

• The dachshund was Queen Diesel and Chance. Girl dachshunds Zweigart* 14-count white aida measuring
Victoria’s favourite pooch, and also are called Lola, Peanut and Roxy. 24x24cm (9½x9½in)
that of John Wayne, Clark Gable, Stranded cotton as listed in the key
Pablo Picasso and Clint Eastwood. • They may be small, typically Size 24 tapestry needle
reaching no higher than 23cm (9in), Frame of your choice with a minimum
• Popular names for boy but the dachshund was originally aperture of 9x9cm (3½x3½in)
dachshunds are Rocky, Rusty, Elvis, bred to hunt rabbits and mice.
Thread & fabric cost

Approximately £13

*For stockists see page 90

24 TheWorldofCrossStitching www.gathered.how/woxs

Pet of the Month Project

Long-haired Dachshund key Factb More pet ideas
Stitching Time
Cross stitch in two strands Approx. 9 hours Sunny delight
Type of Stitches
DMC Anchor Madeira Cross stitch, Did you know the cow is a symbol
fractionals, of fertility, wealth and health and
Z blanc 2 2402 white backstitch, French is revered in India where they are
purple knots allowed to wander freely along
` 156 939 2702 black Ease of Stitching streets and beaches? And it sure
dark grey Intermediate is easy to adore ‘Sunny the
W 310 403 2400 light grey Cow’ (J-7217) with her
tan Clever garland of florals,
J 317 400 1809 very dark grey shading big brown eyes and
lovely long lashes.
4 318 399 1801 black TOP TIPcBthoaCaachrkksaleorscseetethpicetotrrcyhre,htoeasuoadetdersfeiafttbptec’ahsaohciecltsismkshasisadupbtmndolietdsrcett’thsaooenst From PANNA*, the
grey kit costs £21.40
H 434 310 2009 for a 19.5x25.5cm
white (7½x10in) sized design.
k 3799 236 1713
Prima ballerina
Backstitch in one strand Prices and info correct at time of printing
With stars in her eyes and a starry
––––– 310 403 2400 wand, Hermione hamster takes to
the stage in frothy blue tutu and
––––– 414 235 1714 satin ballet shoes in a design from
Hrisis’s Art* that’s too sweet!
French knots in one strand Ballet Stars Hamster Art (19-15),

O blanc 2 2402 £7.45 is stitched
on 14-count
STITCH COUNT 44 high x 43 wide aida using 17
DESIGN AREA 14 HPI (28-count evenweave) colours. The
– 8x8cm (3x3in) finished design
is 11x14cm
STITCHED BY Stephanie D’este (4¼x5½in) and
the kit includes
This design was stitched using DMC stranded cotton a colour chart.

Mother hen

Surrounded by the primroses
of spring, a clucky hen keeps
a watchful eye over her brood
of fluffy yellow chicks. ‘Hen’
(SSN39809) by RIOLIS from
Stitcher* is a heartwarming
scene that’s just right for the
kitchen. Stitched on 14-count
beige aida with
Anchor cottons,
the design
is 30x30cm
(12x12in). The kit
costs £40.99.

www.gathered.how/woxs TheWorldofCrossStitching 25

since 1877

We stock a great range of kits, here are a selection, please visit
our website for more designs along with other craft supplies.

Flower Pot – £19.00

PREMIUM NEEDLEWORK FABRICS Elephant On Cloud - £9.90
100 % MADE IN GERMANY

Magic Owl – £21.50 The Lobster Pot - £20.50

Free UK P&P on all orders over £15

cottonclubcrafts.com

ZZZ JROGOHDIQHHGOHZRUN FR XN

ĞĂƵƟĨƵů ƌŽƐƐ ^ƟƚĐŚ ĞƐŝŐŶƐ ĂŶĚ ĐĐĞƐƐŽƌŝĞƐ

ůŝnjĂďĞƚŚ / Highland Family - Four Seasons ,ĞŶƌLJ s///

<ŝƚ άϮϮ ŚĂƌƚ άϳ <ŝƚƐ ĨƌŽŵ άϮϬ ŚĂƌƚƐ άϲ ϱϬ <ŝƚ άϮϮ ŚĂƌƚ άϳ

^Ğƚ ŽĨ ϰ ŬŝƚƐ άϳϱ ŚĂƌƚ WĂĐŬ άϮϯ

Experience the world of ZWEIGART® premium sŝƐŝƚ ƵƐ ĨŽƌ Ă ŐƌĞĂƚ ƌĂŶŐĞ ŽĨ ƌŽƐƐ ^ƟƚĐŚ <ŝƚƐ
ĨĂďƌŝĐƐ ǁŝƚŚ Ă ƵŶŝƋƵĞ ƐĞůĞĐƟŽŶ ŽĨ ƉůĂŝŶ ĂŶĚ ƉƌŝŶƚĞĚ ůĂĐŬǁŽƌŬ &ĂďƌŝĐ &ůĂŝƌ ŝĚĂ dŚƌĞĂĚƐ ĂŶĚ ĐĐĞƐƐŽƌŝĞƐ
AIDA, evenweave, canvas and linen weaves. All
ĨĂďƌŝĐƐ ŐƵĂƌĂŶƚĞĞ ďĞƐƚ ƌĞƐƵůƚƐ ĨŽƌ ĚŝīĞƌĞŶƚ ŬŝŶĚƐ ŽĨ ůĂĐŬǁŽƌŬ &ĂďƌŝĐ &ůĂŝƌ ŝĚĂ D ƚŽŝůĞ dŚƌĞĂĚ

embroidery techniques. dŚĞ Kǁů ĨƌŝĐĂŶ ^ƵŶƌŝƐĞ Full Set of the 35
<ŝƚ άϭϲ ŚĂƌƚ άϲ ϱϬ &ƌŽŵ ά ϱϬ Ă &Y Sparkling Skeins £35
ŚŽŽƐĞ LJŽƵƌ ĨĂǀŽƌŝƚĞ ĨĂďƌŝĐƐ ŽĨ ƚŚŝƐ ďĞĂƵƟĨƵů ĐŽůŽƌ
world at www.zweigart.de/downloads.

www.zweigart.de

For stockists contact:
>ĂŬĞƐŝĚĞ EĞĞĚůĞĐƌĂŌ / ůĂŬĞƐŝĚĞŶĞĞĚůĞĐƌĂŌ ĐŽ ƵŬ
Willow Fabrics I www.willowfabrics.com
,ĞƌŝƚĂŐĞ ƌĂŌƐ / dĞů Ϭϭ ϱϳϱ Ϯϱϲ
tŽŽůǁĂƌĞŚŽƵƐĞ / ǁŽŽůǁĂƌĞŚŽƵƐĞ ĐŽ ƵŬ
^ƟƚĐŚƚĂƐƟĐ / ǁǁǁ ƐƟƚĐŚƚĂƐƟĐ ĐŽŵ

Dino ABC Project

DIBFNOUOGYN-SIRRFAOOLNASRRD

Shopping list DESIGNS BY HEATHER NUGENT

Zweigart* 14-count white aida measuring Letter-
10cm (4in) x desired length saurus
Stranded cotton as listed in the key
Size 24 tapestry needle Stitch your little one’s favourite dinosaur from an alphabet
Stiff coloured cardstock, white paper for collection that’s joyfully Jurassic with a colourful twist
backing and ribbon of your choice from local
stores TheWorldofCrossStitching 27

Thread & fabric cost

Approximately £22

*For stockists see page 90

www.gathered.how/woxs

Project Dino ABC

CCCCCCCCC999C
[CCCCCCCCCC99CC
88888888888 [CCCCCCCCCCCCCC[
88ffff888888888
f88ffff888888888 [CCCCCCCCCCCC[[CC
[CCCCC[[[[[CCCCCC
ff88ff88888uuuuuu8 [[CCCCC
ff8888866666IYYYYuuu [CCCCC
[CCCCC
6888886 66IIIIYIIuu [C9CCC
[CCCCC
68ff88 688YYIIYYYu [C99CC
[CCCCC
68fff8 6YYIIIIYYYu [CCCCC
C[CCCCC
688ff 688888IIYYYu [9999C
[9999CC99CCCCCCC[ cc
6f8888 68888IIIIYIII
[C999C999CCCCCC[[ tttc
6888888 6886I6 IIYI I
[C99CC99CCCCC[[ t< tc
688888888888886688YYYII
68888888888888uuYYYYII [CCCCCCCCCC999C t

688f88888888uYYIIIIIIII [CCCCC[[[[[999CC t<

68fff888888YIIIIII II [CCCCC [[99CCcccccct<

6ffff88666YI88ff88 I [CCCCC tttttccctt<ttt<
[CCCCtttt [<<ttttt<<t<
ffff886 I668fff8 [CCC<<tt< tt<
[[[[Ct
688888 I 68fff8 C[CCCC< <t t
[[[CC
688888 I 688ff8 [[CCCC99CCCCCC<< <

688888 I 68888 [CCCCCC999CCCC<<[ <<

688888 ff888 [[CCCCCC99CCC<<[ <

688888 fff8ff [[[[CCCCCCCCC<[[ <<

668866 fff688 [[[[[[[[[[[[[< <<

666666 6ff666

666666 666666

88fff88888888 C9999CCCCCC999C
f88fff8888fff88
ff8ff88888ffff88 [C9999CCCCCC9999 2222 2222222222
`22s2`2222222222 MMMM
ff888888888fff888 [C999CC999CCCCC9
[CCCCCC9999CCC[[ `22sss`22222222` Mpppp
688fff666Yu8f8888
Yu68866 [CCCC[999[[[[[[ `2ssss22222222`` ppnnn

68ffff YYu8886 [[CCC[ `2ssss2````````` pn

68fff8 YYY8886 [C[[CC `222s2` pn

688ff8 6uYY88 [CCCCC `22222 pn

688888 6uuYIIIYY [CCCCC ccc `22222 pn

68888 [CC99CC ttcc `2s222 pn
688866 YuuYIYuuuuY
688668 YYYI8IIIIIYYY [9999CCCCCCCCC tttt ``ss222 pn

II688IuYIII [9999CCCC999CC ttttt ``ss2222 222 pn

688888 688IuYY [C99CCCCC999CC ccctt<<tt ``222222s22222 pn

688888 6888YYY [CCcCCCCC999C[cctttt< << ``222222222ss` ppn

688888 6888IYY [CCcC99[[[[[[ctttttt< sss2222222sss`M ppn

668f88 6888IIYY [[CCc9[ tttttttt<<<< sss2222```sss`pMM Mppn

668888 6888ffIYu [[CCtc tttt<<tt< << sss222` ppppppppMMppn

668ff8 688fff Iuuu [[C9<tc ttt<tt<<<ttt `s2222 ppppnpppppppn

6ffff8 6688fff Yuu [[999<ttttt<<tt<<< t ``2222 ppppnnpppppnn

66fff8 uu [9999C<<<<<< tt< << ``2222 pppnppnpppppn
66ff8888888888886
66688888888888886 [99CCCCCCCCCCttC << ``2222ppppnpnnpppnnn
``2ss2pppnnpnnnppnn
6666888888888866 [[[CCCCCCCCCttC<<< ppnn
[[[[CCCCCCCttCC<< ``2ssspnnnnp
6666666666666666 ```sssnn npp ppn
66666666666666 [[[[[CCCCCC<tC[<<
[[[[[[[[[[<<<[[<< ```ss`n nnp nn

````` nnnn nnn

CCCCC [CC99 `22222222222222

[CCCCC [tccc9 `22sss22222s22222

[CCCCC [<<<tc `2ssss2ss22222222

[CC[C [CCC<t ``ss222ss22222222

[CC[[ [CCCCt ```22222222222222

[[CCC[ [C99tt ````222222222222

[[CCCC [99ct< ``22222

[[C99C [9Cc<C `2222

[[999CC [[CctCC `2222

[[99CCCCCCC[CCtt99 `2222
[[CCCCCC99CCC<ttt9
[[CCCCC999CC<<t<ct `22`

[[CCCCC99CC<<<t<tctc ```2` M

[[CCCCCCCCC<C<<t<tttc ``222 MMMM

[[99CCCCCCC<CC<tt<ttc `2222
`2222MMMMMM nMMM
[[999C[[[[[[CC<<<tt<tc `22MpppppppnnppM
[[CCC<<<cttc `2Mppppppppnpppp
[[999C[
[CCC<< tc tc MMpppnpppppnpppp
[[CCCC
[CCC<< tt tt sppppppnppppnnpppp M
[[CCCC
[CCC<C t t `22ssppnnpppnpppppnnnppp
[[CCCC
[CCC<C t `22spnnnnppnnpppppnnnnppp
[[[CCC
[CCCCC `222nnn22ppnnnnnpnn nnnn
[[[CCC
[[CCCC
[[[[99 ``2p2222npn2222ppn
[[[[CC `pp```22npn2222`pnp
[[[[99
[[[[[[ ````````nnnn```` nn
[[[[[

CCCCC CC tc 2ss222

[999CC CC99 ttttcc `2sss22

9999CC CC999 <<<tcc `22ss22

99CCCC CCC99C <ttt `222222

[CCCCC [CCCCCC <ttc 2222ss

[CCCCC [[CCCCC[ ttc ``22sss MMM

99CCCC [[CCCCC[[ ttt ```2sss ppM

999CCC[[CCCCC[[ ttt `2`2222 pppp

[CCCCC[CC[CC[[ ttt< `22222s p

[[CCCCCCCC[[[ ttt< `222222 p

[[CCCCCCCCCC tttt< `222222 p

[[CCCCCCCCC[ cttt< `22s222 ppn

[[999CCC9CC cccttt< `sss222 M ppn

[[999CCCCCCC cccctttt< `sss222 M pMpMppppnn

[[99CC[CCCCCCcctttttt<< ``ss222 ppppppppMppn

[[CCCC[[CCCCCtttttttc< ``22222
``2222s M MppMppMpMppnn
[9CCCC [CCC99Cttt<ttc< ``2222s MpppMppMppppnn
999CCCcc[CC999Ctt<<tc
[99CCCct[[C99CCttt<tt ``22222ppppMppppnnppn
``ss2pppppMppnpppnppp
[[CCCCttt[[CCCCC<<<<t ``sspppppppppnnnnnnpp
[[CCCCtc [[[CCCCC <<t
[[CCCCttc [[[CCC[ < t ```spppnnnnppnnnn pp

[[[[CCtttc [[[[[[ < t ss``pnnnn22pps2nn pp

[[[[[[ttttt[[[[[[ < tt sss`nn`nn`pp222nn n

[[[[[ ttt[[[ttttt t ss```n``nn````n nn

28 TheWorldofCrossStitching www.gathered.how/woxs

Dino ABC Project

2 22222sss2 Dino ABC key

22`22222sss22
222`222222ss222
`222`222222222ss2
`22`22``````2sss2 Cross stitch in two strands
``2ss2
`2222``
``22`
`2222` DMC Anchor Madeira
`````
`ss222

sss222 nn C 13 240 1210 light mint green
ss2ss2 pMMM pistachio green
`22ss2 pppppM lilac
`222s2 nnpppp M 16 254 1409 light lilac
nnpppp dark blue
`22222 blue
`2s2s2 pp npppMM purple
nppppMMM ` 210 108 802 dark pink
`ss222 pink
nnppppppMM light pink
`2s222 2 211 342 801 green
npnpppnppMM light green
`22222 orange
nnnnppnnpppMp tangerine
`22222 f 518 1039 1106 yellow
n`pp2pnnpnnnpp light blue
``2222 dark mint green
``2p2nnpp pp mint green
``22222 6 519 1038 1105
``222222222222ss2n pp nn black
```222222ss22ssss n p
```22222sss22s` n p black Dawn
````2222222`` n p s 553 98 712
READER PANEL
``````````` nn pp < 602 57 702
I’d stitch these
t 603 55 505 alphabet letters for
the children I care for,
c 605 1094 613 they love dinosaurs.
I’d make them really
ff88888888 n 702 226 1306 colourful and frame
and hang it up in the
8fff88ffff888 p 704 255 1308 main entrance of our
68ff888fff8688ff nursery as a welcome
66888888ff86888ff sign for the tots.
6888888666 68888f I 740 316 204

6888886 668f88 Y 741 304 202

688888 6ff88

668ff8 6ff66 u 743 302 113

66fff8

66ff88 8 828 975 1101

f6f888 8fff888

f68888 68fff8f8

f6fff8 uuu 9 911 205 1214
66fff8 u688ff888
6fff88 Yu6888886 YYYYY
[ 954 203 1207
668888 6YYu8886 YYYI Y

66888 YYYuuuuYYYI I Backstitch in one strand

668666 IYYYYYYYI

668688 6YYYIYIII

6688888 6YIIIYI IIII ––––– 310 403 2400

666888888888YY88IYY I

66668ff88888Y886I Y French knots in one strand
6666fff888Y8866II
666fff688Y666 II
66666666YYY II O 310 403 2400

688888888888fff MAXIMUM STITCH COUNT 25 high x 25 wide
6888888fff888fff8 DESIGN AREA 14 HPI (28-count evenweave)
668888ffff8888ff8 – 4.5x4.5cm (1¾x1¾in)
668888ff888868888
66668888888866888 STITCHED BY Pat Cook

These designs were stitched using DMC stranded cotton

666666666688668
6688666

688888

fff888 uu TOP TIPbEavtceahknnethcoswhrefeioytlsaerhotditinusttigrmcenhrweansealo,eslckraphkeriebennpcyeeewatshtlebikye

ffff88 uY

6fff88 Y

68888f Yuu

6688ff YYYu

668fuuuu YI IY

66uuYYYuYI

6YYYYYYYYI

YYYYYYYYYI

668fff YYIYYIYYYII
688fff YYYIIYYIYII II
6688fYIIII66YIIIIY I
668YYI888888YI8II Y I
66fff88f8888Y88II Y
66fff88ff88YY886I
66ff688888Y8666I
666666666YY66 II

668ff 68888 [999C [[CC99 222222222222

668fff 688888 [C9999 [[CC99 `2sss222222ss2
`22sss22222sss22
668fff8 688888 [CC999C [CCCC9 `2222ss222222ss222

6888888 6688888 [CCCCCC [C99CC `ss2222`````222222

6ffff88 6888888 [CCC99CC [999CC sss2222 ``22ss2

6fff8888 66888ff8 [CC999CC [CCCCC sss222 `22sss

6fff8ff8 68888ff8 [CC999CCC [CC99C `ss222 `22sss

68888ff8 68888888 [[CCCCCCCC [CC99C `22ss2 `222ss

688f8888 6688u8888 [[CCCCC99C [CCCCC `22ss2 ``222MMMM

688u88888 6888IuY88 [[CCCCC99CC [CCCCC `22222 `2``22 pMM
[[[[CCCCCC [CC9CC
6888uu88866YYYYIIY8 [CCCC[C9CCCC ccccCC `222s2 `222`2 pppM
6688YIIIYYYYYYuuYII
6688YI88IIYYIYYYuuYYY [CCCCCCCCCCccccccCC c ``2222 `22222 pn p

668II88888IuIIYYYYuuYY Y [CCtccccCCccccccccC c ``2222 `MMMMM pn

6fI888888YYYIIYYYYYYuYII 9tttttttcctttttcccc c ``2222 MMpppppppn

6fff886888886IIIYYIYYuYI 99CC<<<tttttttttcccc cct ``2222 Mpppnpppppn

6fff88688888668IuuIIYYu [[C<CC <ttt<t<<ttttttttt< ``2222 Mpppnnnppnn

668888668888668YYYIIIYYu [[99CC <<t<<<tttt<<<<<< ``2222 MMpnppnnnnnn
``M222 Mpnnnpppn22nn
6688ff66888866IIII8 IIYY [[999C [tt<<<tt<<< ``2Mppppp 2npp22`
[[C99C t<t<99<tt<CC
668fff 66886 688888 IIY <[99<tt<C[ ```22s222222nnn22`

666ff8 66886 668888 I [[[99C [[[C<t<<[ ````2222ss22nnn2``

66688 66666 666888 [[[CC[ [[[t<<<[ ````222sss2n2n``

666688 66666 666886 [[[CC[ [[[<[[<[ ``````sss`n`n`

666666 666666 [[[[[[ [<<[<<[ `````````nnnn

66666 66666 [[[[[

www.gathered.how/woxs TheWorldofCrossStitching 29

Project Dino ABC

6688888888888 CC99CCCCCC
68888fff88888888
6ff88fff88888888 uuY CC999CCCCCCC
[CC99CCCCCCCCC
6ff88ff888888888 uYYYY [CCCCCCCCCCCCCCC One
6888886666688888 uIIIII nighters
6688ff uYI [999CC[[[[[ttCCttttttt
688888 ttt<cCC tt<<<
688ff uYI 999CC[ Factb
68ff88 cctt<<cC t<
6888f YYY [9CCC
6fff88 [CCCC ccctttt<<cct< <t
68888 uYYYI
ffff88 86888uYYYYI [9Ccccctttttt<<ctt<<<t

fff888 [CCCC tttt<tt<<tttcc
6888f88888886886uYIYYI
6888888888886886IIIYYI [CCCC [tt<tt<ttttcc Stitching Time
Approx. 3-4 hours each
6888888888888886IYYYYI [CCCC [Ctt<<<tttttcc Type of Stitches
Cross stitch, backstitch,
6888888888868866YYYYYIII [CCCC [tt<<t ttcc French knots
Ease of Stitching
68888866666 66YYYYYYIIIY [CCCC [CCCt tcc Advanced beginner/
intermediate
6688886 uYIYYYIYII YY [CCCC [[[CtCC <c

668fff uYYIIYYII [CCCC CC[[CCCC c

668fff YYYIYIYII [CC[ [CC99CCCC

668ff8 u YYYYIYYIIII [C[[[ [CC99CC9C
[CCCC99C
668888u IIYYIYIIIII [CCCC
[[CCC999C
668888u YYIYIIII II [CCCC
[[CCCCCCCC99CC99CC
668886IYYYYIYIIY II [[[CCCCC9999CCCCC[
666886IIYIIIIIY I
[[[CCCC9999C[CCC[
666666 IIIY II II [[[[[CC99C[[[C[

66666 II II [[[[[[[[[[ [[

s2sss22222222 MM [C99CCCCCC99C999

`2sss222ss22ssssMppppM 8888888888 [C999CCCCC999C9999
`2ss22222s22ssssMpnn pM
`22222222222sssspn pM 68fff888f8888f [C999CCCCC99CC999C
[[CCC9CCCCCCCCCCC[
`22222`````22sss p 6ffff88fff88fff [[[CCCCCC999CCCC[[
68ffff88fff888ff8
`22222 `2222 pM 6888f8866ff688888 [[[[[[CCC999[[[[

`2222 `2222 pM 6888886 668888 [CCC999

`22222 `22s2 pM 688888 6688f [CCCCC

`22222 `2sss pM 6688888 66666 [CCCCC

`22222 `2sss pM 66688888 [CCCCC

`22222222222sss2 ppM 66688888 [CCCC

`222222s22222222 ppM 666688888 [CCCC

``2222222ss22222 ppp 66688888 [[CCC ttcc

``2222222ss2222 MMpppn 666888888 [[CCcCc tttttc

``2222222s22222 MMMppppn 666888888 ttcttttctt <<ttc
``ss22``222222 MMpppppn
``ss22 ``222222MMppppnpn 66688ff88 tttttttctttttt <tt

``2s22 ``2222ppnpppnnpn YY 668uuuuf uu ct<ttt<ttctctctttt<t
ttt<ttt<<ttttttttt<<<
``2222 ```2pppnpppnnn YuuuuuYYYYu uuu tctt<tttt<tttt<ttt<<

sss222 ```ppnnnppnnn 6888 IYIYYYIYYYYY YYYY <ttt<<ttt<tttt<<t<<
68888 IIIYYIYYYYYYYYIIY
sss222 M `ppnnpnnpp nn IIYYIIYIYYYYI II <ct<<<<t<<<<<<<<tt
sss222 pM ppn`npn2pp n 66888
668888888fYYIIIIIYII <ttt[[<tC<< <<t<
```22` pppp ``npn` p nn
`npn` np nn 666888888YIffIIIII <<tt<tCC<< <tt<
``````
nnn nn nn 66688888YI86IY8I <<<t[[<< <tt
````
66666888II6I88II [<<<[[<< <<<

666666YI66I I

`2ss `222 8ff8 66 88 [CCCC [CCC

`22sss `22222 68fff8 688888 [CCCCC [CCCCC

`222ss `22sss 68fff88 688888 [CC99 [CCCCC

`ss222 `2ssss MMM 6688888 6888888 [C999 [ [CCCCC
[[CC9C [CC [CCCCC
sss22 MM2ssss MMMpM 668f888 6888fff [[[CCC [CC [CCCCC

sss22 ppp22sss MMppMM 6688ff8 688ffff [C[CCC [CCCC [CCCCC

sss2` nppMM2222MpppM 668fff8 6888fff [CC999[[CCCC[[CC999

`22`22 nnppMMn2MpMM 6688ff8 6888fff [CC999[CCCCC[[CC999 cccct

`2``22 nnnnnppM 6688888 6ff8888 [CCC99CCCCCCC[CC999ctttt<

`2`2ss p npnnnn 6668888 6fff88 [CCCCCCCCCCC9CC999cttt<<

``2sss ppnnpnnpps 668888866uffu8 999CCCCCCCCCCCCC9ttt<<<
`ppppp 668888868YuYuuYu
``22ss n 9999CCCCCCCCC9ccctt<<
`pppMM 6688886u8YuYuuYu
``s222 9999CCCCC[CC9cttttt<
nppppM 688886YuuYuYuYu u
``2222 999CCCCCC[CCttttt<<t<<
nnpppMp 66888YuYuIIIIIYuu
``2222 [[CCCCCCC [Ctc<ttt<tt<
`nnpppMM ff8uYuIIYYYYYII
``2222 [[CCCCCCC tttc<ttt< t
`22nnppM fffYIIYYYYYYYYI Yu
``2222 [[CCCcccct<ttc<t<<C
`22222 6fuuIYYYYIYYYYYY YIIY
sss222 [[CCc<<<<<<tc<<<<CC
`22222 66YIYYYYYIIYYIYYYYI
sss222 [[Ctt999 <t[CC<<CC
``22222 uu 6IYYYIIYYIYIIYIII
ss`2sss [[C<999 <t[C<<<CC
```2ssss2```222222 uu IYYIIIIIYIIIYYI
````ssss222222222` IIIIIIIY88III YI [[CC999 <t [[<<CCC
[[[CCC[ <t [[<<CCC
````22222222222` 66686IYI YI <tt [[<t[[
[[[[[[
``````2222222` 66666I I YI <<< [[<t[
[[[[
```````````` 66666III III

2222 `2ss2 668 6 6688 [[CCCC CCCCC999
[[CCCCCCC999CC999
`22222 `2ssss 668866 668888 [[CCCCCC9999CC999

`22ssss `2sss2 6688868 6688888 [[CCCCCCC99CCCCCC

`22ssss `22sss2 6688868 6688888 [[[[CCCCCCCCCCCCC

``22sss `222222 6688688 6688fff8 [[[[[[[[CCC999C[

``2sss2 `222222` 6888f88 668ffff CC9999[
668ff88 688ffff
nn22222 `22222` 68fff886688fff [[C999C[
`nnpp22`22222` MMM
ssnpppp2222` pMMMM 6fff886ff888 [CCCCC[

sssnnppp222` pMMMM 66ff88fff888 [C9CCCC[

ss2nnnppM2 pMMMMM 688888ff88 [CCCCCC[

`222`nnpM2 ppMMM 6688888888 [CCCCCC[

`2222`nnpM ppppMpp 688f8888 CCCCCCC[
CCCCCCCC[ cccc
`s22222npnM pnnnpp 668888uuuu uu cctc

`2222222npnpMn np 688uuuYYuuu Yuuu CCCCCCCC[ ctcccc

`2222``2npnnn 68uuYYYYYYYIIYYu 99CCCCCC[ cctctc

`22222```nnnpn 6uuYYYYYYYYIYYYY u 9999CCCC[ cccccccc

``22222` n2nn22 uuYYYIYYYYYIYYYYu 9999CC99[ ctcc<<<<tttt

`22222` `222222 uYYYYYIYYYYIIYYYY [999CC999
[CCCCC999C999cc<<tttttttt
`22222` ``2222s u uYIIYYYIYYYYYIIIYYYu [[CCCCC99CC99c<<ttttt<t<<
Iu uIIIIYYIIYYYYYIIIIYYY
``22222 `2222ss IIIIII68YYIIIIIYII IIII [[CC[C[CCCCCttt<tt<t< tt

``22222 ``22sss 66IYI6 YYI [[[[CCCCCC<<<tt<<<<t<

```2222 ```2sss 66IYI6 YIY C [[[[CC<<<CCtC<[ < <

````2` ```2ss 66IIII II [[[[[[[[[[[[<<<< <<<<

`````` ``````

30 TheWorldofCrossStitching www.gathered.how/woxs

Your Questions Answered

Ask the experts

Our panel of professionals is here to help you with CONTENTS
your cross stitch dilemmas – however large or small
32 IN THE SPOTLIGHT
Fiona Baker Heather Nugent Hannah Erskine Jenny Barton Hannah Fletcher Cross stitch designer
Jenny van de Wiele
Our Technical Editor Heather is a cross stitch A lifelong stitcher, our Design pro Jenny has All set to hunt down
Fiona is ready to solve designer and multi- Charting Assistant been creating projects those elusive charts 33 WISHES GRANTED
any stitching dilemma crafter – she’ll help you Hannah can answer for us for years and is and products, Hannah’s Jenny’s designed a blonde
and answer all your transform your stitching any chart or stitching ready to take on your here to find shopping German Shepherd
technique questions into finished items related questions design challenges answers that you need
34 FRIENDLY ADVICE
Help from crafters on
stitching with a disability

34 TECHNIQUE FOCUS
How to stitch Bebunni
designs onto Afghan fabric

35 DESIGN ROUND-UP
Find four religious designs
in this holy collection

College congrats College congrats A Hannah F: Congratulations
Older students will to your friend – that’s a
appreciate this Q I need to find a pattern for brilliant achievement! How about
graduation design an adult graduation card this simple yet stylish design from
suitable for a mature student CrossStitchBonanza* on Etsy?
– have you featured any suitable ‘Graduation Cap 5’ is available as
patterns or do you know where a PDF instant download pattern,
I can purchase one? All the and at 8.5x8.5cm (3¼x 3¼in) on
patterns I can find are aimed at 14-count fabric is a great size for
young kids or teenagers. My a graduation card. The PDF
friend is about to graduate from contains a symbol chart, key with
college aged 54, which just DMC, Anchor and Madeira
shows you are never too old to conversions, and a separate
learn new things! I’d love to stitch alphabet chart for personalising it
my friend a special card with a with your friend’s name and
classic design that’s relevant to graduation date. It’ll be simple to
her, to show my support. swap the colours of the tassel to
L Marriet, via email match her college colours, too.

If the shoe fits… If the shoe fits…
You might find old
Q I’m trying to find a chart for an ABC editions of WOXS online
of shoes but I don’t know which back
issue it might have featured in. Would a
digital copy of either the magazine or the
alphabet chart be available?
Maureen Enge, via email

A Hannah F: We did feature a lovely
‘Shoe ABC’ designed by Joan Elliott
in issue 154, but unfortunately our digital
issues don’t go back that far so we’re not
able to supply you with a copy. You might
be able to find an old physical copy of the
magazine on online marketplace sites such
as eBay – just remember to check that the
seller is reputable before you buy.

www.gathered.how/woxs TheWorldofCrossStitching 31

Your Questions Answered

In the spotlight

JENNY VAN DE WIELE, DESIGNER

Eager for spring Spring’ (£3.71) Eager for
patterns available spring
Q I’m looking for a nice set of designs to buy as PDF downloads on my
for spring cards. It doesn’t seem a Etsy store, www.homestitchness. Jenny provides
popular thing to stitch for, but I really like etsy.com. They’re both part of signs of the
the autumn harvest designs in issue 298 seasonal sets and, while not new season
and I’d like a similar set to send this year. specifically card patterns, are a
Rebecca Wiest, via Facebook great size to stitch and mount on your
chosen card blanks. ‘Spring Blossom’
A Jenny says: I’m so pleased you measures 9.5x12cm (3¾x4¾in) and
enjoyed my harvest card set! I love ‘Signs of Spring’ 7.5x7.5cm (3x3in) when
your idea of sending springtime wishes stitched on the suggested 16-count
cards – I like to send cards for all sorts of fabric, and both designs include a DMC
eventless occasions, too. As you liked the key. Do check out my store for other
harvest set so much, you may be interested designs that may be suitable for your
in some of my other designs, like these springtime stitching, too.
‘Spring Blossom’ (£4.73) and ‘Signs of

Sizing up fabric waste

Q Why is the fabric size in your shopping lists so big in
comparison to the size of the stitching? I find I waste a lot
by following these measurements. Am I missing something?
Abby Planter, via Facebook

A Heather: Our shopping lists indicate what’s needed to
stitch the design as per the model in the photos, which can
vary depending on what it is. For example, a framed project will
have 15cm added on top of the aperture measurements – this
ensures there’s enough fabric to mount it in the same size frame
as our own. If, however you wish to make yours up in another
way or use a different size frame, just adjust the measurements
to suit. Remember, it’s better to have too much than too little.

Needle needs, sorted

Sweet fractionals Q What’s the best way to needle and sizes for
Two stitches in the same work out what size comparison. It also has
square maximise colour needles are? I have a big to-scale graphics, so you can
collection of all the different simply lay your needles on top
Sweet fractionals sizes in a needlebook but to easily identify them when
nowhere does it say on them viewing the guide at 100%.
Q I was a cross stitcher a few years back, but I took up the size, like on knitting
bowling and my stitching suffered. Since lockdown I’ve needles or crochet hooks. Needle needs, sorted
gone back to my cross stitching and am really enjoying it Chris Pike, via Facebook Size up your tapestry needles with
again. I’m stitching a sampler of sweet peas and have come this handy go-to guide
across a problem – if a stitch has two symbols in it side by A Hannah E: You’re right,
side, or bottom and top, how do I stitch these? Chris – tapestry needles
Linda Strachan, via email are just too small to have the
size gauge marked on them,
A Fiona: I’m so pleased to hear you’ve rediscovered your which does make them tricky
love of stitching, Linda. The stitch you describe sounds to keep organised. This means
very much like squashed fractionals – these can be either side you’ll need to work it out by
by side or top and bottom, as you mentioned. You should eye if you haven’t kept them in
work these as a full cross stitch, but as suggested by the their original packages,
name, they’re squashed into just half the area of a normal unfortunately. The good news
stitch. These stitches are best worked on evenweave or linen is that John James Needles*
fabrics, as you’ll find it difficult to pierce an aida block have a free super-handy
accurately. Hope you enjoy your new project! ‘Needles Guide’ on their
website, which lists all types of

32 TheWorldofCrossStitching www.gathered.how/woxs

Wishes granted German
Shepherd
Request a design and our resident design
expert, Jenny, might just chart it for you… Melissa
requested this
handsome
breed of dog in
blonde colours

German Shepherd key

10 10 Cross stitch in two strands

lll l7 DMC Anchor Madeira
3 01 397 1805 very light grey
lll lh7

Q I would love a chart l777l lh;7h
of a blonde German l;47h
7l77l lh4l4h j 02 398 1709 light grey
lhJ4lh 4 04 235 1801 grey
10 hll77l W 310 403 2400 black
hl4l7l J 317 400 1714 dark grey
Shepherd dog, please can you l 435 1046 2010 dark tan
h4JJlll ll3J4l7

create a design for me? 7lJlhhhhhhl;3Jl7
h7lhhhhhh7hh;ll7

Melissa Martinez, 7lhhhhl7ll7hh747
7h;7;hhll7;;h77h

via Facebook h;hhj;hl7;hh;l7h
7h7h47;l7hllhhl7

A Jenny: With pleasure, 7hhlWW47h7l4WW7hl7 7 436 1045 2011 tan
Melissa! It was lovely to 7hllWWl7hh4WWllh7l ; 712 926 2101 light cream
hhlll7hhhhllh;;77 h 738 367 2013 cream
pick the threads to convey the ;jhllh7hhhhh;;;;7 X 3727 1016 2610 plum
Backstitch in one strand
;hjl47j7hh;;;3;;h ––––– 938 380 2005 brown

honey tones of this fine breed, h;hj4ljj7j4j;;3;;
;3;4j4jjjj44jj;;hh

just stitch in shades of tan and ;;;3jJ4j4j34j3;;7hh
;;3;jWJ4Jjjj3;;h7h;h

cream to get the same effect. ;;3;jjWWJ43jj3;h7;h;7hh

I used grey and black stranded 10 ;;333j443j43;;7h;h;h7h7h
cotton for the dog’s features,
;;;3XXXX4j;;7h;;hhh7hh7hh STITCH COUNT 30 high x 26 wide
;;3;XXXXj3;;7;h;;h77h;h7h
;;;3XXXX3;;7hhh;h7777h;77 DESIGN AREA 14 HPI (28-count evenweave)
– 5.5x4.5cm (2¼x1¾in)
and a brown thread to outline ;hhhXXXX;;77hh;;h7h777hh7
him. At 30 by 26 stitches, it’s a ;;hhhXXX7777hh;hh7h7hh77h7
;;;hh7777hhh;h77h7hhhh77h

quick-to-stitch mini portrait. This design was stitched using DMC stranded cotton

Please note: Jenny can only fit in fairly small designs and for copyright reasons she is unable to chart logos, or characters from films and TV.

On lacing A lighter shade of pale STITCHING
Each thread colour has
Q When framing differences – even white HELP!
finished projects is it
best for it to be stretched A lighter shade of pale Don’t forget to send all
and laced professionally, or your stitchy questions and
have times moved on and Q I ran out of white thread of different shades in a single design requests in to us!
better ways been found? in a kit so used my own colour, even white! DMC, for Email us at:
Beverley Loach, but it’s a slightly different example, produce three white theworldofxstitching@
via Facebook shade – a bit darker! How are shades that in some lights immediate.co.uk
there differences in white and appear identical, but stitched Write to:
A Fiona: We usually is there anything I can do side by side will show the Ask the Experts,
recommend lacing the about it now that it’s stitched? difference more clearly. I’m The World of Cross Stitching,
fabric at the back, as some I don’t want to unpick it all but afraid there’s little you can do Immediate Media Co,
mount adhesives aren’t it’s very obviously a different for your work already stitched. Eagle House, Colston Avenue,
acid-free and could shade. Please help! If it is too noticeable to leave Bristol BS1 4ST
discolour the fabric over Christine Webber, as is, perhaps decide which Send in queries via Facebook too:
time. If you don’t feel via Instagram area of white to unpick based
confident lacing it yourself, on the least amount of stitches We will try and answer your
seek the help of a A Heather: You may be in it – so there’s less to redo. questions as soon as we can, but
professional framer. surprised by the quantity if you’re working to a specific
deadline then do let us know!
Sometimes
framers use a
spray mount
adhesive to
hold the fabric
in place, so do
check first and
ask them not
to use it.

On lacing
Lacing your work before framing
is still the preferred technique

www.gathered.how/woxs TheWorldofCrossStitching 33

Your Questions Answered

Friendly advice QUICK

We asked our Facebook fans for their tips for stitching Q&A
with a health condition – here’s what they said…
I ’d like to get the
Sarah Faulkner: I have footstool for my feet and a my hands get cross-stitch pattern
degenerative disc disease and floorstand for my stitching. cramp. for a little Christmas Furry
nerve damage. My hubby Tales mouse in a past issue
bought me a Lowery stand Fiona Christie: Support Sheila Roberts: I have – can you help?
and that, and my new clip gloves and splints are swollen fingers from arthritis Nancy, via email
frames, are the best thing wonderful for my carpal and use straight-handled
ever. I have an electric heat tunnel (in both wrists) and scissors by Fiskars. Hannah F: In our
pad to help with the pain. rheumatoid arthritis. I also December-themed issue
use a hands-free frame. Brenda Michelle: 300 (Dec 2020), we
Shari J Sinclair-Forbis: Reading glasses, an OttLite featured a cute little
I suffer from accelerated Claire Thomson: Daylight lamp and a magnifier mouse dressed like an
psoriatic arthritis, so I stitch Compression gloves help with helps with my vision. elf designed by Lucie
with my feet up and wear my chronic pain condition, Heaton as part of her
compression gloves. I also use as does my seat frame which Find us on Facebook Furry Tales series. The
a CBD ointment on my hands I clamp my hoops to. I take and join in with the series is available as a
prior to putting on the gloves. regular breaks to rest my chat. If you’re lucky, digital back issue via our
joints and to prevent pain your tip might appear Apple and Android apps.
Ruth Houghton: I have from building up. here! Just log on to Alternatively, you can
fibromyalgia, so it’s a case www.facebook.com/The find quite a few different
of making sure I’m sitting Hannah Salmon: A WorldofCrossStitching Christmas-themed
as comfortably as possible hoop helps me with my and hit ‘like’ at the top mice designs on Lucie
– a pillow for my back, a dyspraxia, if I don’t use one of the page! Heaton’s* website, too.

TECHNIQUE FOCUS KNOW-HOW

Afghan Bebunni limited by thread quantities. Therefore, Elf Monty Mouse
instead of stitching over two strands of your Lucie’s popular series
Q I’m trying to find a cute bunny design, Afghan fibres, stitch over four – this creates a includes a festive Monty
large enough for the centre of a baby stitch double the size, and therefore the
Afghan. I love the Bebunni character kits but design area listed for each of these patterns W hat are the threads
I don’t think they’ll be big enough. I’m also will be double, too. Stitch using four strands that are sparkly but
reluctant to buy the whole kit because I of thread to provide enough coverage. not full-on metallic? I find
doubt there would be sufficient thread metallics frustrating to
included to work it bigger, and I want to Afghan work with, but I saw some
customise colours as well. Any guidance you Bebunni nice soft cotton ones with
can give me would be greatly appreciated. Try Hannah’s just a few fibres of sparkle
Joolz Morgan, via email method to fit in them, but I can’t seem
designs onto to find them again now.
A Hannah E: This is such a sweet idea! Afghan cloth Lucie Machin,
I’ve had a look through our archive and via Facebook
have found the following Bebunni designs
that you might be interested in: ‘Stitching Fiona: These sound
Bebunni’ (233, Oct 2015), ‘Bebunni in like DMC* Étoile threads
Daffodils’ (241, May 2016) and ‘Bebunni – they’re six-stranded
Holding Roses’ (267, May 2018), all of which skeins, exactly the same
are available as digital back issues via our as standard DMC threads,
app. It sounds like you’ve got quite a large but with added sparkly
Afghan, so try stitching over double the fibres as you describe.
strands of fabric to make the design bigger.
As these are charts only (rather than the kits
you were originally looking at) you have a bit
more freedom to experiment as you aren’t

34 TheWorldofCrossStitching www.gathered.how/woxs

Your Questions Answered

Design round-up Religious
designs
We’ve hand-picked a selection of kits and charts
on the theme of faith, from pictures to prayers…

LUXURY KIT £29.69 SERENE STITCH Prices and info correct at time of printing

JESUS WITH HIS MOUNTAINS
ANIMALS
£4.20
T est your stitching
skills with this B old and effective, this design from
beautiful portrait from LiftedSpiritPatterns* will make a dramatic
Janlynn at Stitcher*. centrepiece for any room. Work a scene of trees and
Filling the entire design mountains using whole stitches and just thirteen
area on 14-count white colours. Easy to download as a PDF colour chart.
aida, the bucolic scene is
brought to life with cross Stitch count: 100 wide x 168 high, 18x30.5cm (7x12in)
stitch, backstitch and on 14-count white aida
half cross stitch. Animals
including lambs, bunnies
and little birds make it a
perfect celebration of
Easter. Includes a clear
chart and full
instructions to guide you
every step of the way.

Stitch count: 126 wide x 168 high, 23x30cm
(9x12in) on 14-count aida

SPECIAL GIFT MODERN LOOK

ISAIAH 40:8 PRAYER

T his kit from Stitch with Susie* on Etsy has cream T his cheerful Design
aida, thread, needles, a chart and instructions, and Works kit from
you get a few fab extras – a 5in bamboo hoop, felt for
finishing off the back, a ‘Handmade with love’ label, Stitcher* features birds
and twine for hanging. This little wreath design is sure
to bring comfort with its central Bible verse. and blooms around the

Stitch count: 74 wide x 74 high, 11.5x11.5cm (4½x4½in) central message, ‘Prayer
on 16-count aida
changes everything’.

Detailed enough to satisfy

an intermediate stitcher, it

uses whole stitches,

backstitch and French £17.09
knots, with coloured
beads to bring a touch of

extra dimension to some of the flowers. If you’ve

too many pictures on the wall already, this inspirational

phrase is just the right size to be made into a beautiful

cushion instead – add some bright fabric to set off the

gorgeous colours. The kit contains 14-count white aida,

stranded cottons, beads, needle, chart and instructions.

£25 Stitch count: 140 wide x 140 high, 25x25cm (10x10in) on
14-count white aida

www.gathered.how/woxs *For stockists see page 90

TheWorldofCrossStitching 35

Project Mexican Lady

ESCAPE
TO SUNNY

CLIMES

Warm up your www.gathered.how/woxs
winter with the
colourful mosaics
and lush produce of
this Mexican lady’s

kitchen

36 TheWorldofCrossStitching

Mexican Lady Project

DESIGNED BY LESLEY TEARE

Recreate this beautiful Mexican kitchen where the lady of
the house is rolling tortillas amid nature’s bounty

P erhaps it’s the grey drizzle Factb Bright
of a British February, but the and
warmth of this vibrant kitchen
is calling out to us from the page and colourful
inviting us into this homely scene.
Surrounded by succulents and tropical Stitching Time
fruits, and with a cascade of chilli Approx. 85 hours
peppers growing around her window, Type of Stitches
this woman has the perfect place to Cross stitch, fractionals,
prepare meals for her family, against backstitch
a backdrop of sunlight and colourful Ease of Stitching
crockery. Thanks to Lesley Teare’s Advanced beginner/
brilliant design skills, you can stitch up intermediate
your own little piece of paradise and
escape the cold winter by travelling well as fractional stitches throughout
to Mexico in needle and thread. the design to add detail and bring a
wonderful definition to the curved
You’ll be working in 32 glorious edges and shapes. The beautiful
shades of stranded cotton, using thread colours of this densely-stitched
whole cross stitch and backstitch, as project will be a joy to work with,
right up to the very last stitch.

Meet the designer

Lesley Teare

I’ve always relished working on portraits of
international ladies – especially when my love
of colour can take centre stage. This woman’s
kitchen is as much the focus of the design as

she is, as she goes about her daily tasks.

www.gathered.how/woxs TheWorldofCrossStitching 37

Project Mexican Lady

50 40 30 20 10 10

70 yyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyiyyyyyyyyiyiii{{{77777{{{{{7yyyiyiiiiii7777777777777777777y7yyyyyiiiiyyyiyyyyyyyyyyyyyyiiiiiiiiiyyyiyyyyiii{{ii{{{{7PPP7SSS{{7yyyyyyyyiyii77yyiiiiiii7777777777777iiiiiiiiyyyiyyyyyyyyyyiiiiiiiiiiiiyyyiiiiii{{{ii{{{7PPPPSSSS7iyyyyyyyyyyyiyyyyiiii777777777777777777yiUUUUiiyyyyyyyyyyyyiiUUUUUUUUiiiiiyyiUiiii{{PPPiSSPPPPPSSSPUUiiyyyyyyyyiyyyyi7777777777777777777777777Uyyy777UUUUUUUyyyUyi7777777777777777yyyiiPPPPSSSiPPPPSSPiiiiiiiiiiiUUUkkk44kkUUUiiiyyyyyyyyiiUUkUkksPsUUU77777777777777k4[[4kkkUUiiiiiiiiiissiPPPPSSSPss{{kPUkks[[skkkUiiyyyyyyyy77UUUkkk44kkUU7UUiiyyyyyyyiSikUUU7777777777777[4kkkUUiiiiii``isssiPPPssS7sss{{{iU[[[4kkkUiiiyy7Ukkk4ss4kkkUUy77yyyyyyyyiUkkks[[[[skkUykUUU777777777777kUEk7iiii``SSSss``Psss77sss{{4[[[[Ukffks[4[[[skfkfkUEyyyEkUiyyy7yyy7UUkkk4ssss4kkykUy7EiiiUUUU77777777777issii`SSSs```Psss77ss{sUUUEEEkUyyyiikU7kfffUUUUUUfffkkUyyyyi7Uk[[[4ssss4[[[kU77UkkEEEUUkUi7UUUU7iiss```SSSS```PssP```7skkkEkUUEkkkUiiyyiUUkkkfUU44kkUUUfkkkUyUkkyyi77Ukk[[[UUUUUU[[[kU77777777777kkii7``777ssssSSSSs````7kk44UUkkkkkkUU44kkUiyiiUkkssUU444kkkUUsskkUyyi77UUkk[[UUuuuuUU[[kkU777777777777U{{7ssssSSSSsssSSPPUk4[[U7kkuikkkU[[4kUiyiiUks[[Ukk44kuukkU7ui[[skUyyi7Ukk44UUuussuuUU44kkU777777777777ss7`SSSPss777SP7777U4[[[Ukku{EukkU[[[4UiyiiUs[[[U4kkukkuk{EU[[[sUyyi{7Uk4ssUuuskksuuUss4kU77777777777777``PP``77SSSS77{{{77U4[[[UkkuEEukkU[[[4UiiiiUs[[[U4kku{kkukU[[[sUyii7U4sssUusk44ksuUsss4U7777777777{{PP```7SSSS77{{{777Uk4[[UkkkPukkkU[[4kUiiiiUks[[Uk44kuukPukU[[s{kUyii77U4sssUusk44ksuUsss4U7777i77777{7PP``{{SSSPPP7{{{777777Ukk44UUkkkkkkUU44kkUiiiiUkkPssUU444kkkUUsskkUyii7Uk4ssUuuskksuuUss4kUi777777777P7{{{{{PPPPPPPP77{{{77777UUkkkEUUkkkkUUEkkkUUiiiiUUkkkfUU44kkUUfkUUyyi7Ukk44UUuussuuUU44kkUii777i7777kk{{{{P{PPP77Pi77777iiUUkk[[UUuuuuUU[[kkUUiiiyyUkkfffUUUUUUfffkk7Uiiisiii888888eeeeUUEEEkUsU77777{{{{7s7f777777iiiiUkk[[[UUUUUU[[[kkUiiiiyyUUkffks[[[[skUk7fSUiiiiZZZ88Z888eeJ[[JEEUUU77777{{{777UUPPPPUU``7SS7iZ[[4s[ss4[[ks777777iU7iiiUUk[UUUUUU```UssSUiiiyyyyUUkks[[[[skkkUUiiZZZZZZZZZZ88eWJ[[JJvbU7777777777SSSkiPPPssssUUsSSS7ss77777bbbbbvJJEEWe8ZZZZZZZZZZZZiiUUkkks[[skkkUUyiyiyPiyiiUUkkk4ssss4kkkUUiiiii7777Pis777iiiiiiiyiiU77777iiiiiiiUUUkkk4ss4kkkiPUPsssssPPPPUUsUUkksskkUUUisiZZZZZZZZZZ8ZZeJJEEJvvbbbbbbbb7777PsiiZ77iii7iiiii77ibbbbbbbbbbvvWJUUJeZZ8ZZZZZZZZZZ7ZisiUiUUUUUUUUiiPiyiyiiiiiiiUUUkk44kkUUUPPPsssePPPPPssUiZiieeeeSPPPeSeS7777iiiiiiiiiiiiUUUUUUUUiiiiiiieiiiiiiiiiiiiiiiiii888ZZZZ8ZZZZ8ZZeJUUJWvvbbbbbbbbbbbbbUUiePPPPPeeePPSSeebbbbmmmmmbbbbbbvWW[[WeZ88ZZZ88ZZ888WWWiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii777777SiPPPPeeePe77i777iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiU[[WW88ZZ88ZZZ8ZeJ[[JWvbbbbbmmmmmmmmmbbSSSPPPPeeePPePSSmmmmmmbbbbbbbbbbvWJEEJe88ZZ88ZZ88WEE[[WWiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii777i77P777PPeeePPPePPPmPmmmbbbbbbbbbbbvvvWJEEJe8ZZ8ZZ888WWEEWW88iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii77777777777PPiUUWe88Z7777777777iiiiiiiiiiiiiiiiiiiiiiWiiiiiiiiii8iiiWW888WWWUUWWe888PePPPPeeevvvvvvvvmmbbbbbbmmPPPPWePPPPeemmmmbbbbbmmm6666ee666b66666888888eeW[[UUW88b8888WWWiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii7777i7777iWbbWWWii77777777iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiibPPPPbee8888WW[[WWeee666666eeeeeee66e66UUmmmbbbbbmmmbbbPPPPeebbbbbmmmUUU6e6e66eeZZZZeeeeeeeeWEEWW888bbbbbmbbbWWWWiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii7777777miiiiiiiii77777777iiiiiiiiiiiiiieeeePPmbbiWWWWiiiiiiWWWbbbbbbbb888WEEWeeeeZZeeeZZee6eeeee6UUUUUmmmbbbbWbW77i77iiiiiiiii7iiiiiiiiiiiWWWWiWWWWWWWiibbbbbbbbb7bWWWW88mm8WUbUWeZZZZeZZZZeZZZZZee66UUUUeeeeUbbbbbbbebbbbbbb7777i7iiiiiibiiiiiiiiiiiiiWWWWWiWWWWWWWWWWWWmWbbbbbbbbbbbb88WUUWeeZZZZZZZZZZZZeee66UUUIIeeeemmeeebbbbbbbee8eeIIIIU6eeZeeZZZZZZZZZZZZW[[W88bbbmmmmmbbbbbbWWWWWWWWWWWWWWWWWiiiiiiiiiiiiiiiiiii77i777mebemW7777iiiiiiiiiiiiiiiiiiiWWWWWWWWWWWW7W[[W88bbmmmmZbbbbvvvvWbbbWZZZZZZZZ8eeZZee6UIIIIee88eebbbbbbmm8m8ZWbb88eI8IIIU66eeZZZ8ZZZZZZZZZZWEEW88bmmmmmbbbvvebbbbbbbbbWWWWWWWWWWWWWiiiiiiiiiiiiii7iii777778v888mmmbbbb8777777777iiiiiiiiiiiiiiWWWWWWWWWWWWWWWbbbbbmmbvvvbbmmmmmb88WEEWZZZZZZZZZZ8ZZeee66UIIIebbbmm888ZZZee88ebbbibbbWWWWWWWWWWWWWWWiiiiiiiiiiiii77777777mmmbm8bZZeZZ88eIIIUU6beZeeZ88ZZZZ8ZZZZZZWUUW88bmmmmbbme88vbvbmmmmmmmmbbbWWWWWWWWWWWWWWiiiiiUiiiiiiii77777777mZbmee88888ZZZeZ8eIIIIU6eeZeee888ZZZZZZWUUW88bmmmbbbvv8beeem88777777iiii8iiiUUUiiiiWWWWWWWWWWWWWWWbbmmmmmmmmmm8Z8ZZZZeZZeIIIIU6eZZZeeZ888ZZZZZW[[W88bmmmbbvvmimmmmmmmmmmbmkWWWWWWWWWWWWWWiiiiiUUUiiiiii777777mivvbbmmmb88J[[WZZZZ88ZZZZZZZee6UIIIIeZeZZZZ88Z888eeeeeme8e8embbbmmWWWWWWWWWWWeWWiiiiiiUUUiiiiii77777788ZZ88ZZZZZZeIIIUUeeeZZZZZZZZZZZZWEEJ88bmmmbbvmmmmmmWmmm777777iiiiUUUiiiiiiiWWWWWWWWWWWWWWmmbbb7J88bbmmbbEmmmmmbmmbEWZZZZZZZZZZZZZeeUUIIIeZZZZZZZZZe88e8eve88beJ777iiPP7inUiiiiiIIUUe7ZZZZZZZZZZZZWUUJ88bbbmbevb7mmmmmmbbbJbbmmmWWWWWWWWWWWWWWiiiIeZZZZZZZZee88e88e88Ze777PPUmmvbbbbb88JUUkZZZZZZZZZZZZeemPniiiiiii7i7ii7WWmmWmbbJbbm7mmkWWWWWWWWWWZ8eeZZZZZZZZZZIIUeeee8e8Z8U7nn7P7iiiiiPiiiiiiiWWWWWWWWW7WWWWmmmmmb7[J88bbbbv[vmUbmmmmbJkZZZZZZZZZZeeeiZiiiZZZZZZZZZZeeZe8e8888vZ8bi8mmmmmmmmmmmWWWWWWWWWWbWWiiiiUUiiiii77nnn7777bWbi8e88ebZ8Z8ZZZZeZZZZZZZiiiiiiieeZZZZZZZZZZZk[[J888vvvveWiiiUiiUiiinninn77777iiiiiiiiiiieZZZZZZZZZZiWEEJmmJ88JJemWWbmbbbZZmZZZZZZZ88vZZ8mm8888ZZWWWWWWWWWWWWmmW{WiZZZ88ZZe8ZZZZiiiiiiiiiiZZiiiiiiZZZZZZZZZWEUUJJeZeWWWbbbbvvbbmmmmmmWWWWWWWWWWWiiiiiiiiUUinnnii77777eZZUWWWJvWiUiUUniiiiiU7777PPinni8ZZZ88ZZZZZ8WWWWWWWWWkmmmmmbbvJbbbiiWWWWZZeeeeeeeeeeeekUUWWiiiiiiiiiiiiiiiiZZZiWmiWPnnUUUUiiiPnniiiiWWWWWP77iWWWW77Weeeee88888ZZZWEiiiiibbJvbbmEmmmmmWWWWviiiiiiiiiiiiiiie88ZZZZZZZZZWiiiWbWivWWWWWW7777PPPWiUUUUiiiiWnnniiiiiWiiee88ZiiiZiiiiiiiiiiivvvvZWWWEEWW8888888Z88ZZiiiiiiiZZiiiiimvbbmimmmWviWWWWWWWWWiiiiiinnninnniiUnPP77777iiemmmbiiiiiiiiiiiiie8ZZ888888ZZJ[[JJWZvbbbvvviiiiiiiiiiiiiiiiiiZZeZmviW77in7ininniiiinnniiiiiiiiivvvbbbbbvJJ[[JJZ888ZZZZiiiiiiWiiiiiiiiiiWWWWWWWWnWiiiiiiiiiiiiiiiiiiiiiieeeevinn777ininnniiiinIUUUUiiiiiiWWWWWWniiiWiiiiiiiiiiiiiiiiZZZZZZZJEEJJvbbiiiiiiiiiiiiiiiiiiiiiivvvvbbimbmiiiinnn777niiinniiiiiIIUUUiUUUiUiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiZZZZZJEEJJbbbbbmmmbbbvvviiiiiiiiiiiiiiivvvvvbbmmvmbbbbbbmkJUUkZZZiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiUUUUUIIiiPPPiiiUUUUUUU7nnUUiiiiiiiiiiiiiiiiivZbmmmbbbbbbbmmkkUUkyyyyyyyyyyyyyyyyyyyyyiyyyyyyyyyyyUUUUIIIIyyyyyPPPPyyyyUUiUUUUUiiiiiiiiiiiivvvvvvyvbiiiiiiiiiivvvbbbbbbbbbbbsbbmmmmmyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyPPPyyyyyyiUUUiUUiyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyymmmmmbbbbbbbbbbbvvyyyyyUUUUUPPiiiiyyyyUUUUiiZZiiiiiiiivyyiyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyynnyyyyUUUUUUUUUyyyiiPPPyiZiiiiiiiivbbmmmbbbbbmmmmZivPPPPiyynnUUUUUUnnnyynnnyyyyyyyyyyyyyybyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyiyyyyiiyyimmmbbbbbmmbvZiiiiiiiiZUvUniPPivibmmbbbbmmibiiiiiyyyyyiyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyyUUnnynyynnnyUUUyyniiiUUUiiivbbbvvbmmmbbbmmmiiiiiiiyyyyyyiyyy7WyyyyyyyyyyyIyyyyyyyyyyyyyyyyyyyyyyyyyUUUUUUUUUnyynnnyyyyyyyyyiiiiinyIbbbbbUmbbbmmUmmiiiiiiiiiyyyyyyykkG7W444444444888nffffff8eUUUUUUI6666666UUUUUIII6666nnn666i6666666iin86666666666n666666666eI6IIUIIUU66666IUUUUUUe8ffffff888MMM4M44nW7Gkf[M44ymmbiiiiiimiiiiyyiyyimmmmmUUUvimiGnn6664444444M886JJJJJ8eUUUUUUI6666J6666666eeUee66Ue6666UUU6UUUUUW7Gf[[Gyi77yiiiiiiiiiiiiiimmmbmmmv4UUibUJJ8eUUUUUII6666666666eeJe66eUUUUUUUUUUUIInn6666JJJU888M4M4M4UUWiGkf[GGi7iiiiiiiiiiiiiiiiye74mvmmmmimbbi666nnn66IIIIUiIUIUee6666eee6666666666IIUUUUUe8JJJJJJ888884444IIUUJGkkflGW77yiiiiiiiiiiiiiiiiivbmmmmmiiinn6n666666eiiiiiiiiiiiiiiiiiiy77WGl[f6GiJUIII444M48888ffffff8eUUUUIII66666666ke66eeee6666eeeenmimmbbvii
60
50
40
30
20
10

10
20
30

Mexican Lady chart (top left)

38 TheWorldofCrossStitching www.gathered.how/woxs

Mexican Lady Project

20 30 40 50 Mexican Lady key

6nnn66nnnneeeeeeeeeeiiib666eeee666666666IIIbbUUUUe8ffffff8884444M4IIIUWiGf[[lGW77yiiiiiiiiiiiiiiiiiiimiiiiiPP66{{66666nUUUUUeeee66eeee666666666IIUUUUUe888888888444M4VVIIIUWiGkf[lGW77yiiiiiiiiiiiiiiiiiiiiiiPPP6{{{6666eIIIUUUUeee6eee666666666IIUUIUUe888888844444MVVVVIIUWiGkkflGW77yiiiiiiiiiiiiiiiiiiiiiiiiiieP6{{{666ePeeIIIUUUPUUeVVVV4444488888688eUUIUIII66666666eeeee8IIuWiGkf[lGW77yiiiiiiiiiiiiiiiiiiiiiiiiiiuV6eeeeeneeeeee66e6ee666666666IIUIUUe8888888884464VV6VVVuuJyGf[[lGW77yiiiiiiiiiiiiiiiiPiiiiiiiii{{6664PieeeeUUUUeee6e6eee666666666IUUUI68888888888844V6VVuuuJyGkf[lGW7yyiiiiiiiiiiiiiiiiiiiiiiiiii66666V66666eeIUUUUe6e6eeee666666iiiieee666666IUUIe88888866886nnV666eiiiii88444VV6VuuuJyGkkflGW7yyiiiiiiiiiiiiiiiiiiIiii6nnn666666666eeeeeIIUU6e66eee6666e66666IUIe88888888888844VVVuuuJiGkf[lGW7yyiiiiiiiiiiiiiiiiiiiiiieeUUUUUUUU6666nnnneeeeee66eee666ee666666IIe88888888888888444uuuJiGf[[lGW7yyiiiiiiiiiiiiiiiiiiiiiiiiiie666UUUUUUIeeeeeeeeeee666eee666eee666666I66666666`n`4``4444UuuWiGkf[lGW7yyiiiiiiiiiiiiiiiiiiiiiiiiiin`nUIIeeeeeeeeeeeee666eee666eee666666666666666````444M4IIUUWyGkkflGW7yyiiiiiiiiiiiiiiiiiii444iiiiUU466nn6eeeeeeeeeeeee6666ee666eee66666666666666``4`44e44MIIIUWyGkf[lGW7yyiiiiiiiiiiiiiiiiiiii44444ieM666nnnn66eeeeeeeeee6666ee6666eee6666666666666```444MM44IeIeWyGf[[lG77yyiiiiiiiiiiiiiiiiiiiiiM{{{4n6666666666UeIeeeeeeeeee666ee66e6eeee6u666669966````MM44M44IIIIWyGkf[l777yyiiiiiiiiiiinnnnnniiiiiMM{{eeeUUUUUUUUU66eeeeeeeee666ee66ee66eeuuu6666pe99`````MM44444IIIJyGkkfeUUUUUU9UUUUUUUeeiiiinPPnnnniiiMM{G7777yiiMMMMMiiHHeeeeeeee6eee6ee66kH[u66666pp999`e```44444EEiHJyekfHHH777yiiiiMMMMMMMieeee66UUUiinnPPPnnnniiMUeIIIIGe6`666nnn6666666UUUeeeeeeeeeee6eee66e66HH[uuu6666pp99GG````HHiSEEiHJySSHHHHW77yiiiiiiMM{{MMMMMnnnnPPPnnnn66nnnn6666UUUUUeeeeeeeeeeee66ee66euu[[uu6669966p99lGGGGHHHiEESiH[[SSHHHHW77yiiiiiiiiMM{{{{MMMMnnnnPPnn6nnnnnUUUUUI6eeeeeeeeeeeeeee6ee66eeuuuuuup699996pplllGGGGHiESSiHEE[SHHHHW77yiiiiiiiiiiMMM{{{{{MMnnnnPP6nnnnUUUIU666eeeeeeeeeeeeeee6eee6uuueu6u66pp9999u9lulGGGGGiSSSiH[[[[HHHHW77yiiiiiiiiiiiiMMMM{{{{{{{nnn6nn4UUII66666eeeeeeeeeeeeeeeeeee6eu6eu666666p9u9uuullllGGGySSEyHSSSSHHHHW77yiiiiiiiiiiiiiiiMMMMM{{{{{{n6666PPPP666eeeeeeeeeeeeeeeeeeeee666e666666666u[[u[uullGGGySEEyHuSSSHHHHW77yiiiiiiiiiiiiiiiiiiiiMMMMMMP6666PPPPP66eeUUUUeeeeeeeeeeeeeee666e6pppp66999u[H[ulllGGGyffSyHuuSSHHHHW77yiiiiiiiiiiiiiiiiiiMMPPPPP66666666PPP6UUUUIeeeeeeeeeeeeeeeeee66ee66pppp6uuukH[[ulGGGyfSSyHff[SHHHHW77yiiiiiiiiiiiiiiiiiiiMMMMMPPH66666666UUUUUIIeeeeeeeeeeeeeeeeeUUUUUUU66pppppu[[H[ulllGGGySSSyMMMiiiiiiiiiiiiiiiiiiiiiiiy7WHHHH[[[[Hy6666nUUUUIeeeeeeeeeeeeeeeeeeUUUUUIIe666666699[uu[lullGGGySSfySSSSHHHHW7yy66iiiiiiiiiiiiiiiiinnnnnnPPPGP666nnn666666eeeeeeee{eeeeeeeenUUUII666e6666696upu9ullllGGGySffyG[SSSHHHHW7yyiiiiiiiiiiinnnnnnnPPPPPPPlnnn6666666666eennnee{{{eennnneeeeee66666u66u66pp99nllllGGGyffSiG[[SSHHHHW7yyiiiiinnnnnnnPPPPPPPPPPnnn966nnnn6666666nnnnnee{{{eneeeeeeeeee666u6uuu66p9994lllllGGGyfSSiGff[SHHHHW7yyinnnnnPPPPPPPPPnnnnnnnn44l4444444nnnnnnnnnnnnnnnnnnnnyiWHHHH[[[[GyESSyGGGGlll6`9999uu[u[uu66eUUUUUUUUUee{{{eeennnnnn666666nnnnnPnnnnnn466666nnnnneeeee{{UUUUUUUUUUUUU66u[H[u6996`````lG`GGySEEiHSSSSHHHHWiyyiiiiiiiiiiiiiii4444444PPPInnnnn664UU6nenneennnnneeeIIPIUUUUeeeeuu[HkH[[u6``````lG``````EiH[SSSHHHHiiyyiiiiiiiiiiii44444PPPPPPPP`nnn66666UUUUeeeeeeeeeeeeeeeeeeeeeeeee6uu[H[u666`````l44G``````HHHH4SSHHHH4iyyyiiiiiiii44444PPPPPPP444`iU66nnn66IIUUUennnnnneeeeeeeeeeeeeee666Huuu[6u6````````lG```H`U44444444444444l4444444zzziyii4yyiiiiiiii4````````66u6u6u66UUUU666n666IIUUennnnnneeeeeeeeeeeeee6liiiiiiiiiiiiMMMMilGHHHll4444444zzzzyyyiiiiiiiiP`4````llll44``````````666666666UUUenneeeeUUUUUUUnnneUIIeennn6UUUIIU6444zzzzyyyiiiiiiiiiiiiiiinnnnMMPPPPP6666IIUUU66PPeeIIeeUUIIUUUUUUUUeennUUUUUUU666`````````````````4444444zzzzyyyiiiiiiiiiinnnnnnnMMPPMMMMM6666666IUU6PPPPeeeeeeeIIIIUUUeeeeeeIIUIUUUUU6````````````````44444444zzyyyyyiiiiiiiiiiiinnnMMPPMMMMnnnyyyyzz444444``nnnnnnMM``````````MPPMiiiii````UUUUUIII6iiiiiiiii666eeeeeeeeey6666666eeeeeeeeeePPP6666PP4446644zzyyyyy````````i```````i`6```666iiiiii6i66666666eeeeeeeiiiiMMMMnnnnneeeeeeenneeeeePPPnn666P6666 Cross stitch in two strands
Mexican Lady chart (top right)
DMC Anchor Madeira
www.gathered.how/woxs
Z B5200 1 2401 white
yellow
u 18 297 113 soft green
light green
M 164 240 1209 black
terracotta
[ 166 279 1611 grey
pine green
W 310 403 2400 dark green
green
v 407 914 2312 sand
cream
J 413 401 1714 very light blue
dark peach
{ 505 210 1312 blue
dk forest green
9 580 267 1608 dark orange
parrot green
p 581 280 1609 peach
orange
y 677 886 2207 dark ginger
light ginger
z 746 275 2511 forest green
dark straw
8 747 158 1104 straw
dark blue
b 758 868 2313 light blue
dark grey
f 807 169 1108 turquoise
ginger
P 895 1044 1405 dark purple
purple
U 900 326 208 light purple
apricot
n 905 257 1412
dark ginger
m 945 881 2309 dark grey

I 947 330 205

H 975 355 2303

l 976 1001 2010

4 989 241 1401

7 3045 888 2103

i 3046 887 2206

E 3765 168 2505

6 3766 167 1109

k 3799 236 1713

e 3811 1060 1101

G 3826 1048 2306

S 3834 101 2609

s 3835 98 712

` 3836 90 2713

V 3854 313 114

Backstitch in one strand

––––– 975 355 2303

––––– 3799 236 1713

STITCH COUNT 140 high x 112 wide
DESIGN AREA 14 HPI (28-count evenweave)
– 25.5x20.5cm (10x8in)

SKEINS NEEDED 2x3046 (straw)

STITCHED BY Angela Ottewell

This design was stitched using DMC stranded cotton

TheWorldofCrossStitching 39

Project Mexican Lady

40 HHHfffiffffPPHfiHHPffPPP7UUnHHnUUnnniHPPPP7PfffffffPfnHnnfiHnHHHnnHHHnHiiHnnHffPPP7PPfP7fPPnnfHHHHHHinnnnninHHHHHUiHf7{PPPfPfPPfPSSSSfHiSiUHH[nHHHHiHSHHHHHHfHfPPHPpPHppSSHf{[[UiHHHHHHHH{{PPiPiSHHHHHHPPf{{S{PHHippPpPiS{SSiPHHGHH[UnipPHPPHPHHU{nnpHHH{ippUiS{PSi{HGPHiGHPHpPpnSnpPiPHGSniGHHPPPUHiHP{{{iHHHnnHHHHHSHHiHUppHpHpSGGGiSUnnHnsPPPPP{{PHiPiSiHUUpinySUSHUPHSnHiHHHPP{GGsHGUsHPS{{SSiHHHHHHSSSGipWP{{{{sUUUsyGGHiUSSHUiHPP{s{WpWinUSSUniHGGGySyHHHHHHHHypppppsPPPSUWW{nHHHGnHHyppUH{iyPppppyGGGHinnGGGGHyzssssHUnHniWssyGGGHinnnWn{HPPPPHPznnsHssGy7UGPHP7yGGGHinnnGPnGGyGWJ[PUsynU[[WnyJPGPsPHyHGGsGHPiPPsllsznU[nGGl[PP[{{{JWyUi7HU[[[yHGlllGGGlGHznnnssysi{7[P{nHynU[[yHlG{{llVlGGznnnsGUJssyGWUn[yHnnUnillVUyHGGGyzWW{VlG{{{{snnnnlsUyHlnn{lllVyGz{W{UUUnss{nWyGGGHPl{innnlVySVlGzUUUnsUnnlGGHHinnUyWsWPPlPUUiHUWWPPSPeeeGyynHnnnlnnlniGHzUHH7nlUSVVSlllSSUiWllSyVPlPGznnnneVnniGeHPSHHP7USPylllVVSllSSSUSSSnSiHiGHH7nnPPUSPPePzP6HHHSniSn7SnppzllHSPPP6PPPPPnnUSyllVVlUP6PPPPnnnylllVlllPzppSSSS7HHHH7nnnnPlPllypppSSS7HHlHllllllllllPPPy66UPHPPn6P6PP66PP666PyllllllllVllH7lSSSlplpylllpWW6P666PP6666PeppyllpplllVllWWGllllllllll666666PeP6P66PlyUlVVlUUpplWWGllllllllll6G66eeP66PPGWpWlUGUylVVllVll{666llll6Ul66G{PPeee6{{lGWkGGppp{llll666666{6ll{[{y66{666eee{l{[[[{W{lG66{{6666666lypppGGG{k{M{666M66666666ee66eGGGJWGl6{{6{{[[[{{[{66eee6{M[{6n{{ll{[MMJ{666GGG{6lM6[MW[{f6Mnee6nf{{{{n6MeUUUM[M6M6[{lllGW6MWGJl6l46WMee66nnbMM4Mnn{M{{pUUUW666WG{llJWGl{{{{n6nnbbbb6nMk{{Mnn44Mp6666WWGllJWG{[[[[UpnbbbbbnnnbU66p99U944nnUMl{WJGllJWMG{{{{99M9nbbb4WUlJW44G4nnMMn4499lll[[Ul94999UWG{m9bbmb[[{llGWJllV999[9p944MMMn4444p4{[9{ppmnbmmbbMM44444499[ppJ49WGl9{[9[Vl[{{9[{lpbm4{[{l4{[[4{lG4WJlVV999p9p9994MM444444m9pmm444e{MMMMMMM9pp[99ppp999VlkWGl{{{ll{p4ep99[[epppmp[nnn44MMMM99VkVlllllll{lWG9ellllllllWkV9999pppppp9pppM4G4nlnnnnnenp9pppe99[999WWGlnllllllln[nnn4444p[pppplpn6{{6pp44444pp{ppp9999pppn9WllllllllWnp9i94p99[9inlU9EEll{{[[4{lp94444e4[p[ppUpplp9{4[{{{{{{{44yppppp9p99ppppU999iUEE[iHHHHppe6ZZ446e[ypHHHGi[[EEUi99[[ppppppppppp4yyyEE[[9pppppppppHpp[[piGyeeH6ZZy4Hy4e9yZ6Zeyyyye6yZpp9ppp[[pGpppp9yUHHHEE[[yp9y9yeZZZZ6eyyyyHIUpGGGy[EEUUy9[p[ppppppp9Ie6IIUyZZyyyeZypy999UEpUpppppEpppyGGGHnUyGGGHnEUnessZeeyyyyIIIIUUUp[ppp[[999UyZsssyyyyyIIIIIUUeppppHGpG9uuuynnnUGzU999UIIIIIIyyyyyeZZUUUUz[[999GuuuuynnGGUUHn[[GGIUuu[[H[uuuuuznUUnInyUUUUyyyyyyIIIIGUyyyyyUyIIIIIy[uUZU[uH[G4uuuuGyzUGnUUn4sZyezyyyyyyGHIIIGyUUnIIuu[444uuunUzuuGyyyyyyyyIIu[IyzssZyHGGGyU[444uuuuuznnUU4zyyyyyyyyyuu4444uuuuuz[nnUUyGGGHzzieZue[44nn4uuzzuyyyyyyzzzieyuzu[[nnUyGGGHuiiizzzzy4yyyzzzunuu[4MMizuuUE[[nnzGGGHU4zi8zzz44MM4[[uuuzzzizziHUzEE[[nGGGUU4zU4UIUUzEEE44[[[[uuzuzzzziii[[zGGGH8zzz4[[uu[i8iuuuzzzzzzzi4IIUUzEE[zGHGH[44UI[ii8zizpHzzuuu[[uuu[H[MMMIIIIUzGyUU[[EHpiHU[HiUIyVIMMGM[uuuuu[[[uuppGynUz8MziIiii8epppuuuuuuuu[MMMMMIVVIUy[UUnnyGHHH8eiiip[uuuuu[[MM4MMpeIIVIUUUnnnyGHHHuyp
50
60
70

Mexican Lady chart (bottom left)

How to... stitch iiiiiiiiiiii4{P{MnPnnMMPMMPn44P44MPMMnnn
fractionals iiiiiiiiiiiii4PP{MnPnMMPPMPn44P44MPMnnnn
iiiiiiiiiiiii4{PPPMPnnMPPMPn4PP44PPMnnnP
Made from either a quarter or three-quarters 88888888888888888PMPnnMMPMMn4PP4MPPMnnnP
of a cross stitch, fractionals allow you to create eeeeeeeee8888888ePPMPnMMPPMn4PP4PPMMnnPn
‘rounded edges’ and more natural shapes, like eeeeeeeeeeeee888eePMPnnMPPMn4P4MPPMnnnPn
those of the lady’s arm, the grapes spilling over zzeeeeeeeeeee88eeePPMnnMMPMn4P4MPPMnnPnn
the fruit bowl and the curved edge of the plant zzzzeeeeeeeee8eeeePPMnnMMPP44P4MPPMnnPn4
pot shown here. The chart shows which detail [[zzzzzziziiieeeeeeeeeeee8886eeeeeee8PPPPPMMnnnnnMMPPPP44PPPPMMPPPPMMnnnnnPPnn444
of the design has the fractional, and the key [uiiiffeeee86eeee8PPPMnnMPP4P4MPPMnnPn4{
tells you which thread colour to use. To make [uiiffeeeee86eeee84PPPnnMPP4P4PPPMnPn44{
a fractional stitch, bring the needle up in that [uufffeeee86eeee884PPPnnMPP4PMPPMnnPn4{{
corner and down in the centre of the square, [uuffeeee86eee8e8884PPPnnPP4PMPPMnPn44{{
halfway across the diagonal. Turn to p97 for tips [[ufeeeee86eee8ee88i4PPPnPP44MPPMnPn4{ii
and, if you’re not confident with these stitches, UnyUUIIMM44MM[[[SMiMMMnMn4UIIUS4SSMM4nEiiUS44sMsSsEEniSSS4ssS`MSssfse`ss```sSSSiSnEssSsSieSSSsssss``ssnssseSss`sss`ss8esSss```ssss`s88sssssss`s8`ss`s`sssssss6``s```s`sssss`fsSf6eeeffffsSssss``See6666eSs9sss`66666666eeeee6``s969eeee6666666e77676e6e8e6e8886iiiiee888ee88yeiiiiiiiii888eeeieyyy8eeee9999999998988e8e9999999999999n88USiH999999iUnSSiHkHkHH99kSiUSHHHHnUUHHiSHlnnHlnHHiSSUnyGGllkkHHkiSUnniinnnUyHGkkklllll[UUGHy[Unnylllllll[[[GHy[[UniiU[[[iHGkkkllllinU[[illllkkkGHynnU[llliUHGUlnllnnnGHyUnnnyllkkGlllHySknnyUllGynUSSyHGkkklGyUGSSSiHGUU[GlGGGGG[[[GySSUniHGGGkkkGHySGinUninnnUyHGkkkGGGHinnU[iHHUUnGGHHnnU[[iHHHnnnHHHnU[[[iHHkkHH999
try a few on a spare scrap of fabric before you nnyHHHUUHHUHinUnHiHHHHHHHinn9HSEnikSS9SSSHiEsSEisSSssssss`ssssS``ssssSssSSsss9sSSss9sSs999ss`99`s9`999997777777iiiiiiiyyyyyyyyyyyyyy99999999999999999999p9pp9999p9999p9HH9pppp9HW9ppppHW9pppppppH99W9pHW9ppppHW99pppp99WHppp99JHppp99JHHJ99pppppp9WH9W99pppHpppp9JHp9WHpppHW9ppppH9pppppHppppp99ppppp99
tackle them in your design. 9999999sss999997iyy9999999pppppppppppppppp

Shopping list Mexican Lady chart (bottom right)

Zweigart* 14-count white aida measuring TOP TIPsBmerlcoeoltiatktiioksevnooadtstnfhoetliwtoidsthnithaenleenltwalodfipragsgnykmeiiesvdaeheelpelysesyoirgounus Like this lady, I have chillies
41x36cm (16¼x14¼in) growing on my windowsill but the
Stranded cotton as listed in the key plant is much smaller than the one
Size 24 tapestry needle in Lesley’s design. I have to stitch
Frame and mount of your choice with a this to hang on my kitchen wall –
minimum aperture of 25.5x20.5cm (10x8in) next to my chilli plant, maybe?

Thread & fabric cost SUE, SENIOR ART EDITOR

Approximately £42

*For stockists see page 90

40 TheWorldofCrossStitching www.gathered.how/woxs

Bothy Threads

New Spring Collection!

Bothy Threads Ltd., Unit 7, Aspatria Business Park, Aspatria, Wigton, CA7 3DP
[email protected] 01900 828844 www.bothythreads.com

Shop & Stitch

Our Best Buys

All the hottest cross stitch must-haves for your shopping list,
plus an exclusive offer to make your pennies go further...

New adventures £39.70

PIMCKOONFTTHHE HERITAGE PETAL POWER
STITCHES
£29.50 E njoying a flowering
W ith their refreshingly season from May to
Heritage stitches modern take on the September the magnolia
New for spring – traditional sampler, you can grandiflora is, as its name
heirloom samplers with suggests, a statement bloom
a contemporary twist always rely on Historical Sampler and this is the perfect month
for PANNA* to release their
Company* for exciting designs new design. ‘Magnolia
Cushion Front’ (PD-7287)
and their bundle of new makes a gorgeous accent for
your home, you can almost
releases doesn’t disappoint. smell the light fragrance of
the flowers decorating this
£29.50 We’ve picked just three, on the design. With star-shaped
theme of new beginnings – new petals and glossy dark
green leaves, the magnolia
baby, new home and a new symbolises purity, nobility and
perseverance so it makes a
adventure. From their Of the fitting subject for cross stitch.
Covered in flowers ranging in
Moment range, ‘And so the size to represent the different
stages of maturity, the design
Adventure Begins’ promises fun stitches up to an impressive
40x40cm (15¾x15¾in) on
and freedom, while ‘Windmill 14-count aida and will give
your sofa a fresh new look.
Home Sweet Home’ is a unique

twist on the new home sampler.

‘Bee Birth Sampler’ is the

largest, at 29x22cm (11.5x8.5in)

and each design is available as

£23.50 a kit (£23.50-£29.50) or a chart
pack (£9). Choose 16-count aida
or 32-count linen fabric.

5 fab finds... for Jewellery Dress up with stitching gems

£6.40

£63 £12 £14.70

Cat in a Hat Brooch Scissors Necklace Maker Wrist Ruler I Need Wheel Pin
Delicate petit point creates a gem of Gold acrylic snips make a statement Measure for measure, this is pretty Cake or thread? Spin the wheel to
a brooch from MonDadaCrafts*. necklace from Sew Dainty*. and practical. From ILoveHandles*. decide with Lovecrafts’* badge.

42 TheWorldofCrossStitching www.gathered.how/woxs

STRICTLY BALLROOM Shop & Stitch

TWIRLS & TULLE £60.80

F rom the popular Elegance collection by John Clayton, meet ‘Katrina’
(JLKA1591) who is dressed to the nines in a shimmering ballgown. It’s
the dresses that take centre stage in the Elegance range from Heritage
Crafts* and this garment deserves the spotlight. ‘Katrina’ has a classy,
timeless quality and could almost be from any decade. Regal purple and
soft powder blue and pink thread colours with sumptuous shading are
the stitching highlights of this 31.5x38cm (12½x15in) design. The kit costs
£60.80, with a choice of 14-count aida or 27-count evenweave.

£20 THREAD CARES SORTED READER Prices and info correct at time of printing

GOODY BAG A re your threads in a tangled, sorry mess? Are your bobbins OFFER
being pinched and worn away under the strain of your
F ans of the luxurious hand leftovers? It makes economic sense to save your stranded cottons W herever you
cream for stitchers that and treat them nicely so they can look their best when they’re choose to stitch,
really works will be overjoyed needed for a future project, so invest in good quality thread as a passenger in the
with the new Hand Love Gift bobbins. Cardboard Thread Bobbins from Cotton Clara* are a
Set from SEAMS*. Priced £20 sturdy 450gsm and printed in the UK. They look stylish too, with car, on the sofa or at the
and presented in a 100% the Cotton Clara logo
cotton drawstring bag, inside on one side there’s kitchen table, you’ll be
you’ll find a tube of Couturiers room on the back of
Hand Cream, a bottle of the card to write the assured great light with
Artisan Hand Sanitiser and a thread number. Sold
cushioned nail file. Designed in packs of six, each the Foresight LED Flexi
with seamstresses and bobbin measures
stitchers in mind, it’s never 5.5x8.5cm (2x3¼in). Arm Lights (FS-ADJ-AAA),
far from the reach of cast and So go on, your
crew at Netflix, ITV and more. threads, and your which have a simple
purse, will thank you.
clip-on function giving
£3.95for pack of 6
you greater flexibility.

Four LED bulbs in two

light heads with different

brightness settings give

you daylight-quality light

for perfect stitching

conditions. Priced £19.99

from Foresight-LED*, get

25% off (until 23 March

TIME FOR A TEA PARTY 2021) using the

and treasures T ea lovers will relish this exciting new Stitch-A-Long discount code 2SA5V%E
just released from Creative Poppy*. Lesley Teare has WCS2150
£9.29 designed 12 must-stitch china teacups that are decorated at www.
with florals, birds and butterflies, with each sure to be even foresight-
Hoop Necklace more refreshing than the last. Lesley’s love of blackwork is led.co.uk.
Adorable mini embroidery hoop on show, with decorative areas worked in backstitch, plus
necklace, Dandelyne on Etsy*. there are French knots and some fractional stitches for fine Reader offer
Save 25% off clip-on Foresight
details such as the LED Flexi Arm Lights
elegant cup handles.
The ‘Tea Cup SAL
2021’ is available as
a subscription, with
a new design being
released each month,
and the final chart on
1 December 2021.

£9.90

www.gathered.how/woxs *For stockists see page 90

TheWorldofCrossStitching 43

SAVE 27% WHEN YOU SUBSCRIBE

TO THE DIGITAL EDITION

Each issue of The World of Cross Stitching meets
all your stitching needs, with over 80 easy-to-follow
charts, features, expert advice and stories to read.

Find it packed with beautiful inspiration that
you’ll love, whatever your skill level!

Have The World of Cross Stitching
delivered straight to your device

When you subscribe
Simply return to homepage to subscribe

MAFKREORMS TOFHE ALL-NEW
SPECIAL EDITION!

A pretty and fun selection of Lucie Heaton’s favourite cross stitch

designs, including Furry Tales! Don’t miss this 132-page collection

of fantastic charts to treasure forever. Order today

for FREE UK delivery direct to your door. JUST

£9.99
INCLUDING
UK P&P*

WHAT’S INSIDE

Home decor & gift projects
Easy-to-follow charts

Complete alphabet sets
Interview with Lucie Heaton
Get ahead with seasonal charts

ORDER YOUR COPY TODAY!

ORDER ONLINE www.buysubscriptions.com/lucieheaton
or CALL 03330 162 138 and quote ‘Lucie Heaton Special PRINT 1’

UK calls will cost the same as other standard fixed line numbers (starting 01 or 02) and are included as part of any inclusive or free minutes allowances
(if offered by your phone tariff ). Lines open weekdays 9am to 5pm. Overseas please call +44 (0)1604 973 746. EUR price £12.99, ROW price £13.99.
*UK prices include P&P. Please allow up to 28 days for delivery. Offer subject to availability.

DESIGN LIBRARY

Hello ol’ bean
LET THE DESIGN BARISTA SERVE UP
THE BEST COFFEE SHOP MOTIFS
40
CAFÉ
IDEAS

Feeling parched? Stitch a reviving brew with a selection
of thirst-quenching designs by Durene Jones

40 quick-and-easy motifs Durene’s design inspiration Stitches for every skill level
Helpful tips and advice Unique present ideas for your special someone

www.gathered.how/woxs TheWorldofCrossStitching 47

DESIGN LIBRARY

CHERRY SWEET FRAPPÉ BIRTHDAY

A stitched gift tag is the cherry on top of a handmade Invite your bestie to afternoon tea as a birthday treat
pressie so whip up a cupcake (8), fray the aida edges using the Parisian-chic café front (26). Add the frayed
and attach to Kraft card along with pieces of ribbon. patch to a powder blue card along with a note to RSVP.

TEA TEASERS A NOVEL BLEND

Label up your jar of herbal tea treasures with a cute A mug and a book are perfect companions – they’re
name tag panel (9). Using tweezers, fray one block of always there when you need them. Create a roastingly
aida around the edge and mount onto Kraft card. good bookmark (20) for your next page turner.

48 TheWorldofCrossStitching www.gathered.how/woxs

DESIGN LIBRARY

AU LAIT, OLÉ DÉJÀ BREW

For those who need their morning shot before they get If a brew is the glue that binds you to your nearest and
into gear (36), stitch this sign as a reminder to the family dearest, stitch this card (12) to celebrate. Attach a pretty
and mount onto a mini canvas from craft stores. frayed patch to a piece of blue cardstock, folded once.

PERK UP! A REAL TONIC

Show you care and make someone special smile with a Stitch a patch (13) for that honey and lemon drink
funny pun (1). Using tweezers, fray the aida edges by for when you’re next in need of a throat soother. Cut
removing fabric threads before attaching to card. finished stitching to size and sew onto a mug hug.

www.gathered.how/woxs *For stockists, see page 90

TheWorldofCrossStitching 49

DESIGN LIBRARY

HHHHHHHHHHHHH

My inspiration 1 H HHll jj HHHl H

Meeting friends and family in a café HHHlHlll jj HHlHllll
is a lovely way of catching up so here’s a
refreshing set of motifs to celebrate our HHlvlHlvlvv HHlHlllll
love of a brew. I’ve included something for
everyone – the tea drinker, coffee lover and HHlllvHlvl Hlllllllll
there are a few slices of cake too.
HHlllvlHlvl Hllllllvlll
DURENE JONES, DESIGNER
HHlllvlHlvl Hllllllvlll

HHllllvllvvl Hvvlllllvlll
HHlllvvllvll Hllllvvlvlll
HHllllvllvvl Hlllllllvlll
HHllllvlHlvl HHllllllvlll
vvHHHlllllHlvl HHlHlllvllllvv
HHlllllHlvl HHlHllvllll
HHHlllllll
HHHllllHll
HHHllllll H
H HHHHlHHll
HHHHl
HHHHl
H
H jj
jj v v jj
H vvjjjjjjjjjvv jj H
jjjjjjjjj
jjjjjjjjj
HH

HH

Hj jH

2 3 Hj jH
}}HHHH
}}}}}} Hj jH
}}HHHHHH
HHH }HHHHHHHHH Hj jH
HHllllHH }HH}HH}}HHHH
HHllllHllH }}}H}}}l}}}}
HlbHlHlHlll }llllllllll} HHHHHHHHHHHHH
lllvvvvvvvvvvv
HlHbbHlHHHHHl llvvvvvvvvvvvv
Hbmmmbbbbbbbl
bmmmmmmbmmmmb llvvvvvvvvvv
bbmmmmmbbmmmb llvvvvvvvv
bbmmmmmmmmb llllll
bbmmmmmbb
bbbbb lv
;;9;ZZZ9;Z
b ;;9;Z;;9;Z
;;;9pppp9;ZZ
;;9;ZZ9;Z ;;;9pMMpp;ZZ
;;9;;;9;Z ;;9ppMMMpp;Z
;Z;9ppp9;ZZ ;;9pMMMMMp;Z j
;Z;9pppp;ZZ ;;9ppMMMMp;Z j
;Z9ppMppp;Z ;;99<pE6pp;Z j;
;Z9pMMMMp;Z ;999<E69p;Z
;Z9ppMMMp;Z ;9TTTTTTp;Z 5 j;;;j
;Z99ppppp;Z jjj;ZZZj;;
;ZZ99999p;Z 9pMMMMMp;Z jj;;;ZZjjjZ;
;ZTTTTTp;Z 9pMMMMMp;Z jjjj;;;;;;;;;j;
;ZpMMMMp;Z 9pMMMMMp;Z j;;;;ZZZZZ;;;ZZj;
;ZZpMMMp;Z 9pMMMMMp;; ;jjj;;;;;;ZZZZZj;Z
;ZZpMMMp;Z 9ppMMMMpl jj;ZZZZZZZZZZZZjj;Z
;ZmpMMp;; 9pppppppv jj;;;;;jjjjjjjj;;ZZ
;bmTpMpb 9pppppMp Ejjj;;;;;;;;;;;ZZZEE66
9bbT<ppm 9pMMMMMp EEEjjjjjjjjjjjjjEE6EE6
TTT<<9p 9pMMMMMp E66EEEEEEEEEEEEE666E 6
T<<<<9pp 9ppppppp 4 E686666666666666686 6
T<<<9pMp 99999999 E6886l66lv66l888Z86 E6
TT9pppp lvlTT<lvv E68886l6lv6l8888Z86E6
9999999 444444 llllT<llv E68886lllvlv8888Z86E6
E66 E66 433433 TTlllT<vTT E6688866ll688888Z6E
E68 E68 433433 llTvvlT<vvT E6686v6668v888Z86
E68 E68 433433 llvTvl<<vvvT EE6686vllv888Z866
E68 E68 llvvTvl<<vvvT EE6666666666666
E68 E68 4343 llvv<vvvvvMM< EEEEEEEEEEE
E68 E68 4343 llvv<pMMMMMM< EE666666666
4343 llvv<pMMMMMp< EEEEEEEEE
4343 llvv<pMMMMMp<
E68 E68 4343 llvv<pMMMppp<
E68 E68 4343 lvvv<pppppvv<
E68 E68 4343 lvvv<vvvvvvv<
E68 E68 4343 lvvv<vvvzvvv<
E68 E68 <<q<qq lvvv<vvzpzvv<
E66 E66 3Zqq<3ZZ lvvv<lvpppvv<
EE6 EE6 333 33Z llvv<lvzpzvvT
HHll Hlll lllv<lvvllll
HHH llTlll
HHH

6;j;;;;;ppMppM;j;j;jp;ppMjj;;ppj;;Mj;j;;pM;pMMppj;;lMMMMHpMjjp;jjpjHHjHHHjjHHHHHHHHjTHHlHHHH;HHHHHHjjjjj<HHll44443444444344llHjjjlj;jqjHllv66j<443444TT434ljj;;lllj;j6vvq4;lll;;;jjl44T<jj<44344ljj<H8434444v444v<<qlHq<4j4ljjj;;j;j;ll444;jjvjlj3l;;;jl44jH44l4<qv44<<4;;ljl4344444444444lv4v<<lj;jjj;;H443lj;;4j444j;jHl4;44<E844;lvv44j3JqjjJJqjJ4ljTjJJ;J;;;4vlJJJvv;4l4vvjjj33jJ4lj;;;vllvvJjj4<jjjj;jjvl;;;;vjjlj443;;;;;;jj344vvvlqjj;vvl;;;j;;jj;j<lvvv44J3;;;;;;;j34v44vvllHj;jJ;;vjj;343;;j;jl;;v;;;vlll44jjHHJjjj;;jj3j;;;;vvvH4jj4jj344444444;;;lvv;j49HM9444vHjjjj;4;jvvvvvvvvvv;pqM9pMq9TTTj;;;;lvvvp<<Tj;;;H9pMq9p9HHllllllvj;;;lvvl;;j<qqlllllllllv;;;;vv;lvqlHpM9MM44llllp9Hj;j;;;444lpp9llv;;;;vvv4vvvj;;vvl696l43jj44vvvvllHj;j;;;;vvj;;v;vvlp9v346;;;j;jHlvvvvv34jj3j4vvvvvlHj;j;;;4v9p6lvv;;;jvvv;4;vvl696v43;;44vvvvvvlj;;j;;;jvvv;;;;;jlvvvvvv444443vpp9vvv;;;;jvlvll;;;vvvv;vvvvvvvvvvvlllllj;;;;jv;;jHHHHHllllvvvvvv;vvvvjjjjllv;v;llllvj;;;;;vlvvvvvvvvvvvvllllllvH;;;;jppppMppll;ppMppj;;;;;pMpj;;;;; lvh
lvh
llv

4

443

7 lvh 444333333
llv 43
44443
4

4

4
lllvvvvvhhhhvvv

4444444444444
4333333333333

43333333333
444444444

llvhhhhhhhv
llllllvvvvvvvhhhvvv

lllllllllllvlvvvv
lvvvvvvvvvvvvvv
lvvhhhhhhhhhhhh
lvhhhhhhhhhhhhh
lvvvvvvvvhhhhvh
lvhhhhhhhhhhhhv
lvhhhhlvhhhhhhv
lvhhhhlvhhhhhhv
lvhhhhllvhhhhhv
lvhhhhhhhhvhhhv
lvvvvvvvvvvpvvl6EE
llllvvvvvvlMpl6868E
lvvvhhhhhvlMM6E68E6E

mmmllllllllllllll6E6EE8EMp
mmmlvvvvhhhhvvvllll8E6688mmmm

mmmmmmmmmmmmmmmMpm66EE8mmMpmmmmmm
mmmmmmmmmmmmmmmmmmmmmmmm

50 TheWorldofCrossStitching www.gathered.how/woxs