Cloud pleaser
It’ll be all sunny days and blue skies with
this rainbow bunting by Kelly Wilson Moore
yodoreucorofhfroiacmteee
CLOUD BUNTING
TA ICITY Add a little sunshine to your space with these
WEDIGKHT 3H.5OMOMK puy clouds and rainbow tassels. This make
would look so cute in a child’s bedroom!
YOU WILL NEED
NOTES
Q Sirdar Happy Cotton
(100% cotton, 20g/43m) The yarn quantities listed will make approx
2 balls of each: 30 Cloud Motifs.
Shower (762) Clouds are worked in rounds throughout.
Pebble (759)
1 ball of each: BUNTING Make rainbow-coloured ‘rain’ by attaching
Giggle (795) tassels to thebottom ofeachcloud motif
Sorbet (793) CLOUD MOTIF MAKE 30
Melon (794) Using Shower, ch12.
Laundry (782) Round 1 (RS)Tr in fourth ch from hook
Bunting (797) (skipped chs counts as tr), tr in next 7 chs, 5tr in
Currant Bun (756) next ch, turn and work along opposite side of
foundation ch, tr in next 7 chs, 3tr in next ch, ss
Q A 3.5mm (US E/4) hook to top of beg ch-3. [24 sts]
For yarn stockists contact Round 2 Ss in next st, (skip next st, 6tr in next
Sirdar 01924231682 st, skip next st, ss in next st) twice, skip next st,
www.sirdar.com 8tr in next st, skip next st, ss in next st, (skip
next st, 6tr in next st, skip next st, ss in next st)
TENSION twice, skip next st, 8tr in next st, skip next st, ss
in beg ss.
Tension is not critical, but it may Fasten off and weave in ends
affect the yarn quantities required
CLOUD EDGING
MEASUREMENTS Using Pebble, join yarn with a surface crochet
ss around post of any tr.
Each Cloud Motif measures approx Round 1 (Surface crochet around each tr from
7x4cm (2x1in) Round 3 to first ss, surface crochet around st
A length of Bunting with 30 Motifs below ss from Round 1) rep around, ss in beg ss.
measures approx 282cm(111in) Fasten off.
ABBREVIATIONS FRINGING Sew the clouds together on thewrong side,
Using Giggle, Sorbet, Melon, Laundry, Bunting leavinga gap ofabout 3cm between them
surface crochet ss Position yarn on and Currant Bun, cut 60 lengths of yarn, each
WS of work, insert hook from RS to 10cm long.
WS where you wish the surface Using the image as a guide, take 2 lengths of
crochet to begin, yrh and pull loop each colour and fold in half. Insert hook
up to RS, *insert hook back through through stitch at base of Cloud, pull folded
to WS in direction you wish the ends of yarn through and thread the tails
surface crochet to travel, yrh and through the folded loop to secure. Repeat with
pull up a loop, pull through first each colour across to form a rainbow effect.
loop on hook; rep from * as Trim to desired length.
required. When fastening off, pull
the final tail through the last ss, TO MAKE UP
thread onto a darning needle and Using Pebble, sew the Clouds together on the
weave through to the WS WS, leaving approx 2-3cm between each Motif.
For a full list, see page 90 Make sure to leave approx15cm of yarn at the
beginning and end of the Bunting to hang.
52 WWW.GATHERED.HOW/SIMPLYCROCHET
WnfE@#anhvxstiootnimoSkapibtitomlyedyhpioovglnooyiottkicaInhlgectomoftcpahaygegrtyoaofmtwhuee! It’s a cinch!HOOKTOHOOK
We chaelalecnhguesdintgwtohedesasimgneeyrasrtno…cowmheicuhpiswyitohuar ffaavbed?esign,
Pauline Morgan Lorraine Catterall
“For this project, I was “I’ve really enjoyed
asked to make a belt using being part of Hook to
sHoowoko.rIkdinegsitgonacblortihefintgo,
wjuhsitchoniseanveeurtyradlicoelroeunrt, design an accessory was a
kind of project for me! But fun challenge. I love using
that made this challenge all wcoatstodnelfiogrhmteydmwahkeensmanydRowan yarn arrived. It’s
vintage-style ptahtetemrnosreanedxctietixntgu.reI as,daonrde so beautifully soft! I wanted my belt design to
wanted to evoke the look of a vintage basket be fun, full of dierent textures and versatile,
of owers. I knew the beautiful textured too. I love that it can be worn tted or loose and
basketweave stitch would be perfect along wa vitahritehteytoafslsoeolsktso.”tChheefcrkonotu,tbLaocrkraoirnsei’dsewfoorrk on
awpirtehtatydorwesesr,-eits’lqluloeobkufcaknltea.sDtircapinesduamromuenrd.” Instagram at @lilliaserendesigns
Find Pauline on instagram at @makingpolly
WWW.GATHERED.HOW/SIMPLYCROCHET 53
HOOK TO HOOK
Left to right: Pauline was inspired by vintage patterns andincorporated a textured basketweave stitch pattern into her belt design, which also
features a tapered end; surrounding the buckle with flower petal-style stitchwork makes Pauline’s beltaperfect summer wardrobe accessory
FLOWER BASKET BELT may find it helpful to mark the first stitch of BELT
the round, moving the marker up as you go. Using a 3mm hook, ch16.
With a rustic woven look and floral-style You can adapt the finished length of the Belt Row 1 (WS)Tr in fourth ch from hook and each
buckle, this belt by Pauline Morgan will by working to the measurements required. ch across, turn.[14 sts]
look lovely as part of any springtime outfit This may affect the yarn quantities required. Row 2 (RS) Ch3 (counts as tr throughout), FPtr
Q Rowan Summerlite 4ply (100% cotton, Main Belt is worked in rows throughout. around next 4 sts, BPtr around next 4 sts, FPtr
For a full list, see page 90 around next 4 sts, tr in final st, turn.
50g/175m),2 balls of Washed Linen (418) Row 3 Ch3, BPtr around next 4 sts, FPtr around
Q A 3mm (US C/2 or D/3) hook BELT next 4 sts, BPtr around next 4 sts, tr in final st,
Q A 2mm (US B/1) hook turn.
Q Tri-glide slider buckle, 50x20mm (available BUCKLE Row 4 As Row 3.
Using a 2mm hook, work 64dc around buckle. Row 5 AS Row 2.
from amzn.to/3ubziIO) Make sure you work 32 sts each side of the Rep Rows 2-5 until Belt measures 78 (88: 98: 111)
For yarn stockists contact central bar. cm, ending on Row 5 rep.
Rowan 01484 668200 Round 1 (RS)(7dc, 2dc in next st) 8 times. Do not fasten off.
www.knitrowan.com [72 sts] TAPERED END
Round 2 3dc, (2dc in next st, 5dc) 11 times, 2dc Row 1 (RS) Ch1 (does not count as st
TENSION in next st, 2dc. [84 sts] throughout), (dc2tog) first 2 sts, dc in each st to
Round 3 *Ss in next st, skip 2 sts, 6dtr in next st, final 2 sts, dc2tog, turn. [12 sts]
Tension is not critical for this project, but it may skip 2 sts, rep from * 13 times more, ss to beg ss. Row 2 Ch3, tr in each st to final 2 sts, tr2tog,
affect the yarn quantities required [98 sts] turn. [11 sts]
Fasten off and weave in ends. Rows 3-9 As Row 2. [4 sts at end of Row 9]
NOTES Fasten off.
EDGING
Buckle is worked in a continuous spiral without With RS facing, join yarn in row-end of Row 1
closing off each round with a slip stitch. You of Tapered End.
Round 1 (RS) Ch1,2dc in each row-end to
SIZE S M L XL corner, 2dc in next st, dc in next 2 sts, 2dc in
next st, 2dc in each row-end down to end of
TO FIT WAIST cm 63-76 78-86 88-97 98-107 Tapered End, ss in side of Row 1.
in 25-30 31-34 35-38 39-42 Fasten off.
LENGTH cm 87 97 107 119
in 34 38 42 46
rTeolemvaanket cthoilsumpantt.ern easier to follow, we’ve colour-coded the sizing instructions – simply follow the
54 WWW.GATHERED.HOW/SIMPLYCROCHET
HOOK TO HOOK
Left to right: Lorraine’s design features linked treble crochet and puff stitches for ageometric, textured fabric that can be worked todifferent
lengths for size adjustments; tapered ends lead to tasselled ties, which can be workat the front, back or side ofthebody
TO FINISH JENNY LOVED IT BELT ABBREVIATIONS
Using a 2mm hook and with WS of Belt and
Buckle facing you, make a slip knot. Full of interesting details, Lorraine ltr Insert hook into middle horizontal bar of last
Remove knot from hook, insert hook below the Catterall’s belt has multi-textured stitches st made (or second ch from hook for your first
central bar of buckle and place knot back onto and a tassel-style tie at the back st of the row), yrh and pull up a loop, insert
hook, pulling through so the working strand Q Rowan Summerlite 4ply (100% cotton, hook into next st/ch, yrh and pull up a loop,
lies below the central bar. (yrh and pull through 2 loops) twice
Dc the straight edge of the Belt to the middle 50g/175m), Washed Linen (418) foundation ltr Insert hook into middle
bar of the buckle, working 2dc through each st. See table for measurements and yarn horizontal bar of last st made (or second ch
Fasten off. quantities from hook for your first st), yrh and pull up a
Weave in all ends. Q A 3mm (US C/2 or D/D) hook loop, insert hook into the 2 loops (V) at the base
Q Stitch markers of the stitch just made (or third ch from hook
For yarn stockists see Flower Basket Belt for your first st), yrh and pull up a loop, yrh and
pull through one loop on hook, (yrh and pull
TENSION through 2 loops on hook) twice
puff (Yrh, insert hook into indicated st, yrh and
24 sts and 13 rows measure 10x10cm (4x4in) pull up a loop) 5 times, yrh and pull through all
over linked treble crochet (ltr) using a 3mm loops on hook, ch1 to close
hook, or size needed to obtain correct tension For a full list, see page 90
SIZE S/M L/XL 2X-3X 4X NOTES
TO FIT WAIST cm 63-76 84-96 101-114 117-120 Belt is worked in long rows. You may find it
in 25-30 33-38 40-45 46-47 helpful to place markers or scrap yarn every
20 sts to help you keep track of your stitch
LENGTH INCLUDING cm 88 111.5 129.5 141 count. When working the FPhtr around a
TIES in 34 44 51 55 linked treble, insert the hook above the
middle bar of the stitch.
LENGTH EXCLUDING cm 62 85 103 115 The pattern is worked in 4 sizes, but you can
TIES in 24 33 40 45 adapt the size to match your requirements.
You will need to work your foundation row as
YARN 50g 1 2 2 2 a multiple of 12 + 6. Minor adjustments can be
made to the length of the Belt by working
Treolemvaanket cthoilsumpantt.ern easier to follow, we’ve colour-coded the sizing instructions – simply follow the longer or shorter ties at the end.
WWW.GATHERED.HOW/SIMPLYCROCHET 55
HOOK TO HOOK
Left to right: the belt is worked in rowshorizontally, soyou need to decide on the length in advance, before working the foundation linked
treble row; at theend ofthetapered ends, a chain isworked toact asa tie– it includes a six-chain loop, which a decorative tassel is worked into
BELT With RS facing turn to work down first short
edge.
Foundation row (WS) Ch3 (does not count as Row 1 (RS) Ch1,13dc evenly across, turn. [13sts]
st), fltr 126, (174:210: 234), turn. Row 2 Ch1, dc in first st, dc2tog, dc in each st to
Row 1 (RS) Ch2 (does not count as st final 3 sts, dc2tog, dc in final st, turn.[11 sts]
throughout), ltr in each st across, turn. Row 3 Ch4 (counts as tr, ch1 throughout), skip
Row 2 Ch1 (does not count as st throughout), next st, (tr in next st, ch1, skip next st) across to
FPhtr around each st across, turn. final st, tr in final st, turn. [6 sts, 5 ch-1 sps]
[126 (174:210: 234) sts] Row 4 Ch1, dc in first st, (skip ch-1 sp, dc in next
Row 3 Ch1,dc in each st across, turn. st) twice, dc in next ch-1 sp, dc in next st, (skip
Row 4 Ch2, skip first st, puff st in next st, (skip 1 ch-1 sp, dc in next st) twice, turn. [7 sts]
st, puff st in next st) across to end, turn. Row 5 Ch4, skip next st, (tr in next st, ch1, skip 1
[63(87:105: 117) sts] st) rep across to final st, tr in final st, turn.
Row 5 Ch1,2dc in each puff st across, turn. [4 sts, 3 ch-1 sps]
[126 (174:210: 234) sts] Row 6 Ch1, dc in first st, skip next ch-1 sp, dc in
Row 6 Ch2, ltr in first 6 sts,*(ch1, skip 1 st, tr in each st and ch-1 sp to final ch-1 sp, skip ch-1 sp,
next st) 3 times, ltr in next 6 sts; rep from * dc in final st, turn. [5 sts]
across to end, turn. Row 7 Ch3, skip next st, tr in next st, skip next
Row 7 Ch2, ltr in first 6 sts, *(tr in next st, ch1, st, tr in final st.
skip ch-1 sp) 3 times, ltr in next 6 sts; rep from * Row 8 Ch40, ss in bl of sixth ch from hook and
across to end, turn. bl of each ch across, ss in top of beg ch-3 from
Row 8 Ch2, ltr in first 6 sts,*(ch1, skip ch-1 sp, tr Row 7.
in next st) 3 times, ltr in next 6 sts; rep from * Fasten off.
across to end, turn. Work End on opposite edge of Belt.
Rows 9-10 Rep Rows 3-4. [63(87:105: 117) sts] TASSELS
Row 11 Ch1,2htr in each st across, turn. Cut10 lengths of yarn approx 20cm long. Hold
[126 (174:210: 234) sts] together and fold in half. Place your hook
Row12 Ch1,FPhtr in each st across, turn. through the ch-6 loop at end of one of the ties
Row13 Ch2, ltr in each st across. and pull folded ends though. Thread the tails
Do not fasten off. through the loop and pull tight to secure.
ENDS Trim to desired length.
Tapered ends are worked across the 2 short Repeat on the second tie.
edges of the Belt.
56 WWW.GATHERED.HOW/SIMPLYCROCHET
GOOD READ
Devoted designer Ana
often spends 12hours
a dayworking on her
crochet projects
Blanket stitch
Portuguese designer and creator of the new SimplyCrochet CAL Ana Morais Soares
explains her passion for big blankets, colour and how she cannot live without crochethenyouimagineanidyllicplace
where you could spend all day
crocheting, you may envision
Wsomethingthat’sverycloseto
I love all the blue and green shades of I choose pastel colours if I need to relax and
a stormy sea as well as the paradisiac strong colours if I need to cheer up. I take
colours of the beach. I love the sea’s pics of anything colourful I see in my daily
sound and smell. It really relaxes me.” life that catches my eye.”
Ana Morais Soares’s reality. When designing, Ana likes to keep her
Basedinabeautifulfishingvillageonthe COSYTOUCH options open and develop patterns
west coast of Portugal, Ana has an Ana’sbodyofworktodateincludesawhole organicallywithout,forexample,sketching
affinity with the ocean that feeds her hostofblankets,oftenworkedingeometric, themoutfirst.“I’mawfulatdrawing,”she
creativity and nourishes her soul on mosaic-stylepatterns.“Ilovebigprojects,” confesses.“Itakenotesonideas,colours,
a regular basis. “I love the sea,” she shesays.“WhenIfinishacrochetproject, andsoonandI‘draw’themwithmyhooks.”
explains. “My grandfather was a ‘sea Ialwaysgetnostalgicandmissitalot.Sobig Shealsodoesn’tgettoospecificabouther
wolf’, the name we give here to those projectskeepmesatisfiedformoretime. personaldesignstyle.“Ineverthought
men involved in cod fishing. He was And I love the cosy, snuggly touch of about it,” she confesses. “Maybe a colourful
acaptainononeofthoseshipsthatsailed ahandmadeblanket.”Infact,Ana’spassion [style]withoutneoncolours,elegantand
toNewfoundlandandstayedintheopen forblanketsissoprofoundthat,upon sometimes romantic.”
seaforalmostayear.Itwashardfishing joiningInstagram,shecreatedthe However, she does have favourite stitches
inseveretemperatures,andmanymen #mycrushonblankieshashtag. and yarns, and she’ll mix and match them to
lost their lives. I learned to respect the When selecting the colours for her come up with new projects. “I love double
sea as something that gives but also projects,Anadoesn’tadheretoahardand crochet–it’ssorelaxingtodo–andcluster
takes.Iloveitbutrespectitevenmore. fastformula.“Itdependsonmymood. stitches, which I think look like petals. I also
58 WWW.GATHERED.HOW/SIMPLYCROCHET
GOOD READ
SeTTohsaAErL1
suetaM síuL dna seraoS siaroM anA :sotohP love the texture of front post stitches. and breathes crochet all day, every day. intense period of rapid design a couple of
“I also love cotton yarn. It gives such “I cannot live without crochet,” she says. years ago as she put together the projects
for her book Cosy Crochet Blankets to
beautiful definition to stitches. I’ve used “Some days I might be very tired, but I need Snuggle Under for Tuva Publishing. “It was
acrylic a lot as it’s warmer and more resistant to sit and crochet a few stitches. It’s my such a challenge. So much joy to create all
to washes, [which is useful] with small kids relaxing moment, my me-time. I meditate those blankets, but also such a pain to have
around. Now I’m trying to reduce my stash a lot while crocheting. I’m totally dedicated them all done in only six months!”
of it and go for more sustainable yarns.” to crochet design now, but instead of a job
FAMILY AFFAIR However, her time spent designing for
Ana has been crocheting since she was “WheInaIlawfnindaisymhsisgasectirtonacohsletoattl”pgricoject, books didn’t stop there. “Last year I was also
eight years old, and grew up seeing her contacted by David & Charles Books to
mother and grandmother crocheting from Monday to Friday, I have one from design squares for the book 100 Crochet
before becoming hooked herself. “We used Monday to Sunday. I usually work more than Tiles. I came up with 10 squares and three
to sit all together after dinner chatting and 12 hours a day. It’s very absorbing, and my projects. I really like the challenge of
crocheting. It was a kind of a family therapy.” bones sometimes complain, but in Portugal designing new things, but this time the
Later in life, Ana began testing patterns for we used to say, ‘Those who run for pleasure process was much calmer!”
several designers, which in turn made her never get tired’.” For this reason, Ana’s
realise her true calling was to design herself. stitching studio has become her sanctuary. In addition to her new Talavera CAL with
“I can get there and forget a little bit about SimplyCrochet (seepage61),Anasaysthere
An Etsy shop and Instagram account the craziness happening in our world.” are many more exciting projects in the
followed in 2014 and 2015 respectively, and pipeline over the next few months, but she’s
now Ana’s online presence is going from This dedication saw Ana through an been sworn to secrecy. “Sorry, I cannot
strength to strength under her One Skein Of reveal them yet. But I will keep designing
Love brand. “Only last year I started using new things. I don’t like to make plans as
Etsy more regularly. I love reactions from I believe good things happen when we least
new crocheters saying how easy it is to expect them, but I would love to collaborate
follow my patterns. I recently also created more with yarn brands.”
a Facebook group, Oneskeinoflove Crochet. Written by Lucy Evans
I’m having a lot of fun there. It’s such a great
group with kind and helpful people, and it’s A few of her favourite things
a place where crochet newbies can get all
the attention and help they need.” When Ana’s not busy crocheting, you’ll find her…
TRANQUIL RETREAT “Quilting, reading, baking and taking walks on the beach – especially
Considering her infectious love of crochet during autumn and winter when the beach is almost empty!”
and her desire to spread the word about it, Find out more at www.oneskeinoflove.com or visit Ana on Instagram
it’s no surprise that Ana pretty much lives at @oneskeinoflove, on Facebook at Oneskeinoflove Crochet and on
Etsy at www.oneskeinoflovecrafts.etsy.com
WWW.GATHERED.HOW/SIMPLYCROCHET 59
CROCHET-ALONG
TaBllaanvkeetra
bBrirginhgt Scoplaonuisrshasnudnstheixnteuriendtostyiotcuhrehsoomf AenwaitMhothraeis
Soares’seven-part Talavera blanket crochet-along
stiLtocthseosftnoetwry! SUBSCRIBE!
GYEATRAN CPAARCOKNTURNTTHCOEOPYMAAPGRLENE3TYE6OTUTHONERECEEDACLETIOVE ALL
WWW.GATHERED.HOW/SIMPLYCROCHET 61
CROCHET-ALONG
TA ICITY Imaginative stitches and bright colours pop
WAERIGAHNT 5H.5OMOMK on thismulti-texturedblanket,bringing
forth visions of Spanish Talavera tiles and
YOU WILL NEED warm days spent by the sea. This is the rst
part of this seven-part CAL, and we’ll be
Materials are for the whole Blanket starting at the centre of the blanket. We hope
Q Caron Simply Soft, (100% acrylic, you’ll join us on this exciting Iberian journey!
170.1g/288m), 4 balls of Off White NOTES
(9702),3 balls of each:
Blue Mint (9608), Robin’sEgg (9780), This crochet-along has been designed in
2 balls of each: seven parts, worked from the centre out.
Gold (9782),Fuchsia (9764) The Blanket is worked in rounds with RS facing
Q A 5.5mm (US H/8) hook throughout. You may wish to weave in ends
Q Stitch markers or scrap yarn as you work.
For yarn stockists contact
Wool Warehouse 01926882818 BLANKET
www.woolwarehouse.co.uk PART 1
Using Gold, make a magic loop.
TENSION Round 1 (RS) Ch3 (counts as tr), 15tr into loop,
ss to top of beg ch-3, do not fasten off.[16 tr]
Rounds 1-10to measure approx10cm Round 2 (RS) Ch3 (counts as first tr of first 5-tr Part 1 ofthe blanket CALbegins with a
(4in) in diameter pc), 4tr in same st, finish as for 5-tr pc, *ch2, tr in magic loop for the floral motif in the centre
next st, ch2, 5-tr pc in next st; rep from * 7 times
MEASUREMENTS more, omitting last 5-tr pc, ss to beg 5-tr pc.
[8 5-tr pc, 8 tr,16 ch-2 sps]
Finished blanket measures approx Fasten off.
145x145cm (57x57in) Round 3 Using Blue Mint, standing dc in any
5-tr pc, *2dc in next ch-2 sp, dc in next st, 2dc in
ABBREVIATIONS next ch-2 sp, dc in next 5-tr pc; rep from * 7
times more, omitting last dc, ss to beg dc.
5-tr pc 5tr in st/sp specified, remove [48 dc]
loop from hook, insert hook in first tr, Fasten off.
place loop on the hook and draw loop Round 4 (Working in bl throughout) Using Off
stitch, ch1 to secure. To work in the White, standing tr in any st worked in a 5-tr pc
‘eye’ of a pc already made, insert hook from Round 2, tr in same st, *tr in next 2 sts, 2tr
in sp created when loop on hook is in next st; rep from * 15 times more, omitting
drawn through first st last 2tr, ss to beg tr. [64 tr]
standing sts A standing st at beg of Round 5 Ch1 (does not count as st), dc in bl of
round is worked starting with a slip each st around, ss to beg dc. [64 dc]
knot on the hook, then the st indicated Fasten off.
is worked as normal in the st or sp Mark the 8 dc from Round 3 that are worked Work in the round, beginning with a circle
specified into the tr from Round 2. Each leg of a ttr2tog st shape that will change toasquare later
cl Work all sts of a cl in the same st/sp in the foll round is worked into the fl of marked
specified, working each st of the cl up dc either side of a 5-tr pc from Round 2.
to the last yrh of each st. At this point Round 6 Using Blue Mint, standing dc in Round 8 Using Off White, standing htr in any
there will be 1 loop on the hook for second tr worked in a marked dc, dc in next 3 FPdc, htr in same st, *htr in next 4 sts, 2htr in FP
each st of the cl, plus the original loop sts, ttr2tog with first leg in fl of prev marked dc cl, htr in next 4 sts, 2htr in FPdc; rep from * 7
on the hook (for a 2-tr cl there will be 3 and second leg in fl of next marked dc, *dc in st times more, omitting last 2 htr, ss to beg htr.
loops on the hook), yrh, draw through behind ttr2tog and next 3 sts, dtr in fl of same [96 htr]
all loops on hook marked dc just worked, dc in st behind dtr and Fasten off.
ttr2tog *Yrh 3 times, insert hook in st next 3 sts, ttr2tog with first leg in fl of same Round 9 Using Gold, standing BPhtr around
indicated, yrh and pull up a loop, (yrh marked dc as dtr, and second leg in fl of next any st, BPhtr around every st around, ss to beg
and pull through 2 loop) 3 times; rep marked dc; rep from * 6 times more, dc in st htr. [96 BPhtr]
from * once more working into next st behind ttr2tog and next 3 sts, dtr in same fl of Fasten off.
indicated, yrh and pull through 3 loops marked dc just worked, ss to beg dc. [8 ttr2tog, Round 10 Using Robin’s Egg, work entire round
on hook 8 dtr, 64 dc] in bl, standing tr in any st, tr in same st, *tr in
FP4-tr cl *Yrh, insert hook from front to Fasten off. next 5 sts, 2tr in next st; rep from * 7 times
back to front around post of st, yrh and Round 7 Using Fuchsia, standing FPdc around more, omitting last 2 tr, ss to beg tr.[112 tr]
pull up loop, yrh and draw through 2 any ttr2tog, *dcbl in next 4 sts, FP4-tr cl around Fasten off.
loops; rep from * 3 more times next dtr, dcbl in next 4 sts, FPdc around next st; Round 11 Using Gold, standing dcbl in a tr
inserting hook around same st, yrh and rep from * 7 times more, omitting last FPdc, ss aligned with aFP4-tr cl of Round 7, *dtr in fl of
draw through all loops on hook to beg FPdc. [8 FPdc, 8 FP4-tr cl, 64 dc] next st 2 rounds below, skip st behind, dcbl in
For a full list, see page 90 Fasten off. next 6 sts; rep from * 15 times more, omitting
62 WWW.GATHERED.HOW/SIMPLYCROCHET
CROCHET-ALONG
last dc, ss to beg dc. [16 dtr, 96 dc]
Fasten off.
Round 12 (Working in bl throughout) Using
Blue Mint, standing dc in any dtr aligned with a
FP4-tr cl from Round 7, dc in same st, *dc in next
13sts, 2dc in next st; rep from * 7 times more,
omitting last 2 dc, ss to beg dc. [120 dc]
Fasten off.
Round 13 Using Gold, standing 5-tr pc in fl of
any dtr from Round 11 aligned with FPdc from
Round 7, skip st behind, *dcbl in next 14 sts, 5-tr
pc in fl of next dtr from Round 11, skip st
behind; rep from * 7 times more, omitting last
5-tr pc, ss to beg 5-tr pc. [8 5-tr pc, 112 dc]
Fasten off.
Round 14 Using Fuchsia, standing dc in eye of
any 5-tr pc (see Abbreviations), *dcbl in next 7
sts, FPttr2tog around dtr from Round 11, dcbl in
st behind FPttr2tog and next 6 sts, dc in eye of
5-tr pc; rep from * 7 times more, omitting last
dc in pc, ss to beg dc. [8 FPttr2tog, 120 dc]
Fasten off.
Round 15 Using Off White, work all htr of this
round in bl, standing htr in any dc worked in a
5-tr pc from Round 13, htr in same st, *htr in
next 7 sts, trfl in st behind FPttr2tog from
Round 13 (8th dc after 5-tr cl), skip FPttr2tog,
htr in next 7 dc, 2htr in 5-htr pc; rep from * 7
times more, omitting last 2 htr, ss to beg htr, do
not fasten off. [8 tr, 128 htr]
Round 16 (Working in bl throughout) Ch2
(counts as a first htr), htr in same st, *htr in next
8 sts, 2htr in next st, htr in next 7 sts, 2htr in
next st; rep from * 7 times more, omitting last 2
htr, ss in top of beg ch-2.[152 htr]
Fasten off.
Round 17 Using Blue Mint, standing BPhtr
around any st and each rem st around, ss to first
st, do not fasten off.[152 BPhtr]
Round 18 Ch2 (counts as first htr), htr in each st
around, ss in top of beg ch-2.[152 htr]
Fasten off.
a ro
.
br
o ta
e
WWW.GATHERED.HOW/SIMPLYCROCHET 63
Peach fuzz
aOirraynmgoehyaoiur wgrlaadp yboyuHsapnontatehdCtrhoisss?
soumybabtrrlnee
SUMMER WRAP
AASSYY Welcome the warmer seasons with lush The airy lace fabric is made ina four-row
WLEAIGCHET 6H.5OMOMK orange creamsicle shades in subtle ombre, repeat herringbone treble stitch pattern
perfectly displayed on this lightweight wrap.
YOU WILL NEED SAV
NOTES S LU
Q Rowan Kidsilk Haze Colour
(70% mohair, 30% silk, 50g/420m) Wrap is worked in short rows. For a more budget-friendly make, try
3 balls of Sunset (008) Use 2 strands of yarn held together as one Schachenmayr Mohair Dream: 2 balls of
throughout. Blossom (00082). Checkhooksize,tension
Q A 6.5mm (US K/10) hook Ch-1 sps count as a st throughout. and ball length if you use a different yarn
For yarn stockists contact
Rowan 01484 668200 WRAP For yarn stockists, visit
www.knitrowan.com www.schachenmayr.com
Ch51.
TENSION Row 1 (RS) Hbtr in third ch from hook and each
ch across, turn.[49 sts]
Tension is not critical, but it may Row 2 (WS) Ch2 (does not count as st
affect the yarn quantities required throughout), (hbtr in next 2 sts, ch1,skip 1 st,
hbtr in next st, ch1, skip 1 st, hbtr in next 2 sts)
MEASUREMENTS 7 times, turn.
Row 3 Ch2, *(hbtr in next st, ch1, skip 1 st) 3
Wrap measures approx 49x202cm times, hbtr in next st; rep from * across to end,
(19x79in) turn.
Row 4 As Row 2.
ABBREVIATIONS Row 5 Ch2, hbtr in each st across, turn.
Rep Rows 2-5 until Shawl measures approx
hbtr (herringbone treble)Yrh, insert 202cm, ending on a Row 5 rep.
hook in st/sp indicated, yrh and pull Fasten off and weave in ends.
up loop, pull loop through first loop
on hook, yrh and pull through 2 rem
loops on hook
For a full list, see page 90
SIMPLE STEPS HOW TO BLOCK YOUR CROCHET PIECES
1Check the yarn’s ball band 2 Using long, rust-proof pins 3 Placepins inside the last row 4 Forwet blocking, just leave
for advice on whether to dry, or blocking wires, pin out to or round of stitches, not in the to dry.To dry block, spritz
wet orsteam block your item. the measurements in the actual stitches or you risk with cold water and leave to
Towetblock, wash the item pattern (check the schematic distorting them. Insert the dry.To steam block, hover
before pinning. For dryand for garments). Start at the pin’s point towards the centre a steaming iron over the fabric
steam blocking, pin out when corners, then move evenly of the fabric, away from the (don’t touch it)untildamp,
dry.To pinout, laytheitem around the edges. You can edge, to balance out the then leave to dry.Once dry,
flat onatowelovera blanket. reposition pins if needed. forces involved. you can remove thepins.
WWW.GATHERED.HOW/SIMPLYCROCHET 65
GOOD READ
Healing
hooks
The calming, repetitive stitches of crochet can distract and soothe during
tough times.Two hooksters describe how the crochet community and the
craft itself have helped them through physical and mental illness...
GOOD READ
Clockwise from left: Patricia
wears the blanket made for
her by her Instagram friends;
Alice the Zebra accompanies
her to all of her appointments;
applique owls were “the first
project to get me truly back into
crochet again during lockdown”
PATRICIA’S STORY: hospital since my diagnosis – often I’ll be in
waiting rooms for hours at a time. Crochet
“When I crochet, I feel warm and fuzzy”hecrochetcommunitywrappedits Afterachildhoodspenttravelling,Ifinally transports my mind to a more exciting,
armsaroundPatriciaNovelliafter settledintheUKandstudiedtobecome creative place. It also distracts me if I ever
feel nauseous due to treatments.
Thercancerdiagnosisinthespringof avirologist.Crochetwasalwaysaroundin FEELING THE LOVE
2021.Below,shediscussesherfavourite thebackground,butwhileIworkedhardon The crochet community is just fantastic. I’ve
makes,howshegotintothecraft,crochet’s my careerittookabackseat.ThentheCovid always disliked social media, but after
soothing nature and how she received pandemic ended up coinciding with my I began my crochet journey a friend urged
supportandlovefromothercrochetfansin cancerdiagnosisandIneededsomethingto me to join Instagram, explaining how I could
an unexpectedplace–hooky socialmedia. distractme,sooutcamemyhooks. use it to record my yarns and patterns. Now
Ihavemorethan2,000 followers–my
NEW STRIPES SOOTHING STITCHES teenagesonasks mehowI’vedoneit!
Alice the Zebra may be a bit wonky, but she’s When I crochet, I feel warm and fuzzy. There’s FRIENDSINNEW PLACES
one of my favourite makes. You see, zebras something about its repetitive nature that I’ve made so many new friends through my
are the symbol for rare cancers and, in spring makes it incredibly relaxing. I think it’s the account. When I went in for surgery, some of
2021, I was diagnosed with neuroendocrine soothing way that the hook slots in and out my followerssentmewell-wishinggifts of
cancer. So, when I saw an amigurumi pattern of the yarn, over and over again. stitch markers and yarn skeins. Then, before
to make this little zebra, I just knew I had to AVID COLLECTOR I started chemo, they sent me a gorgeous
hook Alice up myself. Now she’s by my side at It’s not only the act of crocheting that I love – blanket to bring me comfort.
all my hospital appointments. I’m also an avid collector of crochet books
CROCHET ORIGINS and magazines. When I look at other people’s They had all hooked squares for that
I crocheted as a child and lockdown last year designs and read about the history of blanket, and the whole thing was organised
inspired me to return to the craft. I’m Italian crochet, I feel inspired and happy to be a part by Melanie Joy, aka @the.yarnicorn, through
and my dad worked for the United Nations, of such an amazing community of crafters. a secret Instagram account. Their kindness
so we lived all over the world when I was A LITTLE PROGRESS really took my breath away.
growing up. I remember first being taught I’d highly recommend other people with Follow Patricia on Instagram at
how to crochet by an American woman when cancer learn how to crochet. It can give you @crochetandcancer
Dad was posted to Afghanistan in the 1970s. a sense of achievement on a day that might
I also have vivid memories of crocheting tiny be filled with hospital appointments or
clothes for my teddies and Barbies back necessary rest. I’ve spent so much time in
when we lived in Kenya.
WWW.GATHERED.HOW/SIMPLYCROCHET 67
GOOD READ
SiyprSfhtSCnaoiatttoalpvteeeoprsoepovvvnctlrkliiiekueeeceeeilwfrnos’’’stsissstgtl:tihilccwseiSnetgaeoutsccogdaelrfthtorrrirevsikteoomiutiscssenimnrhtwpeftcl;uonaihtlvctehseesi;s;n
STEVIE’S STORY:
“Crochet pulled me through”tevieLarwood’snew-foundpassion
for crochet was her anchor as she FIRSTVENTURES crochet. But it’s comforting to know that when
My crochet journey began when I noticed I feel better, crochet will still be there for me.
Shealed from psychosis. Now, she that a new yarn shop had opened up in my HOOKY ADVICE
shares her love of the craft with others. town. I plucked up the courage to go in and Crochet can be of such a benefit to people
got talking to the assistant. She suggested with mental health issues. When I was ill, I was
AWELCOME SOLACE I come along to a beginners’ crochet under the care of an early intervention
EverytimeIpickupmyhook,I’mescaping workshop.Iwastheworstthere,butIfellforit psychosis team and I now go back to advise
intoaworldofcolourandcreativity.Crochet immediatelyandpractisedgrannysquares them on the patient experience. I’m looking
relaxes me. It’s something tactile that for a whole year, gradually improving my into how I can start workshops to help people
grounds me in reality. When I was first skills. Now, I love making clothes – particularly under their care. I know tricks such as using
recovering,IwouldworrythatIwasslipping mysignaturebobble-stitchcardigan.Iadore chunky yarn if you are feeling shaky.
intoanotherepisode.Crochetwouldreassure pastelshades,andripplestitchismycurrent LOOKING FORWARD
me that everything was OK. favourite stitch to use. As I continue on my crochet journey, I’d like to
I’ve always struggled with my mood and The crochet community helped to build me carry on teaching newbies on my social media
then,in2017,mymentalhealthstartedto backup.IsetupmyInstagramandYouTube feeds. When I was learning, I found that some
deteriorate.Ilosttouchwithreality–Iwas accountsasawaytomeetpeopleafterleaving beginners’ tutorial videos were so fast that I’d
seeing, hearing and smelling things that my hometown. They allowed me to connect get lost. I make slower videos that really take
weren’t there. I became so ill that I was with people who are also passionate about their time over the process of crochet. I’m also
sectioned due to psychosis and put on crochet – all the lovely comments and planning to go to uni and eventually want to
asecureward.Itwasaweirdandisolating messageshavereallyboostedmyconfidence. train as an art therapist. Crochet has truly
experience and I was happy when I was given me so much, and I want everyone to
discharged. I was diagnosed with bipolar NOT ALWAYSEASY understand how wonderful it is!
disorderandputunderthecareofamental Therehavebeentimeswhenit’sbeen FollowStevieonInstagramat@steviebythesea
healthteamforthenextthreeyears.Crochet physicallyhardtocrochet.WhenIfirst Written by Marianne Rawlins
wasthemainthingthatpulledmethrough.It learned,Iwasonmedicationthatmademe
gavemeapurposeandsomethingtofocus veryshaky.Ialsogetmigraines–linkedto
on apart from my illness. trauma – which wipe me out so that I can’t
68 WWW.GATHERED.HOW/SIMPLYCROCHET
TULIP CUSHION
rSepfrreinsgh
Grow a garden in your own living room with this
ower themed cushion by Florencia Campos Correa
WWW.GATHERED.HOW/SIMPLYCROCHET 69
TULIP CUSHION
WEDIGKHT H5OMOMK Rows ofblossomingowerscometolife The design is made inthe interlocking mosaic
against a cool green background on this method, working with one colour ata time
YOU WILL NEED pretty cushion. Go on, bring the outdoors in!
The stitch pattern combines double crochet
Q King Cole Cottonsoft DK NOTES with treble stitches worked into rows below
(100% cotton, 100g/210m)
3 balls of Apple(1851) Cushion is made up of one Panel, which is The cushion is made asone front panel, which
1 ball of each: sewn to backing fabric at the end. is sewn tosturdy fabric to create aback
Opal (3460) The Panel is worked in the interlocking mosaic Join Apple in first st.
Hot Pink (1848) method. There is a Chart on page 96, which Row 87 Ch1,dc in each st across.
Orange (3030) you will need to refer. Read all rows from right Fasten off.
to left. Each row is worked in one colour only. Rows 88-90 As Row 87.
Q A 5mm (US H/8) hook Where a second colour appears in a row this Fasten off and weave in all ends.
Q Cushion pad, 50x35cm will be worked with a tr2d on the next row in TO MAKE UP
Q Backing fabric, 52x36cm that colour. Each small square represents a dc Fold in a 1cm seam on each side of the backing
Q Basic sewing kit in the bl except the first and last stitch of each fabric and pin to the Panel, with WS facing out.
For yarn stockists contact row, which is worked through both loops. Sew the fabric to the Panel over 3 sides, turn so
King Cole01756703670 Where a tr2d is indicated, work the treble st RS is facing out and insert the cushion pad. Sew
www.kingcole.com into the unused fl of st 2 rows below. The first the final side close.
few rows of the Chart have been written out
TENSION to guide you.
Work all rows with RS facing, fastening off at
24 sts and 26 rows measure the end of each row.
10x10cm over interlocking mosaic
pattern using a 5mm hook, or size CUSHION
needed to obtain correct tension
PANEL
MEASUREMENTS Using Apple, ch122.
Row 1 (RS) Dc in second ch from hook and
Cushion measures 50x34cm each ch across. [121 sts]
(19x13in) Fasten off.
Join Apple in first st.
ABBREVIATIONS Row 2 (RS) Ch1 (does not count as st
throughout), dc in each st across.
tr2d Work a tr in the unused fl 2 Fasten off.
rows below Rows 3-4 Rep Row 2, fastening off at the end of
For a full list, see page 90 each row.
Fasten off.
For Join Opal in first st.
at Row 5 Ch1, dc in first st, dc in bl of each st
www.blacksheepwools.com across to final st, dc in final st.
use the code 122KC Fasten off.
at the checkout Join Apple in first st.
Row 6 Ch1, dc in first st, tr2d in next 15 sts, (dc
Oer ends 06/06/2022 in bl of next st, tr2d in next 21 sts) 4 times, dc in
Code cannot be used with bl of next st, tr2d in next 15 sts, dc in final st.
Fasten off.
any other codes Join Opal in first st.
Row 7 Ch1, dc in first st, (dc in bl of next 15 sts,
70 WWW.GATHERED.HOW/SIMPLYCROCHET tr2d in next st, dc in bl of next 6 sts) 5 times, dc
in bl of next 9 sts, dc in final st.
Fasten off.
Join Apple in first st.
Row 8 Ch1, dc in first st, (tr2d in next 15 sts, dc
in bl of next st, tr2d in next 6 sts) 5 times, tr2d in
next 9 sts, dc in final st, turn.
Fasten off.
Join Opal in first st.
Row 9 Ch1, dc in first st, (dc in bl of next 15 sts,
tr2d in next st, dc in bl of next 6 sts) 5 times, dc
in bl of next 9 sts, dc in final st.
Fasten off.
Join Apple in first st.
Rows10-86 Cont in patt set, using the Chart as
you work.
THE DYE LOT
Meet an indie dyer and indulge in a design with their skeins
Attic Spin Dye is a dyer with “I started dyeing for her own personal use sometimes I put them out to Instagram and
a difference – husband and four years ago, but I enjoyed it so much that let people suggest a name. That is popular.”
wife team Andy and I ended up with a stockpile! I decided to In the future, Andy is looking to create
Angela Holcroft are on a open an Etsy shop to sell the excess. It more classic literature-inspired yarns, and
mission to spread the word bloomed from that. Just before lockdown, wants to start using natural dyes and more
about misdiagnosed and I started to apply for shows and did the first 100% wool based yarns. “It’s always
rare illnesses. They’ve even ones last year, starting with Yarndale.” a learning experience,” says Andy. “The
created a little character, the rainbow- FEELING INSPIRED possibilities are endless.”
coloured Spot the Zebra, to promote it. Andy finds a lot of his inspiration in things HAVING AN IMPACT
This initiative comes from a very like nature, music and literature. “We have an As for their Spot the Zebra campaign, Andy
personal place; Angela lives with EDS as ongoing Alice in Wonderland subscription explains that it’s already changed several
well as a few other conditions. The couple club,” he says. “My personal favourite was a lives for the better. ”We’ve had feedback
decided to create yarn packs that contain very early yarn called Kingfishers Bridge. It from people as far away as America and
informationabout EDSandhelpraise was named after seeing a Kingfisher Spain who have seen our campaign, further
awareness about the existence of other perched on a stone and brick bridge in investigated, realised loved ones have the
rare diseases, too. Of course, this is done the Lake District. condition and convinced their doctors to
on top of creating their regular large look into it further. If we can help with
selection of hand-dyed yarns as well! He also explains that he has several yarns exposure and one more person is helped
EARLY DAYS named after the birds and flowers that [because of it], then it’s a win.”
“My wife Angela has been a knitter and inspired them. “Other colours are created www.AtticSpinDye.etsy.com
crocheter for many years,” says Andy. first, and then I find what it reminds me of. Instagram: @atticspindye
Some are based on abstract concepts, and
WWW.GATHERED.HOW/SIMPLYCROCHET 71
MARictatriioncb1S0opwsinkZeeDibnyraeset
Asditdtinaglitattloepmaavgiibcrtaonytorauinr lbifoewwbityhVtwictoolroiaveKbaiirrdiss
72 WWW.GATHERED.HOW/SIMPLYCROCHET
THE DYE LOT
TA ICITY Not only is this amigurumi project a beautiful
W4EPIGLYHT 2H.2O5OMKM make, the colourful skein set helps raise
awareness for rare disorders like EDS.
YOU WILL NEED
NOTES Work the two rainbow stripe pieces in double
Q Attic Spin Dye Rainbow Zebra crochet and then slip stitch them together
Micro 10 skein set Parts of this pattern is worked using the
(75%superwash Merino, 25% amigurumi method. Work stitches in a
nylon, 10g/42.5m per mini skein) continuous spiral without closing off each
round with a slip stitch. It may help to use a
Q A 2.25mm (B/1 or C/2) hook stitch marker in the first stitch of each round,
Q Stitch marker moving it up as you work.
Q Toy stuffing The colour of each small skein is referred to as
Q 2x large coins (optional) Dark Grey, Tweed Grey, Violet, Indigo, Light
For yarn stockists contact Blue, Green, Yellow, Orange, Red and Pink.
www.atticspindye.etsy.com
RAINBOW Use arunning stitch tosecure the ends ofthe
TENSION rainbow inside the bumps oftheclouds
RAINBOW MAKE 2 Tweed Grey.
Tension is not critical, but it may Using Violet, ch31. Ch9.
affect the yarn quantities required Row 1 (RS) Dc in second ch from hook and Round 1 (RS) Dc in second ch from hook and
each ch across, turn. [30 sts] next 6 ch, 3dc in final ch, turn to work down
MEASUREMENTS Rows 2-3 Ch1 (does not count as st opposite edge of foundation ch, dc in next 6 ch,
throughout), dc in each st across, turn. 2dc in final ch. [18 sts]
Rainbow measures approx 14x17cm Row 4 Ch1,(dc in next 5 sts, 2dc in next st) 5 Round 2 (RS) (2dc in next st, dc in next 6 sts,
(5x6in) inc Birds times, turn. [35 sts] 2dc in next 2 sts) twice. [24 sts]
Change to Indigo. Round 3 *Dc in next st, 2dc in next st, dc in
ABBREVIATIONS Row 5 Ch1,(dc in next 6 sts, 2dc in next st) 5 next 6 sts, (dc in next st, 2dc in next st) twice;
times, turn. [40 sts] rep from * once more. [30 sts]
invdec Insert hook in fl of first st to Row 6 Ch1,(dc in next 7 sts, 2dc in next st) 5 Round 4 *Dc in next 2 sts, 2dc in next st, dc in
be decreased, insert hook in fl of times, turn. [45 sts] next 6 sts, (dc in next 2 sts, 2dc in next st) twice;
second st to be decreased, yrh, pull Change to Light Blue. rep from * once more. [36 sts]
through 2 loops, yrh and pull Row 7 Ch1,(dc in next 8 sts, 2dc in next st) 5 Round 5 *Dc in next 3 sts, 2dc in next st, dc in
through 2 loops on hook times, turn. [50 sts] next 6 sts, (dc in next 3 sts, 2dc in next st) twice;
For a full list, see page 90 Row 8 Ch1,(dc in next 9 sts, 2dc in next st) 5 rep from * once more. [42sts]
times, turn.[55 sts] Round 6 *Dc in next 4 sts, 2dc in next st, dc in
Change to Green. next 6 sts, (dc in next 4 sts, 2dc in next st) twice;
Row 9 Ch1,(dc in next10 sts, 2dc in next st) 5 rep from * once more. [48 sts]
times, turn. [60 sts] Round 7 *Dc in next 5 sts, 2dc in next st, dc in
Row10 Ch1,(dc in next 11 sts, 2dc in next st) 5 next 6 sts, (dc in next 5 sts, 2dc in next st) twice;
times, turn. [65 sts] rep from * once more. [54 sts]
Change to Yellow. Round 8 *Dc in next 6 sts, 2dc in next st, dc in
Row 11 Ch1,(dc in next 12 sts, 2dc in next st) 5 next 6 sts, (dc in next 6 sts, 2dc in next st) twice;
times, turn. [70 sts] rep from * once more. [60 sts]
Row12 Ch1,(dc in next 13 sts, 2dc in next st) 5 Rounds 9-12 Dc in each st around.
times, turn. [75 sts] Round 13 *Dc in next 6 sts, invdec, dc in next 6
Change to Orange. sts, (dc in next 6 sts, invdec) twice; rep from *
Row13 Ch1,(dc in next14 sts, 2dc in next st) 5 once more. [54 sts]
times, turn. [80 sts] Row14 Dc in next 7 sts, turn leaving rem sts
Row14 Ch1,(dc in next 15 sts, 2dc in next st) 5 unworked. [7 sts]
times, turn. [85 sts] Do not fasten off.
Change to Red.
Rows15-17 Ch1,dc in each st across, turn.
Fasten off first Rainbow only.
Place Rainbow pieces together with WS facing
out, and ss the final rows together.
Fasten off.
Ss the foundation ch of each Rainbow together
in the same way.
Fasten off.
Turn so RS is facing out and stuff Rainbow
firmly. Sew the ends closed.
CLOUDS (MAKE 2) FIRST SIDE BUMP
Make one using Dark Grey and one using
Row15 (WS) Ch1,(dc2tog, dc in next 2 sts) 4
WWW.GATHERED.HOW/SIMPLYCROCHET 73
RAINBOW TOY
times, dc2tog, turn leaving rem sts unworked. Make two amigurumi-
[13 sts] style birds for thetop
Row16 Ch1,dc2tog, dc in next 2 sts, dc2tog, dc
in next st, dc2tog, dc in next 2 sts, dc2tog, turn.
[9 sts]
Row17 Ch1,dc2tog, dc in next 2 sts, dc2tog, dc
in next st, dc2tog, turn. [6 sts]
Row18 Ch1,(dc2tog) 3 times. [3 sts]
Fasten off.
SECOND SIDE BUMP
With WS facing, skip the next 9 unworked sts
from Round 13 and work Rows15-19 to make
the next bump in the Cloud.
Fasten off.
MIDDLE BUMP (MAKE 2) invdec, dc in next 4 sts, invdec, dc in next 6 sts, Thread the tail through the fl of each st of final
With WS facing, join yarn in last st of First Side 2dc in next 2 sts. [26 sts] round, pull tight to close.
Bump. Round 9 2dc in next st, dc in in each st to final BEAK (MAKE 2)
Row 1 (WS) Dc in next 11 sts (the last dc is st, 2dc in final st. [28 sts] Using Indigo, make a magic loop.
worked in same st as first st of Side Bump, turn. Round 10 2dc in next st, dc in next10 sts, 2dc Round 1 (RS) Ch1,3dc in loop. [3 sts]
[11 sts] in next st, dc in next 4 sts, 2dc in next st, dc in Round 2 2dc in each st around. [6 sts]
Row 2 (RS) Ch1,dc2tog first 2 sts, dc in in each next 10 sts, 2dc in next st. [32 sts] Fasten off.
st to final 2 sts, dc2tog, turn. [9 sts] Rounds 11-12 As Round 9. [36 sts] TO MAKE UP
Rows 3-5 As Row 2. [3 sts at end of Row 5] Round 13 Dc in each st around. Place the ends of the Rainbow into the opening
Fasten off and weave in ends. Round 14 (Dc in next 4 sts, invdec) 6 times. of each Cloud.
Rep Rows 1-5 on the last st of the Second Side [30 sts] Sew into place using a running stitch, topping
Bump. Round 15 (Dc in next 3 sts, invdec) 6 times. up the stuffing as you join.
Place a large coin in the base of each Cloud to [24 sts] Sew a Beak to each Bird, then sew the Birds on
help it stand. Round 16 (Dc in next 2 sts, invdec) 6 times. the top of the Rainbow.
Stuff the Cloud. [18 sts]
BIRD (MAKE 2) Stuff the Bird.
Using Pink, make a magic loop. Round 17 (Dc in next st, invdec) 6 times. [12 sts]
Round 1 (RS) Ch1,6dc in the loop. [6 sts] Round 18 (Invdec) 6 times. [6 sts]
Round 2 (RS) 2dc in each st around.[12 sts] Fasten off.
Round 3 (Dc in next st, 2dc in next st) 6 times.
[18 sts]
Round 4 (Dc in next 2 sts, 2dc in next st) 6
times. [24 sts]
Rounds 5-7 Dc in each st around.
Round 8 2dc in next 2 sts, dc in next 6 sts,
SIMPLE STEPS HOW TO INCREASE IN DOUBLE CROCHET
1Work a double crochet stitch 2Then work another dc, 3Continue the second dc 4Finish the second dc stitch as
as usual: insert hook into st inserting hook intothesame stitch, working yrh and pull up usual, working yrh and pull
indicated, yrh, pull uploop, stitch again. a loop ofyarn. yarn through 2 loops onhook.
yrh, pull yarn through 2 loops Once you’ve finished, you’ll
on your hook. see how 2dc stitches are
worked into the same stitch.
74 WWW.GATHERED.HOW/SIMPLYCROCHET
Join foourragacnhganocfeTtroebbleefMeaatkuerresdahnedres,huasree oyuorurhathsohutagght#s Sacntdrmebalkeemsawkeitrh us,
INN ! HQOUEOEKNSOF U L TA
Living in Here comes the ITnasgWtatueghs’reva@emhsbaimseahneptndalygdacdo#romuScCbihrtlierenetgtbmalypeaopmguinaargknmedoranukeses.
full colour Queen! Temeka
Clarence, aka SUMMER LOOKS
@tenealtextiles, Kirsty Sullivan, aka
made Her Majesty @ladybirdkirsty,
from issue 107 in adapted the ‘little
a beautiful pink black dress’ from
dress. Creating issue 118 into her
this little doll own blue creation
has inspired for Spring, and we
Temeka to start absolutely love it!
crocheting more. CHECK YES
We think she did Who can resist a cute
an amazing job panda project? We
with this regal yet can’t, and neither can
adorable make. Isabel Alexander, aka
@adventures_in_
ftfGsitraheoeubiasmmpusaolmaosinsunwas. usWoWeeitlnecli1lh’ahrs1esoie9slns.roauT,ctaarogsekklrooiaesnfuha@gcrteofma’wulmldlaagpeeydemlneittmoi.babmeceygenl.jrglaliteescesahbk!mtmreaw,tetlaeoennaottdrhkposedruoinatjeelolwicfntg crochetland. Her
creation looks very
FIN-TASTIC FRIEND handsome, too!
SQUARE EYES
Becky Urry has dipped into our 2022 calendar Katy Noble, aka
and made this gorgeous turtle from issue 117. @katys.crochet.
This little guy is the amigurumi make for May, critters, hooked up
but as Becky demonstrates, you don’t have to this granny square
wait to hook up your favourite endangered hoodie from issue
animal! We wonder if Becky will create some 120. It’s an impressive
more animal buddies from our calendar. finish, and Katy did it
so quickly! Well done.
SLEEPING LIONS
How adorable is this
lovely lion rattle from
issue 118? Emily Love,
aka @emilycatherine
studios, made this as
a gift. We’re sure it’ll
be well-loved in its
new home. So sweet!
THE LOWDOWN It’ssimpletobeinwithachanceofwinningagreathookyprizeinafutureissue!Showus
wyour Simply Crochet makes on Facebook, Twitter, Instagram or via email by 9th May.
Foralltermsandconditions,andmore information, visit www.gathered.how/simplycrochetcomps
PcntatPnICnhhonrrooOsoieendttztMmteapwabresgPcraoemiicrcnmEztapeeteTanompeur[iIerlTrstsfrsmo]atIo[aO.adrsfbniT]ntNdpaeyhtdbrnreeetrReedyaeas-Uwf.ksnsolaTpiLe]yirrah.nnEoerobaenSnTnrianlehesweTisgirtlehbe[ycseisneiPatodlh]anisrnPttooipwiynnernwmrodegiofglmoscomatoterbthoeneneoleitdodvrsttersienwrwoicatrno,anniiisfctldntatoliah[Ofenlruuismleoput]asshdtureeywaerbdeMwtepiideplonioeilntrntdodsbohreerraiemiaaesnfnfne.srtoLtaphd7rEstirueem’niedpopdctdfranirteuito.aryerolTsvonssedthfirotndotescn(ttehfohasaPeitrntheslhrrnhieoodperItemcmurerdictolwteimdolaermositein.ensleecosTtendnrtrhtitieyrionfaeeoearftrd[nsamPetserb.chr]a]rGicoy.elvwtoymrTehIoprnnhmsdeourseaoattptoehenamtpmpCregcrrpoooaeerbroatnmmxiewigmrcodrthpolsinouu,ttat.mhndiFbnCtoaieoytoytncfhsy)mreseeiolu(tsbmipmocabIosmoebasuoomtiaitmbbikllitli.tpljtjiuoeIeeoytfatrccdnhnetttteisoehayttmoeitohctnnrehoaewutleirPiihslmmrpi.resnefriuEucvbiintlznlteaaeeettcewrre1hrywni0xc2esetaPt5i2sreotano7ihenrmfaln1eistrEoco5coenapynet4ufgoeieb1(tnvrlpew5aeemtoern)dfowcnt.idottfha[whtf.nieTferneto.thdeicfammsiorlcsbaorttmymmps0ehird0leneaeoa,:dgtcmw0ooiiloa1dorronftasgfooetiatisrmrnnoeiehlg.ansa1eaTntdrd9itheyseoiareaAdiltrn.vo.epPecasTorsrnoslhoip.ul,ofumeoe2dtkwn.hP0ao/Tderpm2atoheyr2pwmaierv’rsugsioaspotneudhcmottyereioninno-rlcrspati1ro7siiemono1irsodlenj:ieeu5ndcarwr9yya,vay)psneeis.lomndsol[tcdfTnotcchoohsooutuenretuhrscrsnrbee1iheindteg7wygdn,hcMieaoototntdtofantnaiomrfysiteielichsardi2sanemiie0atdsiirsrp2eoeeeft2ainnendnbr.rcd.taebeBeiEldcteiynnohiaipbntegfenraygnstadcn,hetnosoetnetetlrrsaoeniwenrarmtccimgsis,otnsiutensrtonhsrdhgcaeeteeinrsaafs[Pprnpdutsoroedr]pomcodnpmwoumdlwnshyioeloediinttstdteiobchtirooiebeoOrFnryneraau,hesscvtrteleheaahorMrbeitervleioaneePtnpbodogsrtakloiretcratmyhtooauiLeirncontpiicmIhtrptnoeeioegansirlt,,nthtpearnhattredgslooetqtromatteauphgrbmoeroerooysfeti.frmrti]eeFoa[ba.rTnopmcy(htteaehwieseor)beesninpotlonpldoronodobrktbiarimezhnleooeegoedrcbtntcapIaoionutotrneuaosarnrrtnSmeriariendAdusgoqgEnbrotiuanintyptoimotoreenoternht.s.d]hauieTmtteOfpshooea,enpwranolltPyluyiyerlnrcsrotorsnrmoetotnmeosacserrigoehd[raeseu-teene]n,ontnrd@itaftfrfcmrsecyiodimsoroamewintfnyemhpditgmlseheeilhtfeedtbipraoidoietrUraniimeozntKpseente;,e.hh,ccariinniemoecnsch.sddauiolsotunekatr(odetyrbhwasydi)enfeiuiliptrgtsnwthheauotaiiircnhrtnftcespentesthoepwehpCreprrothsoo(iaowunsamnmn)lniidocno,anoenrtntnenei,hoeodlgtoefrnIha[syraa.sslrriaTdw]rfponahlcwrfeindeinisztrirgshctseet,heueh.oaim[efstfgcoBhlnmepsroyetdorspaeoepirn1ctnnmrihacz8igtzoeseeoeyhdsdrttieiaponaoaoatrrgnlerfboitss,eeevtoetrhonihfndsriotesetaeruohniytrprtlie.tvdsrfnBooitepedaorumrraem,oltwnkoehmoedxtieefnicooantipentthnntpsiueroedityrrcen(popoltss.iohurnk)Tmiseetzh–aerneaPoegsedrelwroP.oseexTsfrimealohbflmmutmoeynoltapfoPoteiyrhltlrtreeoe’ibisblsrnermdeeewgawmoups/toreitdsalapeueerFnrlldtcloadiisdoevcyfbnobeseeeyertebrewaaistosnnbchioglotaleekrm./e
76 WWW.GATHERED.HOW/SIMPLYCROCHET
@SIMPLYCROCHET
DARLINGDRAGON COSY CROCHET OfWYphoETr1t,vo0r!0RsS
Dragons are real – or crochet sYoocukcsa, snonwevee’rer haalwveaytosoexmciatendy to *cSCheroaosrcechhnefatoporpnSsyimtoouprrely
ones are, anyway! Karen Yau sKeneigshotms,eaokane@’sbnlueewhippapiro.1H6e, idi
couldn’t resist hooking this one sheoeoinkegdththeepsaetuteprnfoinr hisesruseel1f2a0ft.eHrer GoogAlveaPillaabyl,eZoinnioAapnpdleN, ook
up over her half-term break using pstiynlkisahnadndblwuearamda. pTotaatsitoyntoloeoskasnd
pink and yellow yarn. The colour aasfkufnofr?inMishay–bwe hHaetidmi cooreulcdomuldakyeou iPad is a trademark of Apple Inc., registered
combination looks neat and we’re a matching blanket or cardigan! in the U.S. and other countries. App Store is a
sure your students will love seeing tsreardveicmeamrkarokfoBfaArnpepsle&InNco.bNleO,OInKc.iNs aOrOegKisTtaebreledt
this project when you bring it into JOINUSONLINE! isisaftorardneemwaurskeorsf Boanrannensu&alNsoubblsecrIinpct.io*nFsreoentlryi.al
school. We think it’ll enjoy beCinagnccehlaartgaendy. Fproeienttrdiaulrninogt tahveaitlariballetooanvZoiindio.
If you’re looking to socialise
the adventure, too! twhiethnlmikaek-me sinudreedyocurojcohinetoeurrs, *
gSCrotruepb–letmheakpelarsceFatocesbhoaorek
T is fP\_\bPZURbùYVù[VùT.N.,.`X ppiactttuerrensroefcoyomumr menadkaetsi,ognest
aabndouatdhvoicwe,manudchgyeonuerlaolvlyetalk
5\ddUVQY\R SWimithployvCerro5c.h7ektmmeamgabzeinrse,.it’s
aofbfurisetnlidnlgycfreollcohwethfoooruksmtefrusl.l
!T’NAC I L VA T/ LA I Wwiethloyookufoonrwtharedret!o chatting
NINCITSSUIL YT
S LIF/VT NI CTA Y TALK TO US!
1 Post a pic on our Facebook page
7 facebook.com/simplycrochetmag
Tweet us @SimplyCrochet_
twitter.com/SimplyCrochet_
Add to our Finished Projects board
ravelry.com/groups/simply-crochet
Use the hashtag #SCtreblemaker
instagram.com/simplycrochetmag
Email us at:
[email protected]
g a
crochet
ith
Becky Skuse
howdoiavoid darning in ends?
Brush up on your technique with our simple guide…
Colourful crochet projects are one of the great joys in life, but there’s It’s easiest to start using this method with double crochet stitches,
a downside – the more you change colour, the more ends you have to when you’re using two colours to work stripes of two rows each. Once
weave in! Luckily, there are a few simple ways to reduce this you’ve learned the technique, though, you can use it with longer
somewhat tedious task, and I’ll be sharing one of them with you here. stitches, more rows and potentially more yarn colours.
Being able to carry different colours of yarn up the side of your When carrying different colours of yarn up the side of fabric, it’s
fabric is great if you like stripy patterns and inset mosaic crochet as not unusual for short strands of contrasting yarn colours to be visible.
much as I do. Instead of fastening off and cutting the yarn every If you dislike the finished look, try to keep your yarn weaving on the
two rows or so, you can weave the unused yarn colour into the wrong side of the fabric. Or, you can add a border to the fabric and
stitches at the edge of the fabric while you work. work the stitches over the colour changes to hide them. Let’s hook…
Howdo I get started?
We’ll begin by changing colour at the end of the row…
To practise making stripes and carrying yarns up the side, you need Step 2 Pull a loop of your second colour or Yarn B (I used blue)
two yarn colours of the same weight. Using your first colour or Yarn A through the remaining 2 loops on the hook. This finishes the final
(I used cream), work two rows of double crochet or any stitch you stitch and gives you a loop of the new yarn to work the next row.
want. At the end of the second row, stop before the last stitch. Step 3 At the side or wrong side of the fabric, secure the tail end of
Step 1 Start the last stitch, but stop before the final yrh. Yarn B (blue) with a half-knot to Yarn A (cream).
01 02 03
moc.sserpdrow.odemekamta ykceBtuobaeromtuodniF
78 WWW.GATHERED.HOW/SIMPLYCROCHET
a
Howdo I start carryingyarns?
It’s easy to carry colours up the side of the fabric…
Once you have two rows of stitches, you’ll be last stitch of the second row. Step 11 Repeat Steps 3-7 to work more
ready to practise carrying the unused yarn Step 7 Drop Yarn B (blue) to the back and two-row stripes.
up the side of the fabric, weaving it into the pick up Yarn A (cream), which should Tip To use this technique with longer stitches
stitches you’re working. positioned be at the front. Yrh in Yarn A like trebles, you need to weave the unused
Step 4 To start with, we’re going to weave (cream) and pull through – this is now yarn up a longer turning chain: *bring the
the unused Yarn A (cream) up the turning becomes the active colour. unused yarn over the active yarn towards
chain – this can be easier to do if you work Step 8 Now weave in Yarn B (blue) up the you and work a chain (as in Steps 5-6), then
the turning chain before you turn. So focus turning chain before you turn. To do this, take the unused yarn over the active yarn
now on the two working yarns – bring Yarn A bring Yarn B (blue) over Yarn A (cream) away from you and work a chain; repeat from
(cream) over Yarn B (blue) towards you. towards you. * until your t-ch is the right height.
Step 5 Pick up Yarn B (blue) and work Step 9 Pick up Yarn A (cream) and work
a chain. Yarn A (cream) should be encased a chain. Yarn B (blue) should be encased With longer stitches, you also need to
inside the chain. inside the chain. neatly weave the unused yarn up the last
Step 6 For dc, one chain is enough for the Step 10 Repeat Steps 3-6 swapping the yarn stitch of the second row. To do this, pause
turning chain and you can turn and work the colours to work two rows in Yarn A (cream), the stitch after the first ‘yrh and pull up a
next row of stitches in Yarn B (blue), and then then switch to Yarn B (blue) and weave in loop’. *Bring the unused yarn over the active
a second row. Stop before the final yrh of the Yarn A (cream) up the side. yarn and continue the stitch; repeat from * at
regular intervals as needed.
04 05 06 07
08 09 10 11
Let Becky solve your hooky conundrums! Dsohwfnooo’twlrlomkycswihhosaouasrptshtht…oietwcnIh’letloxt
Crochet Unravelled aims to deep dive into the techniques, tutorials and terminology that
will make you a better hookster. Have you got a question you want Becky to unravel?
Send it in to us at [email protected]
WWW.GATHERED.HOW/SIMPLYCROCHET 79
FLORAL EARRINGS
AASSYY
WEDIGKHT H5OMOMK
YOU WILL NEED
Q Any DK yarn in 2 colours
Q A 5mm (US H/8) hook
Q 2 wire drop earring findings
TENSION
Tension is not critical for this project
MEASUREMENTS
Earring measure approx 3.5cm
(1in) in diameter
ABBREVIATIONS
For a full list, see page 90
Up to your ears
Show o both your style and your favourite hobby with
these cute ower earrings designed by Amy Overbury
A perfect project for beginners, these Quickly hook up this pretty set of earrings Round 2 Ch1 (does not count as st
earrings are made injust three rounds to instantlybrightenyourlook–andyour throughout), 2dc in each st around, ss to beg
mood. Use any two colours you like! dc. [12 sts]
80 WWW.GATHERED.HOW/SIMPLYCROCHET Change to second colour.
NOTES Round 3 Ch1, dc in first st, (2tr in next st, dc in
next st) 5 times, 2tr in final st, ss to beg dc.
Earring are worked in rounds throughout. Fasten off.
TO MAKE UP
EARRINGS Use the tail to sew the Earring to the finding.
Weave in all ends.
Using first colour, ch2.
Round 1 (RS) 6dc in second ch from hook, ss to
beg dc. [6 sts]
summceorlleFcatiironisle C
grannyblanket * Contents subject to change
stylishtwinset
QueenaEmliigzuarbuemtihII
quickhookbracelets
kidsponcho
tealightholders
Cutesunkeyring
Exclusive 10dsetsyilginssh
bpaototkern
YARN REVIEWS
New season yarnsSix
yarns in yummy shades to get your hooks into this summer
DC TRIANGLE MOTIF
Make a magic loop.
ROUND 1 Ch1, (dc, ch2, dc) 3 times, ss to beg dc,
ss in next ch-2 sp. [6 sts, 3 ch-2 sps]
ROUND 2 Ch1, *(dc, ch2, dc) into ch-2 sp, dc in next 2 dc;
rep from * twice, ss to beg dc, ss in next ch-2 sp.
[12 sts, 3 ch-2 sps]
ROUND 3 Ch1, *(dc, ch2, dc) into ch-2 sp, dc in next 4 dc;
rep from * twice, ss in beg dc. [18 sts, 3 ch-2 sps]
FASTEN OFF and weave in ends.
01
02
03
04
_\b7[bQ`ù`ù_VSdN\\_[_XT`bYZ]RR`\__R`VgR
05
06
82 WWW.GATHERED.HOW/SIMPLYCROCHET
YARN REVIEWS
Debbie Bliss Dulcie King Cole Cottonsmooth
WEIGHT Chunky WEIGHT DK
CONTENT 47% cotton, 01 CONTENT 100% cotton 02
47% acrylic, 6% nylon BALL 100g/200m
BALL 50g/75m HOOK 4mm
HOOK 7mm RRP £4.79
RRP £5.25
Debbie Bliss’ Dulcie yarn has adds to the softness, and its This new 100% cotton yarn from smooth and processed that they
many amazing qualities, and we loosely braided structure makes King Cole certainly lives up to its lose some of their character, the
think it’s going to be a big hit it incredibly lightweight. This name! It’s a mercerised cotton, Cottonsmooth yarn still has
with chunky yarn fans. It’s yarn is great for chunky yet airy so it’s super-silky and smooth a minimal halo, meaning the
a blend of cotton, acrylic and accessories for the summertime. with a lovely shine, but it still yarn feels super-soft to the
nylon fibres, which have There are 13 light pastel shades retains some of the natural touch. The range features 10
been combined to create an to choose from in the range, and qualities in those lovely cotton gentle pastel colours and is
incredibly soft yarn. The texture it’s hand wash only. fibres. Whereas some varieties machine washable at 40ºC.
has an almost felted feeling that www.debbieblissonline.com of mercerised cotton can be so www.kingcole.com
Rico Design creative cotton flecky Fleece West Yorkshire Spinners Elements
WEIGHT DK WEIGHT DK
CONTENT 75% cotton, 13% 03 CONTENT 60% Lyocell, 40% wool 04
polyacrylic, 12% wool BALL 50g/112m
BALL 100g/250m features a spray print that gives HOOK 4mm
HOOK 4mm you gorgeous flecks of colours RRP £3.95
RRP £8.50 throughout your work. There’s
Rico Design have come up with also a single-coloured wool You’ll be in your element (sorry, too – it’s made from cellulose
a new yarn that’s honestly quite fleece worked into the cotton we couldn’t resist!) when you fibres (wood pulp) and is
unlike any cotton blend yarn thread, creating a natural woolly start hooking with this fab new harvested from sustainable
we’ve tried before. From the feel and texture. There are six yarn from WYS. A gorgeous sources. These two fibres come
moment you start crocheting shades, and it’s hand wash only. blend of Falkland wool and together to create a yarn that’s
with it, it feels different and www.rico-design.de Tencel™ Lyocell fibre makes this breathable, gentle on skin and
lightweight. The cotton, lightweight yarn extra soft and fully biodegradable. Available in
polyacrylic and wool yarn is silky. The Tencel™ Lyocell used 10 shades and hand wash only.
both soft and strong and in this yarn is very Earth-friendly, www.wyspinners.com
Bernat Softee Cotton Rowan Kidsilk Haze Colour
WEIGHT DK WEIGHT Lace
CONTENT 60% cotton, 40% acrylic 05 CONTENT 70% mohair, 30% silk 06
BALL 120g/232m BALL 50g/420m
HOOK 4mm HOOK 3.5mm
RRP £6.99 RRP £19.95
We love this latest addition to lovely and soft with a gentle If you’re a fan of super-fluffy These 50g balls come with 420m
the Bernat Softee range (which shine. It’s easy to care for, too, as fibres, then you’re going to love of yarn, which will go a long way
is also available in a baby yarn it’s machine washable and can the Rowan Kidsilk yarns. Their if you’re using it in conjunction
and chunky yarn). It’s got a even be tumble dried. There are new Kidsilk Haze Colour expands with another yarn (as it’s so fine,
fabulous and fun springy twist 14 shades in a wide range of on their existing Kidsilk Haze it’s quite tricky to crochet with
to it, which feels great to colours, including bright and range, but now has soft stripes by itself). The new range
crochet with but also gives your neutral shades as well as a of colour that blend effortlessly. includes eight gorgeous shades
stitches a squishy bounciness to couple of variegated ones. In addition, it has double the and is hand wash only.
them. As the name suggests, it’s www.woolwarehouse.com weight and double the length! www.knitrowan.com
WWW.GATHERED.HOW/SIMPLYCROCHET 83
Crochet essentials VI - SFcowrsrotewhcpahwnpedi.tcgy-tfauvoirtderhe-teobusrteeoagrdniiad.nlhssn,oteevwiprss-i/tby-
sOtvitecrhtehseannedxttefcehwnipqaugeesst,hyaotuy’lol u’nlldussiemepvleersytetipm-beyy-ostueppigckuiudpesathoomokany useful
THryOthLeDseImNeGthoTdHs aEndHseOe OwhKich works best EHveOnLteDnsIiNonGresTuHltsEinYeAveRn sNtitches
PENCIL METHOD KNIFE METHOD METHOD ONE METHOD TWO
Hold the hook like a pencil, in Hold the hook between your Pass the ball end of the yarn Loop the ball end of the yarn
your right hand (if you’re thumb and forefinger, about between the little finger and loosely around the little finger
right-handed), about 3-5cm 3-5cmfrom the hooked end, third fingers of your left hand of your left hand, then take it
from the hooked end. If your resting the end ofthehook (if you are right-handed), then over the third finger, behind
hook has a flat area, you’ll find it against your palm. This will behind the third and middle the middle finger and over
comfortable to hold it here. give you lots of control. fingers, over your index finger. your index finger.
MAKING A SLIPKNOT Thefirstlooponthehook
1Hold the tail of theball of 2 Hold theloop betweenleft 3 Catchtheball end ofthe 4 Pullboth ends oftheyarn to
yarn in your lefthand and thumb and forefinger, then yarn with the hook and pull it tighten the knot, then pull just
drape the yarn clockwise over insert the crochet hook back through the centre of the the ball end totighten the
the top ofit to formaloose, through the centre of theloop loop, taking the yarn through loop so it’sclose to thehook,
circular loop. from front to back. with it. but not touching it.
CHAIN STITCH Usethisstitchtomakeyourfoundationchain How to count chains
1
98765432
1 Hold the hook in your right 2 Pullthehooktowardsthe 3 Thisiswhatyourrowof Each chain or loop counts as
hand, and both the yarn end slipknot, catching the yarn in chains will look like. Hold the one stitch. Never count your
and the working yarn in your the hook, and pulling it through chain with your left hand near first slipknot or the loop on
left hand. Move the hook under the slipknot loop. This forms the hook, to keep the tension. the hook (called the working
and over the yarn to wrap it your first chain (ch) stitch. Keep going until you have the loop). So that you can be
around anticlockwise. Repeat steps 1 and 2 to form number of chains that’s stated accurate, make sure the
a chain length. in your pattern. chain is not twisted and that
the front is facing you.
WWW.GATHERED.HOW/SIMPLYCROCHET 85
YOUR GUIDE
TShLisIPstitSchThITasCnHo h(esigsh)t – often used to join rounds FWollOowRtKheIsNeGsimIpNleRruOlesWtoSconstruct crochet fabric
1The slip stitch is used tojoin 2 Pulltheyarn through the 1The first row ismade by 2 Forthe next row, first make
a length of chain into the chain stitch (as shown) and working across the the turning chain for the stitch
round. Insert thehook from then the loop already on the foundation chain from right to you’re about towork(see
front to back into thefirst hook to make aslip stitch. You left. At the end of thechain or opposite). Nowworkthenext
chain you worked. Wrap yarn can also work this stitch into row,turntheworkso that the stitch into the topof the
round the hook (yrh)in an each stitch along a rowto yarn is behind the hook. stitches on your first row,
anticlockwise direction. form a neatedging. missing the first stitch.
ODnOe oUf tBheLkEeyCsRtitOchCesHinEcrToc(hdect,)dUouSblteesramre s:imsipnleg, cleomcpraocct shtietcthes that form a dense fabric
1Tomakea double crochet 2 Wind theyarnaround the 3 Pulltheyarn through the 4Yarn round hook again, then
stitch, insert thehook under hook (yrh). stitch, giving you 2loops on pull the yarn through both
the top 2loops of the next your crochet hook. loops. There’s yourdouble
stitch on the previous row. crochet made and you’ll have
one loop left on the hook,
ready to dothenext stitch.
AHhAanLdFy sTtiRtcEhBthLatE’s bCeRtwOeeCnHdoEuTbl(ehatnrd)tUrebSletecrromche: thinaslifzed, aonudbit lloeocksrsolicghhtelytlooser than double crochet
1Tomakea half treble crochet 2 Insert thehook under the 3 Pulltheyarn through the 4Yarn round hook again, pull
stitch, work towhere you top 2loops of thenext stitch stitch only (3 loops on hook). the yarn through all 3loops.
want the htr and then wind in theprevious row.Wrap yarn You’ve made ahalf treble
the yarn round the hook (yrh). around the hook again (yrh). crochet. Continue working htr
into nextand following sts to
the end oftherow.
86 WWW.GATHERED.HOW/SIMPLYCROCHET
YOUR GUIDE
OTnReEoBf tLheEmCoRstOpoCpuHlaEr Tstit(cthr)esUinScrtoecrhmet,:thdisosuimbplleesctitrcohcishtweitce as high as a double crochet stitch
1Toworka treble crochet, 2 Wraptheyarnaround the 3You will nowhave 3 loops on 4You will nowhave 2 loops
start by winding yrh and then hook (yrh) andpull theyarn the hook. Yrhagain, anddraw on the hook.Yrhagain and
insert the hook under the top through the stitch only. the yarn through just the first draw the yarn through the
2 loops of thestitch onthe 2 loops on thehook. remaining loops on the
previous row. hook. Your treble crochet
is complete.
UDSOtUeBrmLE: tTreRbElBeLcEroCcRhOeCt HET (dtr) UTRSItPeLrEmT:RdEoBuLbEleCtRreObCleHcErToc(thter)t
This isastitch regularly used Yrhandpulltheyarn through This is one ofthelongest 2 loops only. Repeat from †
as anelongated version of the 2 loops only (2 loops on hook). standard crochet stitches and is 3 times more andyourtriple
treble (described above). It’s 4 Yrh andpulltheyarn through mainly used in fancy stitch treble will be finished. Repeat
worked inavery similar way to the remaining 2 loops. Repeat patterns. It’s taller than a double from * tomake more ttr sts.
the treble, as follows: from * tomake more dtr sts. treble crochet stitch (described 4Tomakethenext row, turn
1 Make afoundation chain. Skip 5Tomakethenext rowof dtr, left) andis worked inavery work and ch5.Thisturning chain
4ch, *yrh twice,andinsert the turn work and ch4. This turning similar way,as follows: counts as the first triple treble in
hook under the top loop ofthe chain counts as the first dtr in 1 Make afoundation ch. Skip a newrow. Skip first st atbase of
next ch. a newrow. Skip first st atthe 5 ch,*yrh 3 times, insert hook the t-ch. Work 1 triple treble,
2 Yrh, pull the yarn through the base of the t-ch, work1dtr under under top loop ofnext ch. inserting hook under the top
ch loop only(4 loops on hook). the top 2loops of the second 2 Yrh, pull yarn through ch loop 2 loops of thesecond st inthe
3 Yrh andpulltheyarn through stitch in the previous row; only (5 loops on hook). previous row; continue to the
2 loops only (3 loops on hook). continue to theend of the row. 3†Yrh, draw loop through end of therow.
FToUr aRnNevIeNn GfiniCshH, sAtarItNea(cth-crohw)with a turning chain How to count stitches
In crochet, you needtoadd table below tells youhowmany Check your work is correct
turning chains (t-chs)tothe t-chstsformthe first stitch.
beginning of rows. Thereason *For dc, usually the turning chain Being able to count 123456 7
for this istobring the hookup to does not countasastitch, and your stitches isvery 1 2 3 456 7 8 9
the height of the stitches you’re the first stitch of the rowis important andhelps
crocheting. Each basic stitch has worked into the stitchatthebase youtoensure that
its own numberof chains. The of the turning chain. you’re following
a pattern correctly.
STITCH Afcsothdauadrnitnitdnobagteirfooonwre sfrSaootskauwifrpnitr(dascotoatfstuitno) tns ft(Fcciuhororsarnutininsntt)gs as It’sa goodideato
Double crochet 1 ch 1 ch* 1 ch* count your stitches at
Half treble 1 ch 2 ch 2 ch the endofeveryrow.
Treble 2 ch 3 ch 3 ch To count short
Double treble 3 ch 4 ch 4 ch stitches such as
Triple treble 4 ch 5 ch 5 ch double crochet, look
at theplaited tops
(see above right). For
taller stitches,count
the upright ‘stems’ –
each ‘stem’ is
counted asastitch
(see right).
WWW.GATHERED.HOW/SIMPLYCROCHET 87
CHreOatWe stTripOesCanHdAotNheGr cEolCouOr eLffOecUtsR YOUR GUIDE
SINhaCpiRngEsAtitSchINesGareAviNtaDl forDmEaCkinRgEgAarSmIeNntGs
1Before you work thefinal 2 Pullthrough aloop ofthe INCREASEToincrease one DECREASE Fora quick
yrh (yarn round hook) on the new yarn tofinish the old stitch is verysimple – work decrease, just skip one stitch.
last stitch ofarowin the old stitch. The working loop will one stitch into the nextstitch For aneater look, work the
colour, drop theoldyarn and be inthenewcolour. on therow below. When first part ofonestitch and
then pick up thenew one Continue, keeping theold you’ve finished, workanother then begin the next stitch.
with your hook. yarn at thewrong side. stitch into the same stitch. Finish both together.
YSoEuWcanINjoGin cSroEcAheMt seSams by using a tapestry needle or a crochet hook, using one of these four methods
1Sewing with atapestry 2 To slip stitch a seam, place 3 Fora dcseam, place the 4 Auseful variation on the dc
needle is the regular and neat the crochet pieces right sides crochet pieces right sides seam, the dc andchainseam is
way tojoinseams. Placetwo together. *Insert hook into together,or wrong sides used when less bulk and/or
pieces of crochet right sides both edge stitches, yrh and together fora visible seam. greater flexibilityis needed.
together and oversew them as pull through to complete 1 slip Work as for slip stitch seam, Work 1 double crochet and
shown above, using a tapestry stitch; rep from * working into using double crochet instead 1 chain alternately.
or yarn needle. the next edge stitches, of slip stitch.
keeping work fairly loose.
How to check your tension
Make and measure a swatch to check your tension
Most crochet patterns state thetension
required, in rowsandstitches of aspecific
type. Make a swatch atleast15cm square
and check that your tension matches. Place
a ruler across the swatch and insert twopins,
10cm apart. Then place theruler along a
column of stitches and insert twopins 10cm
apart. Count thestitches and rowsbetween
the pins –if you have less than the pattern,
your tension is too loose so youneed touse
a smaller hook, but if youhave too many,
use alarger hook. It’susually better to
match the stitches than rows, because you
can always work more orfewer rows.
88 WWW.GATHERED.HOW/SIMPLYCROCHET
YOUR GUIDE
CFrOeaUteNa fDouAndTaItOionNriRngINforGworking in the round TWomOaRkeKcIirNcleGs,tSuTbeITsaCnHdoEthSerINshTapOesA RING
1Make a chain thelength 2 …andpullyarnthrough 1Make a foundation ring and 2 Finish the treble, as usual
stated in the pattern 2 loops onhook. Nowyou’re work thet-ch (3ch for treble (yrh, pull yarn through ring,
instructions. Next, insert the ready to start crocheting in sts).Workatreble st asusual, yrh, pull yarn through first
crochet hook into the first the round, following the but insert hook intocentre of 2 loops, yrh, pull yarn through
chain. Close the ring with instructions given right. ring. For treble sts, yrh, insert 2 loops). Work more sts into
a slipstitch, working yrh… hook into ring. the ring asneeded.
AMnAaltGerInCatLivOe foOuPndation ring for working in the round
Wyaorrnking
Tail end 2 Now insert your hook into the 3 Make a t-ch for the sts you 4 Once you’ve worked the first
loop, from front to back. Wrap want to work (above, we made round of stitches, pull the tail
1 To start a magic loop, don’t the working yarn around the 1t-chfordc).Work your sts end of yarn to draw up the ring.
make a slipknot. Instead, make hook and pull the yarn through into the magic loop, over both Work a slip stitch to join the last
a loop with the yarn, leaving the loop. the loop and the tail end(so, and firstststofinishthe first
atailaround10cmlong. Make 2 yarn strands). round (as instructed in the
sure the tail end isunder the guide below).
working yarn.
FJiOnisIhNoIfNf eGachRrOouUndNofDcrSochet stitches nice and neatly by using a slip stitch oRrouspnidrsals
1Toclose around of stitches, 2 Then place theyarn round 3You’veslip stitched the yCohuecnkewedhitcohutseechnique moc.imatuoballa.www ,uaL einahpetS©
work aslip stitch intothetop the hook. Pull the yarn round together! Before
of the turning chain. Todo through the turning chain working another round, be Some patterns are worked
this, insert thehook intothe stitch and through the sure tomaketherequired in rounds thatarejoined
top stitch of theturning chain. original stitch on your hook. turning chain. Always work together at theendof
rounds on the right side, each round (see left).
unless your pattern instructs Other patternsare worked
you otherwise. in aspiral, so youdon’t
need to jointherounds at
the end, just keep going,
working into thenext
stitch on theprevious row.
Amigurumi toys areoften
worked in aspiral like this.
WWW.GATHERED.HOW/SIMPLYCROCHET 89
YOUR GUIDE
Abbreviations Crochet hook conversions
across to end of the row meas measures UK METRIC US
approx approximate(ly) patt(s) pattern(s)
beg beginning pm place marker 14 2mm –
bl insert hook under prev previous
BP back loop only qtr quadruple treble 13 2.25mm B/1
Back Post: rem remain(s)/remaining 12 2.5mm –
ch(s) work st indicated, rep repeat
ch-sp(s) inserting hook around RH right hand – 2.75mm C/2
ch- post of st from back to rnd(s) round(s)
cl(s) front to back and not RS right side 11 3mm –
cont in top of st sk skip
dc chain/chain stitch(es) sp(s) space(s) 10 3.25mm D/3
dc2tog chain space(s) ss slip stitch
refers to ch made st(s) stitch(es) 9 3.5mm E/4
dec previously, eg. ch-3 t-ch(s) turning chain(s)
dtr clusters tog together – 3.75mm F/5
dtr2tog continue tr treble crochet
fdc double crochet tr cl (yrh, insert hook in sp/ 8 4mm G/6
ftr (insert hook in next st,
fl yrh & draw a loop st, yrh & pull up loop, 7 4.5mm 7
foll/folls through) twice, yrh & yrh & draw through 6 5mm H/8
FP draw through all 2 loops) number of
3 loops on hook times indicated, yrh & 5 5.5mm I/9
htr decrease draw through all loops
htr2tog double treble crochet on hook 4 6mm J/10
in next work 2dtr together tr2tog (yrh, insert hook in
inc foundation dc next st, yrh & pull up 3 6.5mm K/10
LH foundation tr loop, yrh a& draw
lp(s) insert hook under through 2 loops) 2 7mm –
front loop only twice, yrh & draw
following/follows through all loops on 0 8mm L/11
Front Post: As BP, hook
inserting hook around ttr triple treble crochet 00 9mm M/13
post from front to WS wrong side
back to front yrh yarn round hook 000 10mm N/15
half treble * work instructions
work 2htr together immediately foll *, Which hook do I use?
sts to be worked into then rep as many
the same stitch more times as directed Hook size UK yarn weight
increase () work all instructions in 2.5-3.5mm hook 4ply yarn
left hand the brackets as many 3.5-4.5mm hook
loop(s) times as directed 5-6mm hook double knitting yarn
7mm and bigger aran yarn
chunky yarn
fTHaosOpterWnevtehTnetOeynodGusroEhfaTfrcdaArwePofurEkllyRu,nfForaEllvoCewlTliinnggFooINunrcIeiSnysHotruu’cvteiofinnsisbheeldowcrocheting, UK/US conversions ch
ss
Completethefinal stitch, then UK US sc
cut the yarnabout15cm from hdc
the work. Pull itthrough the chain ch chain dc
last loop on the hook and pull slip stitch ss slip stitch tr
to close theloop. Thread the double crochet dc single crochet dtr
yarn tail onto atapestry needle half treble htr half double
and weave into theback ofthe treble tr double
work. Most crochet items don’t double treble dtr treble
need a lotof blocking, but triple treble ttr double treble
cotton lace work usually does.
Todo this, carefully pin out the
item with rust-proof pins, mist
with a waterspray and leave to
dry naturally.
90 WWW.GATHERED.HOW/SIMPLYCROCHET
MWpnyoOce !
You can buy a digitaledition of
Simply Crochet, ready to read
wheneveryouwant. Singleissues
andsubscriptions areavailable
andevery issueyoupurchaseis
stored in your magazine library
permanently. Onceyour magazine
has downloaded, an internet
connection is not required so you
cantakeyourmagazinewith you,
wherever you go.
To buywywouwr.dgiagtihtaelrecodp.hyoowf/Sdiimgiptalyl-iCsrsoucehset visit
iPad is a trademark of Apple Inc., registered in the U.S. and other countries. App Store is a service mark of Apple Inc.
NOOK is a registered trademark of Barnes & Noble, Inc. NOOKTablet is a trademark of Barnes & Noble, Inc
Charts &CHARDTSiagrams
Fobllloanwktehte, rsuecckhsaacrtkscwahmepnemrvaakninmgotthife, lgulgogbaegceutsahgio, lna,cme taopppaonudchtu, lGipoicnugshSioounth
Globe cushion, page 21
80 79
78 77
76 75
74 73
72 71
70 69
68 67
66 65
64 63
62 61
60 59
58 57
56 55
54 53
52 51
50 49
48 47
46 45
44 43
42 41
40 39
38 37
36 35
34 33
32 31
30 29
28 27
26 25
24 23
22 21
20 19
18 17
16 15
14 13
12 11
10 9
8 7
6 5
4 3
2 1
70 65 60 55 50 45 40 35 30 25 20 15 10 5
92 WWW.GATHERED.HOW/SIMPLYCROCHET Key
Gypsum
Citronelle
Leaf
CHARTS
Map pouch, page 21 25
23
26 21
24 19
22 17
20 15
18 13
16 11
14 9
12 7
10 5 Key
8 3 Deep Sea
6 1 Citronelle
4
2
40 35 30 25 20 15 10 5
Going South blanket part 3,page 22 35
33
36 31
34 29
32 27
30 25
28 23
26 21
24 19
22 17
20 15
18 13
16 11
14 9 Key
12 7 2tr
10 5 let block
8
6
146 140 130 120 110 100 90 80 70 60 50 40 30 20 10
WWW.GATHERED.HOW/SIMPLYCROCHET 93
CHARTS
Going South blanket part 2, page 22
82 83
80
78 81
76
74 79
72
70 77
68
66 75
64
62 73
60
58 71
56
54 69
52
50 67
48
46 65
63
61
59
57
55
53
51 Key
49 2tr
47 let block
146 140 130 120 110 100 90 80 70 60 50 40 30 20 10
Going South blanket part 1, page 22 127
126 125
124
122 123
120
118 121
116
114 119
112
110 117
108
106 115
104
102 113
100
98 111
96
94 109
92
90 107
146 140 130 120 110 100 90 80 70 60 50 40 30 20 10 105
103
101
99
97
95 Key
93 2tr
91 let block
94 WWW.GATHERED.HOW/SIMPLYCROCHET
CHARTS
Rucksack motif,page 23 Key Luggage tag, page 25 15
Coral 13
21197111615318414350261 Citronelle 16 11
16 10 5 Gypsum 14 9
12 7
10 5 Key
8 3 Deep Sea
6 1 Citronelle
4
2
28 25 20 15 10 5
Lace top,page 45
Front
Back
Key
Fold line
Hexagon
Half hexagon
WWW.GATHERED.HOW/SIMPLYCROCHET 95
CHARTS
Tulip cushion, page 69
Key 121 115 110 105 100 95 90 85 80 75 70 65
Apple
Opal
Hot Pink
Orange
tr2d
96 WWW.GATHERED.HOW/SIMPLYCROCHET
CHARTS
60 55 50 45 40 35 30 25 20 15 10 5 121212917253331323931484848484757575757566666666665757575757484888484842468133313131222221068860422436089072541698705234169870523416987052341698705234169870531975319753142
WWW.GATHERED.HOW/SIMPLYCROCHET 97
FAVE FOLLOW
it
Six reasons to follow Libby Forsyth of beatnikthreadz
and explore her funky – and often froggy – makes
TFoiklTloowk:e@rsc:r1o9c.h9ketbylib FInosltloagwrearms::3@,7b5e7atnikthreadz
IFYOULIKE...bold,brightcolours. IFYOUWANNA... makethesefun IFYOULOVE... 1970sstyle.We’re
Libbylovestocreate“funproductsthat projectsforyourself!Libbytellsher gettingmajorgroovyvibes fromthis
promoteself-expression”andherfeed is followersthatanyonecancrochetand brown, green and yellow Quad Heart
fullofextra-saturatedshades.#bebold lovesitwhenpeople useherpatterns. GrannySquarevest. #70scrochet
IFYOUNEED... moreslowfashionin IFYOUARE... lookingtooutsourceyour IFYOUHAVE... anobsessionwith
yourlife.Libbyisamajorproponentof crochet.NotonlydoesLibbycreate frogs. These sweet amphibians pop up
makinggarmentsthatare“carefullyand patternsforherpieces,shesellsfinished timeandtimeagaininLibby’sdesigns.
mindfullycreated”.#sustainablestitches clothesandaccessories,too.#madeforyou We can’tblameher–they’retoocute!
It’s all over... TrenAdiNngAtThiOsmMonYthonInstagram
@wee.yarns @thecrochetcarpenter @naashx.the.artista
@knotmonster @choniescrochet TTrrnh!S
98 WWW.GATHERED.HOW/SIMPLYCROCHET
RoyalGuard
saCCtorvooamccihklpeaitlsebitmdlefineronfBrmitgoamVrmayluyipedoaC-uAthrtupenlrrkoinylca2l022
01756 703 670 kingcole.com [email protected]