Sunday,
April 25, 2021
THE WEEKLY TIMES PICTORIAL TRIBUTE
We DID Lest We
Remember Forget
Them
Epping RSL Sub-Branch led the way again in observing ANZAC Day with a service
in the Epping Club Ballroom, march to the Epping Boronia Park Cenotaph, pictured
below, and wreath laying service, pictured above. TWT on-the-spot PHOTO.
Ryde MP Victor Dominello and Lane Cove MP Anthony Roberts assisted by his son
Samuel laid wreaths at North Ryde RSL Anzac Day dawn service at North Ryde RSL
Club. TWT on-the-spot PHOTO.
B THE WEEKLY TIMES Wednesday 28 April, 2021
Sunday,
April 25, 2021
Ryde Council ANZAC Commemoration Service was held in Anzac Park West Ryde at 9am Anzac Day. Among official party
were pictured above, l to r, Granville Schokman (RAN), Ryde MP Victor Dominello, Clr Trenton Brown, Clr Sarkis Yedelian OAM,
Lieutenant Manning Field who gave the Commemorative Address, Mayor Clr Jerome Laxale, Clr Penny Pedersen, Clr Jordan
Lane, former mayor Edna Wilde OAM and Cr Chris Moujalli.
Marsden High School captain Molly Wells presented the Commemorative Youth Address, pictured right with vice captains
William Spenceley left and Liam Jolly.
In attendance were veterans Colonel Rob Senior left, and Squadron Leader Kevin Andrews 101 years young and below JB’s
former school students Ryde Public School, pictured below. TWT on-the spot PHOTOS.
ANZAC Service at Ashburn House
PETER ASTRIDGE OAM Gladesville RSL Sub- as everyone in the street stopped and stared.
Branch Secretary and Vice President was Mas- William was a bit of a tearaway when he was a
ter of Ceremonies at an ANZAC Service created teenager.
for Ashburn House retirement village in Glades-
ville on Monday. He was one of the local ‘Teddy Boys’, one of
the earliest types of teen gangs famous for their
Peter is pictured cutting an Anzac cake with sense of fashion, hairstyles, and rowdiness.
William John Williams a member of Five Dock One of his most famous exploits as a youth was
RSL. when he cycled over 100 miles from Banbury to
Cardiff by himself. A feat still mentioned to this
William John Williams was born on New Year’s day by his Welsh cousins. Rather than wait to
Day 1937 in the small English market town of be called up for National Service, William vol-
Banbury, famous for its nursery rhyme and unteered to join the British Army. He was part
cakes. His father was a Welsh professional sol- of the Royal Welsh Fusiliers contingent sent to
dier and his mother was an Irish lass from Cork. Malaya to quell a communist insurgency. He be-
William and his two brothers and two sisters came a corporal and radio operator and had the
grew up in wartime Britain. Their mother had to experience of jungle warfare.
raise them by herself as their father was over-
seas in the Royal Artillery fighting in North Af- His group was attached to a Ghurkha regiment
rica, France and Germany. and to this day he has a very high regard and
respect for the Nepalese people. He is very hap-
William and his siblings had a relatively safe py that so many members of staff at Ashburn
but adventurous war. Once, William fell into the House are from Nepal.
moat of nearby Broughton Castle and had to be
brought home by the local lord in his fancy car
Your multi award winning local newspaper!
Tigers Where to use your
Tribute to Wednesday April 28, 2021 VOUCHERS
ANZACS Page 20 SEE PAGE 10
www.weeklytimes.com.au
VOL. 100 NO. 12 PUBLISHED 99 YEARS Email: [email protected]
P.O. BOX 123, RYDE 1680 PHONE: 9807-6666
ANZAC Poppies
show our love
Anzac Day poppies were handed out to aged
care residents at the weekend as part of a local
knitting project. The poppies were purchased
after Mass at the Holy Name Of Mary Catholic
Church in Hunters Hill and the St Peter Chanel
Catholic Church in Woolwich.
Students Elizabeth Winters and Bridget
Donohue from Hunters Hill’s Villa Maria Catho-
lic School are pictured with project participant
Gloria Khoury at St Anne’s Catholic Healthcare
retirement village in Hunters Hill.
TWT on-the-spot PHOTO
WIN! with TWT!
Joubert Singers Eternal Light Concert Sunday
TWT readers have won three Double Passes to Jou-
bert Singers “Eternal Light” Concert this Sunday
May 2 at 3pm in the Holy Name of Mary Parish
Hall. Winners See Page 2.
‘June Again’ Double Movie Passes
Five TWT readers can win Double Passes to the
new Australian movie “June Again” which releases
nationally on May 6.
The movie stars Noni Hazlehurst, Claudia Karvan
and Stephen Curry. Entries close next Monday and
winners announced next Wednesday. SEE PAGE 2.
INSIDE This Week
Cathie’s Column ����������������������������������� 2
Letters to Editor ������������������������������������ 4
Hunters Hill Guest Column ����������������� 4
Elementelle Probiotics ��������������������� 6, 7
Ryde City Council ��������������������������������� 9
DINING GUIDE ������������������������������������ 10
TWT STIR Team Report ��������������������� 11
Handy Phone Guide ��������������������� 14-18
Cassifieds �������������������������������������������� 18
Clubs & Sport ��������������������������������19, 20
RYDE CIVIC CENTRE JB’s World ANZAC DAY on
RORT REPORT Sunday was partially
returned to normal
PART 2 - SEE PAGE 11 but let us all hope and
pray that this time
next year we will all
be able to say we can
fully pay our respects
to the true Anzac spir-
it and tradition that
our veterans deserve.
Lest We Forget.
Continued on Page 3
Your mattress Warehouse Anthony Roberts MP
Member for Lane Cove
orders can be made over the phone, online or in store.
Single King Single Double Queen King HOW CAN I
Maftrtormess Maftrtormess Maftrtormess HELP YOU?
Maftrtoremss Mafrtotrmess
$299 $299 $499
$125 $225
SHOWROOM: 16b leeds st, rhodes (parking available) If you require assistance please contact my office
Opening Hours: E: [email protected] P: 9817 4757
Mon - Thu 9-5.30pm | Fri – Sat 9-5pm | Sun 10-4pm Authorised by Anthony Roberts, Ground Floor, 215 Victoria Rd, Gladesville NSW, 2111.
TEL: (02) 9743 3922 | www. dialabed.net.au | [email protected] Funded using parliamentary entitlements.
2 THE WEEKLY TIMES Wednesday 28 April, 2021
Ryde’s ‘Magnificent Seven’ Women in Local Government celebrate
Celebrating women of
Macquarie Park Ryde
Macquarie Park Ryde Business Chamberis dedi- ☐ Ryde’s ‘”Magnificent Seven” women councillors celebrated 100 years of Women in Local Government last Thursday. Event was commem-
cating the May 10 Business After Hours network- orated with unveiling of an Honour Board for the seventeen women who have served on Ryde Council (compared with a total of 312).
ing event to celebrate the amazing women across The “Magnificent Seven” who attended on Thursday wwere Lyn Langtry, Roslyn Lunsford, Penny Pedersen, Edna Wilde OAM, Gabrielle
the city of Ryde. O’Donnell, Nicole Campbell and Edwina Clifton pictured at the Council Chambers on with Clr Bernard Purcell, Clr Jordan Lane, Clr Sarkis
The evening will include presentations from a Yedelian OAM, Clr Christopher Gordon and Mayor Jerome Laxale. TWT on-the-spot PHOTO.
panel of three high profile local women in busi-
ness. They will share their insights, experiences Kevinwood Eastwood
and thoughts about success. Easter Concert
Venue is North Ryde RSL Club Magdala Road
North Ryde. Time is 5.30pm to 7.30pm. First time Kevinwood Orchestra and Bells will enjoy
visitors free. the season of Easter in its second Sunday
Register at www.macquarieparkrydechamber. afternoon concert for the year this Sunday
com.au May 2 at the Haseler Centre just below St
Kevin’s Catholic Church in Hillview Road
WEST RYDE WIN with TWT Eastwood starting at 2.30pm. NEW TRADING HOURS
DENTURE Tschaikowsky is the featured composer
CLINIC ‘June Again’ Movie Passes in this composer with the wonderful Suite Due to the impact of COVID-19
from Swan Lake and including music from our new trading hours are:
82.1*v;.9-v(4F3O+.R)*A3(L*xL Five TWT readers can win Double the Nutcracker Suite.
Passes to the new Australian movie Both halves of the programme include Monday to Friday 7am – 5pm
YOUR DENTURE NEEDS “June Again” which releases nation- Easter music - in very different styles. Saturday 7am - 4pm
ally on May 6. Peter Hogg and the choir will sing move- Sunday 10am – 2pm
I Free consultation I Veterans affairs welcome ments from Vaughan Williams “Five
I Full/partial dentures I No referrals necessary TO WIN a Double Pass visit our Mystical Songs” leading into the refresh- If inconvenient please call or text
I Flexible/metal dentures I Emergencies home visits website weeklytimes.com.au and ment break while Irving Berlin’s “Easter to 0412 010 353 to utilise our
I Implant retained I Payment plan options click on the Win with TWT tab and Parade” will end the afternoon on a very pickup and delivery service.
dentures/overdentures available fill out the online form or write your lighthearted note.
I Repairs – while you wait I On the spot health fund name and address and phone num- Admission is by donation but numbers are
I Same day relines rebates ber on the back of an envelope and limited. Please sign in on arrival or use
I Impact® mouthguards 100% Australian Made send to TWT June Again, PO Box 123 QR code. More information and a copy
Ryde 1680. Entries close Monday of the concert handbill is on the kevin-
Shop 81, 1-55 West Pde, West Ryde May 3 and winners published May 5. wood website www.kevinwood.org.
(Next to Bus Exchange Taxi Stand, If not rehearsing or performing the director ph 9805 0986 ph 9870 8955
Joubert Singers Suzanne Maslen OAM, is contactable at
9807 1205Entrance to Train Station) ‘Eternal Light’ Concert 9874 2809 CoX’S road MaLL Midway Shopping Centre
211 Coxs Rd, 117 North Rd
www.denturefactory.com.au The TWT readers have won Double North Ryde Denistone East
Passes to Joubert Singer”Eternal
Light” Concert this Sunday May 2 at
3pm in the Holy Name of Mary Par-
ish Hall.
Winners are Valerie King of Hunters
Hill, Carry Tambakis of Marsfield and
Martina Wachsman of Hunters Hill.
Take you copy of The Weekly Times
for admission.
KaRa MINDS
Meet Katarina. "Our clinical trials offer treatment
options not yet available within the
Australian health care system,'
Katarina, Recruitment and Retention Coordinator
KaRa MINDS
-
02 8974 1100
Wednesday 28 April, 2021 THE WEEKLY TIMES 3
Ryde’s Armenians and Greeks rally for
genocide
recognition
RYDE’s Armenian and Greek ☐ Flag waving Armenian and Greek protestors at Saturday’s rally. TWT on-the-spot PHOTO
communities held a rally at Syd-
ney’s Town Hall on Saturday to
demand Federal Government rec-
ognition of the Armenian, Pontian
Greek and Assyrian Genocides
during the First World War.
☐ City of Ryde Clr Sarkis Yedelian OAM is pictured on the Town Hall steps during Hundreds of flag and banner waving ac- Speakers at the rally called on Prime
tivists also called on the government to Minister Scott Morrison to “break his si-
Saturday’s rally. TWT on-the-spot PHOTO recognise and condemn all other atroci- lence” and grant official recognition.
ties committed by the Ottoman Turks as
well as to specifically commemorate the They also condemned Turkey’s military
estimated 1.5 million Armenians killed in support for Azerbaijan in last year’s 44
Armenia and neighbouring countries in day conflict with the Armenian speaking
1915. Republic of Artsakh and Azeri drone at-
tacks on Armenian civilians in Ryde’s Sis-
New South Wales politician Natalie ter City of Stepanakert.
Ward MLC addressed the crowd with a
message from Premier Gladys Berejik- “Today the great grandchildren of the
lian, who is from Ryde’s Armenian speak- Armenian Genocide survivors suffer new
ing community. atrocities at the hands of Turkey,” several
rally speakers stressed.
“Today we commemorate the Armenian
Genocide and we will never forget the They said Anzac Day is the appropri-
men women and children who fell victim ate event to commemorate the Armenian
to this deliberate campaign of extermina- Genocide, which coincides with Ryde’s
tion,” she said. annual service at the Armenian Genocide
Memorial in Meadowbank Park.
“As our Premier said, I am forever hope-
ful Australia will join the nations of the Saturday’s rally was preceded by a
world that recognise the Armenian Geno- march from the Domain led by Ryde’s
cide.” Armenian scouts, a smoking ceremony
by Aboriginal people and prayers from
Turkey denies both the Armenian Geno- Greek and Armenian clergy.
cide and the Pontian Greek Genocide
where the Ottoman Turks are alleged to An important part of the rally was to
have sent thousands of men, women and raise awareness of the genocides in the
children on forced death marches, first wider Australian community and Federal
reported to the world by Anzac soldiers recognition is regarded as a crucial part
stationed in the Middle East. of raising this awareness.
Despite these Anzac reports and wide Onlookers at the tally told The Weekly
coverage in Australian newspapers of Times they knew Armenia was “some-
the day, successive Federal governments where near the Middle East” but did not
have not recognised the Genocides. know it is a Christian country that had
suffered a genocide.
JB’s World Ryde and former Syd- with More Pi Kirsten who meet at the Guild’s Invdeeslitvmeer notninclitmecahtneoclhoagnygwe ill
ney Tech High class- and siblings Per and national headquarters
mate of JB celebrates Karen. Beth Josey for- historic “Addington” The Morrison Government is acting on climate change. Actions speak louder than
Ryde will be toasted at words.
DR SEAN PARSON- today with his far better merly of NorthRyde cel- the next Guild meeting
AGE of SPA dental and half Ilma same day as ebrates 37 Friday. following on her actual Any action on climate change must include job creation and economy growing
Smiles dentists heads Leigh File, Jeff Ayling birthday this Tuesday. initiatives, not job killing taxes or retrograde restrictions on our standard of living.
This Week’s Birth- and Cale Jack Walker Graham Metcalfe
day Honours List fac- son of Matt and Julie of Ryde Rotary Club Linda Hallett better In that light, we all know green-hydrogen will be a major fuel of the future.
ing 49 candles on his turning sixteen. Mar- fame faces 77 candles half of Ryde Rotarian Hydrogen fuel cells generate electricity, with the by-product being only water.
cake tomorrow sharing garet Newman Lovett on his birthday cake on Adrian Hallett blows That electricity can drive electric motors attached to large transport vehicles like
with Pamela Suttor of better half of JB cousin May Day the first while out the candles on her 4x4 cars, trucks or train locomotives. No recharging stations are needed, as
Gladesville and former Chris Lovett also cel- Bill Payne celebrates 37 cake next Wednesday the electricity is made in the vehicle, range is limited only by the capacity of the
Principal of L Rundle & ebrates today as does years membership of the while Luke Nye turns hydrogen tank.
Co lawyers in the city. Brad Chan former MD same Ryde Rotary Club 40.
Ruth Henderson bet- of Eastwood Shopping and Peter Sullivan of The next budget will invest an additional $275.5 million to accelerate the
ter half of Ian Hender- Centre. LCD & Co parties along Jan Cutler past development of an Australian hydrogen industry. This new funding will increase
son and Dee Brown bet- too in Eastwood. president of Ryde Ro- the Government’s total support for a hydrogen industry to over $845 million. This
tary Club celebrates next is called ‘action on climate change’.
ter half of John Brown John and Elaine Wednesday same day
of Ryde Rotary also cel- Griffiths of Putney cel- Madeleine Bond as Angela Bonifacio of Making hydrogen is difficult, it comes from water, and requires a lot of energy.
ebrate 60 years of wed- daughter of local car Marsfield and better half Green hydrogen comes from green energy. The Government is supporting
ebrate tomorrow. of Frank of Eastwood projects that harness solar electricity to make hydrogen in the outback. We can
* * * ded bliss Friday while driving ace Colin Bond real estate fame. and will be a leader in the supply of green hydrogen to the world. This action on
IAN THOMAS TET- Bjorn Hojte parties in turns 39 Sunday same
LOW McKEE of West Copenhagen Denmark day as Max Hill faces Doug Barrett of West climate change boosts jobs and grows our economy. I’m proud
88 candles on his cake Ryde celebrates 83 gold- to report this good news to you.
NWOTAINRYSPUTBOLICNⅠ SORLIECIATODR ⅠFESOTARTEDSWINSTON READFORD and Matilda Smith en years on Wednesday.
daughter of Rev Mark Regards – JA
WINSTON READFORDNOTARY PUBLIC Ⅰ SOLICITOR Smith and Anna Smith MAY DAY is also a
celebrates with siblings conspicuous day for JB 32 Beecroft Road, Epping 2121 9869 4288
as a milestone in the life [email protected]
■NEOTsAtERaSYtTePAUTaBEnLSIdCⅠ ⅠBCSuONLsIViCnEITeYOAsRNsⅠCPEINSlaGTAnTnEiSngAsedpehlianidee, Declan, Jo- of The Weekly Times. www.johnalexander.net.au
and Audrey John Alexander MP
It marks 42nd anniver-
■ E■s■■tWaPWteiolillaslwsnaedannrBsdduoDsDfionoAwewstntsnsoiPszrniilnzaegninynging Honor as they party at sary of my ownership Authorised by John Alexander MP, Liberal Party of Australia, 32 Beecroft Rd Epping NSW 2121
Lithgow where dad is of The Weekly Times
minister at St Paul’s An- and The Weekly Times
glican church. Gladesville Pty Ltd as I
purchased the title May
■ En■dPuorwinegrsGouf Aarttdoirannesyhips Bob and Celia John- 1 in1969 which was
ston celebrate 69 years also a conspicuous day
for The One-Eyed Tiger
■ Enduring Guardianships wedded bliss in Putney as it was the last year
Saturday. Balmain Tigers won the
adm1i61nN(6@Nc5(Ocnw5OnrCirnRCCRCsohtTohToaanxHxHuurvsveseeRaRldlRSYRSfYtoorDterorDdeaeE.tcead)Eotd)m.au Grand Final in an his-
Elsie Sim now resi- toric win over Souths
Bunnies.
dent in North Ryde
***
and mother of Ryde’s BUMPER STICKER:
Don’t Laugh – Your
“Voice” Stephen Daughter may be in
Here!
Sim faces 98 candles on
***
TT9988877 22888888 her cake Monday same -Keep Smiling!
-JOHN F BOOTH
day as 2002 TWT Teen
Queen Crystal Roemer
and Ryde Rotarian and
anaLndLoidsoiyosyoookookuiuuiunnrrrrggccssalpalpoofefsetsteceeceriarifyaalftoyamlytoumyiulyily photographer Duncan
Taylor of Putney.
Phyllis Berger past
Guildmaster of Sydney
St George’s Guild of for-
mer scouts and guides
4 THE WEEKLY TIMES Wednesday 28 April, 2021
Letters to the Editor Walk Safely to Hunters Hill Guest Column
School Day
Must apologise to In fact, her purchase tone or emotion when LETTERS A murder mystery
Christine Holgate of four Cartier watch- subsequent revela- Dear Sir,
es in 2018, to reward tions have forced him Welcome On Friday May 14
Dear Sir, executives who had to condemn genuinely children from across at historic house
Given Prime Minis- worked “nights, week- disgraceful sexual as- TWT welcomes letters NSW will put their
ter Scott Morrison so ends and holidays” saults and debauch- from our readers. Full feet first, and journey
quickly apologised on a project that was ery in Parliament name, address and towards a healthier
to Rupert Murdoch’s not “their job”, but House. telephone number MUST future by participat- Carisbrook Historic House on Burns To The POINT
News Corp machine a special initiative to In his press confer- be supplied, even if not ing in the 22nd an- Bay is open every third weekend in the with
for raising a false al- transform the fortunes ence he could only for publication. Send to: niversary of National month for house tours and a delicious
legation about an in- of Australia Post by describe himself as TWT PO Box 123, Ryde Walk Safely to School assortment of Devonshire tea and cof- Dr Kay Leiper
cident at Sky News, making the banks “shocked and dis- 1680 or email: contactus@ Day. fee and cakes served in the courtyard.
if he wants to be pay properly for post weekly times.com.au In NSW Olympians
taken as genuine he offices serving their gusted” by the rev- Ben Mates, Steph Ma- Burns Bay is a lively area these days, with Eliza Perry.
must also apologise customers, was more elations of lewd and to acknowledge their giros and myself dual but when the Brooks family owned Mr. Smith was ‘found dead in the
to Christine Holgate than justified—it was degrading sexual role in the character Olympian Peter Had- Linley Point it was a backwater with a
for his entirely un- brilliant management. debauchery in Parlia- assassination of Aus- field are lending our dark past. water’ and Haslam, Coy and Perry
justified character ment House, also tar- tralia’s most success- support as Ambassa- were indicted for his murder.
assassination of her She didn’t waste geted at women. ful female CEO, nor dors and will be getting It even had the menancing name of
that has ruined her “taxpayers’ money”, But then, because have they taken steps out walking with kids ‘Murdering Bay’ and, to this day, no Only Coy and Perry stood trial. Eliza
career and totally she saved taxpayers’ he went on to use in- to rectify it. to promote health and one knows why. claimed Tom Smith drowned himself
destabilised Austral- money, she saved the correct information CHRIS ISHERWOOD fitness. and, without hard evidence, she and
ia Post. taxpayers’ national to take a swipe at The annual event It was already called that when Coy walked free.
And then he must asset Australia Post, Sky News, he quickly Australian Citi- raises awareness of woodcutter, Terence Byrne, lived on
instruct his Ministers and she earned tax- apologised to News zens Party the health, road safety, the Point with Annie Davis. I wonder how long they lived
to direct the Board to payers millions more Corp and the people transport and environ- there constantly looking over their
reinstate her as CEO. in revenue through her involved in the inci- Electric vehicles mental benefits that Terence, ‘free by servitude’ and ‘of shoulders.
Up until now too initiative. dent he cited, saying without handouts regular walking (es- unblemished character’ was also
many politicians and “the emotion of the pecially to and from known to harbour the odd escaped The ghosts of the past did not worry
media hacks have ac- Yet, based on false moment is no ex- Dear Sir, school) can provide convict. Charles Brooks in 1884 when he
cepted Christine Hol- and incomplete infor- cuse”. My primary grip for the long-term well- tried to sell his land as a gentrified
gate’s fate as simply mation the PM chose Well, neither was with electric vehicles being of our children. He petitioned to buy the land he had subdivision in which ‘marine villas’
the swings and round- to go on a tirade in your faked emotion (in keeping too with Apart from the physical squatted on since 1827, but those could be built on waterfront blocks.
abouts of politics; they Parliament against on 22 October an ex- the Climate Change/ benefits, regular walk- with authority objected to ‘his class’ Nothing nasty here!
say that after Morri- Christine Holgate per- cuse, Prime Minister— Global Warming ing also has a favour- owning land on the North Shore
son’s attack on her, he sonally, raging that he where is your apology debate demonis- able impact on their (probably including William Henry, At least not until 1913, when poor
would lose face if she was “appalled” by her to Christine Holgate? ing CO2) relates to cognitive and academ- who was in line to be granted a 1,000 Myrtle Caldwell was shot by her
got her job back, so it “disgraceful” action Before the Labor the skewed market, ic performance. acre lease which included Byrne’s fiance, William Wright.
won’t happen. and assassinating her Party gets self-right- driven by mega sub- The day also encour- squat, or the Nicols family who also
Australians should character in front of eous over this, they sidies in favour of ages primary school claimed ownership). He left her body in a shed near
stop tolerating this the entire nation. too should apologise EV’s and the Unre- aged children to build Figtree Bridge. William was sentenced
kind of politics. to Christine Holgate, liables of wind and walking into their daily Governor Darling eventually saw to death, but was reprieved to life-in-
The bottom line is The PM’s confected because they instigat- solar power. routine, by walking to differently, and the petition was prison on account of ‘unstableness of
Christine Holgate did outrage and condem- ed the attack on her If they’re so good, and from school, not granted in 1833. mentality’.
absolutely nothing nation of Christine on 22 October, fully then let them stand on just on Friday May 14,
wrong. Holgate on that day prepared to destroy their own two feet, in but every day. Terence could finally buy the land at Now, there is a story of ghostly
was so hyperbolic a successful female transparent competi- I’m delighted to be an the September 17 auction. happenings experienced by owners of
and so over the top, CEO and risk the fu- tion with fossil fuelled Ambassador for Walk Carisbrook in the 1940s and 50s and
he has been unable ture of Australia Post technology and let’s Safely to School Day. Problem was, on August 12, he had who knows?
to match it for either see how they per- Fitness and well-being been hung for the murder of Annie.
form without taxpayer have always been an Maybe there are a few restless spirits
in order to play their funded handouts, but integral part of my life Terence protested innocence to the around Linley Point, frustrated that
political games. with mandatory QOS and it concerns me end, claiming Annie had fallen from a they suffered injustice.
Labor Senator Kim- standards that attract greatly that a quarter cliff.
berley Kitching am- serious financial pen- of Australian children There are many local histories to be
bushed Christine alties for any failure to are either overweight A plausible story as there were many told.
Holgate in Senate Es- comply with minimum or obese. sandstone outcrops on Linley Point.
timates over watches QOS performance Regular exercise for The LCHS Lane Cove History Prize is
purchased two years standards. school kids and their They had been shelter for the again open for submissions.
parents provides sig- Cammeraygals for millennia and
JIM SIMPSON nificant benefits and many an escaped convict evaded Any aspect of local history is eligible
Five Dock I would encourage the military guards under cover of the in the form of a written piece, an oral
as many families and Point’s wild foreshores. history, or a video work.
Sportspeople need schools to not only
to take a stand participate in the Walk In 1870 one of these outcrops on Check out the details on https://
Safely to School Day Burns Bay was reported as the home www.lanecovehistoricalsociety.com.
Dear Sir, but to continue to exer- of Joe Haslam, who worked for Tom au/lane-cove-history-prize
Our military men cise on a regular basis. Smith, another woodcutter across the
and women fought Harold Scruby, Chair- river in Ryde near Buffalo Creek. Dr Kay Leiper from Hunters Hill is
and died for the rest man and CEO of the a spokespersonon for Carisbrook
of us to have the Pedestrian Council Another employee was John Coy, Historic House in Lane Cove
freedom to enjoy of Australia said that who lived immediately across the river
earlier; then Labor life, for example, by physical inactivity is a
leader Anthony Al- watching sports. major risk factor for so
banese formulated a The multi-govern- many chronic diseases
dishonest question ment COVID-19 pan- that can affect our kids Museum connects
for the Prime Minister icdemic has created at different stages of indigenous people
to make it sound like arguably unwarranted their life, including
the watches were pur- restrictions on our mental illness, heart
chased “in the middle freedoms such that disease, diabetes and
of the worst recession RSL clubs are finding cancer.
in almost a century, it too onerous to hold Primary school aged
with one million Aus- Anzac Day marches. children across Aus- HUNTERS HILL HAPPENINGS
tralians unemployed, At the same time, tralia – it’s time to get with Mayor ROSS WILLIAMS
businesses collapsing stadiums can be walking! One in 4
and a trillion dollars filled to watch football children in Australia is
of Liberal debt”—this games. overweight or obese, May I commend to you a new dis-
was the question that In effect, govern- and it is expected that play at Hunters Hill Historical Society’s
sent Morrison on his ment regulations are numbers will reach 1 museum at the Town Hall. Called “In-
tirade. killing Anzac Day, in 3 by next year,” he digenous Connections”, it depicts the
Labor love talking when we all unite in said. involvement of Australia’s first inhabit-
about the treatment thanks to our fallen We really need teach- ants of Hunters Hill.
of women, but they and respect for our ers, parents, carers and
have done nothing veterans, while pro- the community at large
moting sports which to get behind this event The display contains arte- deals in property or construc-
ST JOSEPH’S COLLEGE HUNTERS HILL encourage tribalism. and its objectives, the facts, photographs and story- tion, you can find out how to
If professional best exercise for all of boards. An informational book- make the planning process as
EINNFROORLMMAETNIOTN sportspeople had any us is regular walking. let has been published and is simple and easy as possible.
EVENING 2021 dignity, patriotism, or Children require at available free at the museum.
intellectual consist- least 60 minutes huff The booklet can also be viewed As well as looking at online
TUESDAY 4 MAY ency they would boy- and puff physical ac- on the museum’s website – ePlanning services, things such
cott playing until An- tivity every day. We huntershillmuseum.org.au. as what you need to know be-
SCAN OR REGISTER ONLINE AT: zac Day received the should encourage fore you lodge a development
WWW.JOEYS.ORG/ENROLMENTS same conditions as them to include walk- The project was made pos- application – and how we can
LIMITED SPOTS AVAILABLE them. ing at the beginning, sible with a community grant help you with the process - will
during and end of each from the Commonwealth Gov- be covered.
PETER CAMPION day – if you can’t walk ernment. Invaluable profes-
Tolga all the way, use public sional assistance in putting the The session will also highlight
transport and get off display and booklet together Hunters Hill’s values and herit-
the bus, train, tram or came from Macquarie Univer- age requirements and how best
ferry a few stops earlier sity. to understand its unique char-
and walk the rest of the acter as a garden municipality
way to school. This project recognises the and conservation area.
PETER HADFIELD important contribution made
by early Aboriginal people. The The session will be held on
Sydney museum is usually open week- Thursday 6 May from 7pm at
days between 10am and 12 Hunters Hill Town Hall.
noon. However, during COVID,
it is best to call the museum Go to huntershill.nsw.gov.au/
first on 9879 9443. participate for more informa-
tion and to register your inter-
Renovating and building plan- est.
ning
While an ideal session for
Next week, we are also host- residents, planners, architects,
ing a renovating and building lawyers or real estate agents,
planning information session. all community members are
welcome to attend.
If you are building or renovat-
ing, or work in an industry that Clr Ross Williams
Mayor of Hunters Hill
Wednesday 28 April, 2021 THE WEEKLY TIMES 5
LOCAL BUSINESS AWARDS FOR GLADESVILLE
ANTHONY ROBERTS MP
GLADESVILLE
SHOPPING VILLAGE
NEWSAGENCY
SUNNY VI HUONG –
HOT BREAD
FRANKIE’S WHEELS
AUSSIE
BITES
CAFÉ
6 THE WEEKLY TIMES Wednesday 28 April, 2021
Celebrate mum at Eden Gardens Welcome Elementelle
Celebrate mum this Mother’s Day at Eden Gardens, where you’ll find a variety of lush plant Probiotics MD
gifts that will grow long after the petals have fallen and show love for years to come.
With some great a delicious breakfast mum Happy Plant. No fuss,
combos like Parlour and luncheon menu on A great way to pick just results, time after
Palm in a beautiful ‘Ball May 9 with all mums the perfect gift for time.
Basket’, ready to grab getting a little pot of mum is to match her
and go at $40 or two colour to celebrate key strength with the The ‘way too busy
(2) pretty Cyclamens them. Book now so plant equivalent. and slightly out of con-
for $40. you don’t miss out The model mum is trol’ mum always has
- call Eden Gardens the one everyone is an interesting project
There’s a gift to suit on 9491 9900 or visit jealous of and secretly on the boil. You get
every mum at Eden edengardens.com.au wants to be. In the dizzy thinking about
Gardens. And why not plant world that trans- how she does what
make it a day? There’s A plant for every lates to the Moth Or- she does or imagine
half the stuff that she
chid. Sophisticated conjures. The perfect
and dramatic, it looks pairing for her is a Po-
great everywhere and thos or Devil’s Ivy,
always gets a second which comes in gold,
look. green, marbled white,
‘Happy Camper flecked green and
Mum’ is adaptable, loads of other creative
cheery and resilient, combos. It is versatile
bouncing back after too and will trail, climb,
small mishaps and grow in water.
makes others around
her feel better about The friendliest mum
themselves. Her natu- is the one all the kids
ral garden match is the like going to see. She
rubber tree, or Ficus bakes, knows great
Elastica. jokes and lets her hair
The super fit, ac- down on occasion with
tivewear mum that you. She can mend
☐ Eden Gardens has this Parlour Palm and spends her mornings friendships, fix bro-
beautiful ‘Ball Basket’ combo for just $40 in in the gym (can be a lit- ken toys and help you
time for Mother’s Day tle intimidating for the mediate the toughest
fuller figured mums) times. Her totem plant
and is flexible, thin and is the Peace Lily.
fast. Her plant match
is the Tally & Willowy The grandmum is
Bamboo Palm. a very precious lady;
The on-top-of-eve- cherished, loved and
rything mum is coor- revered. Her garden
dinator of the netball match is the Lady
team, is on the P&C Palm, which is elegant,
and spends her days long lived and adapt-
running a multinational able.
company. It’s no sur-
prise that the Umbrella Mother-in-law? ☐ John Kim is pictured left with JB, Gut Foundation executive Martin Cooper and
Tree is her pot plant There is even a plant Ryde Progress Association Treasurer Daniel Han. TWT on-the-spot PHOTO.
tribute. named after you…
Another mum we as- the Mother-in-Law’s- The Weekly Times managing editor John F Booth AM welcomed and in-
pire to be is the ‘earth Tongue, or Sanse- troduced Mr John Kim Managing Director of Pacific Blue Health manu-
mum’, who makes vieria, which perhaps facturers of Elementelle Probiotics at Hunters Hill Rotary Club’s recent
bread for her kid’s slightly cruelly has a fundraiser for the Gut Foundation at Hunters Hill Club.
lunches, prepares sharp point! On the
home-made hummus upside, they are hardy,
and knits them jump- gorgeous and right on
ers from home-spun trend and grow just Mr John Kim has over 20 years experi- Elementelle Probiotic range?: “We have
and hand-dyed llama about anywhere. ence in industries specialising in pharma- products that help with Brain & Cognition,
wool. Her spirit plant ceuticals, bio technology, IT and manu- Sleep & Anxiety, Kids Immunity & Learn-
is the Native Lemon The brand new mum facturing. ing, Healthy Ageing, Everyday Wellness,
Myrtle – perfect for doesn’t have time to Immunity Guard and Hair Skin Nails. We
tea, screening the fuss over plants as Pacific Blue Health has it’s head office at have recently introduced IBS Defence,
neighbours and a natu- she is flat out feeding, Macquarie Park NSW and the Elementelle Eczema Guardian and Women’s Health”.
ral insecticide. sleeping, changing etc. Probiotics range are made in Australia.
The contented mum And that’s just her, not TWT, Do you have any news to share
is just that - she’s done even the baby’s needs! We recently had a chat to Mr Kim and with us?: “We plan on introducing col-
her job, is satisfied with She deserves a Mon- asked him why he decided to found Pa- lagen products this year to help with fe-
that and is now reaping stera or Fruit Salad cific Blue Health. male skin health and to export our Made
the rewards. Her soul Plant. They look after in Australia product range to overseas
mate is obviously the themselves, and will He answered: “ I had a passion to im- markets”.
still be around grow- prove the health of millions of Australians
ing happily even when affected by intestinal health problems by TWT, What is a goal of Pacific Blue
the kids leave home. researching and developing a range of Health?: “Our goal is to be the number
That’s commitment! Australian made Probiotics. We all want one Australian Probiotic brand”.
to be happier and healthier and our El-
Celebrate Mum ementelle Probiotics range along with TWT, Could you share with our readers
with breakfast or lunch in exercise and a healthy diet can help to any lessons you have learned?: “I believe
The Gardens Restaurant at Eden achieve this”. you should have confidence in your vi-
sions and goals and continue to learn to
Mention this TWT, What is the focus for your com- achieve those goals. It is also important to
ad when booking pany?: “Pacific Blue Health’s focus is on be respectful and communicate openly”.
efficacy with our Elementelle Probiotics
and receive a range. We adhere to strict quality param- TWT, What is something that you try to
eters and meticulously select all ingredi- do each day?: “I try to enjoy all moments
FREE ents based on scientific evidence”. and live every day to the fullest with posi-
tivity and passion”.
glass of bubbles TWT, What products do you have in your
for Mum
We accept the NSW Dine & Discover vouchers Macquarie Park WWeepprorvoidveiidnfeorimnaftoiornmanadtrioefnerraalnadssisrteanfecerrwaitlhafosrsmisfitllainng,cdeirewct istuhppfoortrmworfki,llciansge ,mdaniraegecmtesnut pport
edwucoartiko,nacl agrsoeupsmanadncaomgmemunietyndteveedloupmceanttioprnogarlamgeros.uWpesalsaonrudn gcrooump smesusionnistythrdoeugvheoulot pthme yeeanrt
Book now 0422 712 617 or for more information profogr oruarmcoenssti.tuWenets.also run group sessions throughout the year for our constituents.
visit edengardens.com.au For more informatioFno, rplmeaoseregeitninfocromntaacttiownith, pAnlenaesGehagriebitaninvicaoounrtawcebtswitei,thphone or email:
Email: [email protected] v| iPahoonuer: 0w49e0b4s7i2te6,06p|hWonebesioter: ewmwwa.ial:rcaustralia.org
eden gardens macquarie park eden_macquariepark Address:ESmuiateil5: 2A2/nLneeve.lG5,h7aErdibeniaPnar@k Darrivcea, Musactqraualiraie.oParrgk, NPSWho2n1e13: 0490 472 606
Website: www.arcaustralia.org
Address: Suite 522/ Level 5, 7 Eden Park Drive, Macquarie Park, NSW 2113
Wednesday 28 April, 2021 THE WEEKLY TIMES 7
Introducting Elementelle and
a new way of looking at life
We are an Australian company with a passion
for better gut health. We have exclusive
access to scientifically validated initiatives
and breakthroughs. Visit our website for all
information www.elementelle.com.au
and to take advantage of the current
25% discount across the range.
* Competition and discount campaign will end 3/5/2021.
Premium probiotics combined with prebiotics
and specialty vitamins & minerals to
renew, reactivate & respond to ever yday life
www.elementelle.com.au
8 THE WEEKLY TIMES Wednesday 28 April, 2021
Boronia Park’s controversial clubhouse moves forward
A controversial proposal for a rugby clubhouse and com- Mayor Ross Williams “We will have terms Hunters Hill Rugby vate changing rooms nity centre between
munity centre between Boronia Park Ovals One and Two will said the facility will and conditions for hire Club spokesman in the facility. Ovals One and Two
be progressed to a development application stage. not be available for but not everything Blake Walker said the because the funding
“private celebrations” goes smoothly and club is happy with the “Just two weeks ago promise by Lane Cove
Hunters Hill council- community centre events will take away after 5pm and Clr Zac we encourage people 5pm curfew and will we held a tournament MP Anthony Roberts
lors last week voted proposal which she our right, as local resi- Miles said it will be to contact the police only be doing what it event that had over was announced at the
unanimously to pro- said had ‘morphed’ dents, to enjoy peace locked at night, kept if there are anti-social already does on the 100 women players Boronia Park Grand-
ceed with the propos- from being a small and quiet. clean and monitored events, but we do site. and a lot of them were stand.
al which is expected rugby clubhouse into by surveillance cam- have safeguards in “There is emotive getting changed in the
to see a Hunters Hill a large project that will “I cannot help but eras. place.” talk about it being a open.” “This is for the wrong
Rugby Club facility impact on residents. foresee the behav- function centre but building in the wrong
built on the council “It has morphed into iours that will come “It was never the Residents will also we consider it to be The Rugby Club is place,” she said.
owned parkland which a much larger project from alcohol fuelled intention to have this have an opportunity a community facility raising the money for
can also be used by to build a community night time events.” operate as a func- to comment on an and we look forward the building with fund- “And while the coun-
the council for com- centre for the council tion centre,” Clr Miles expected develop- to seeing it through,” ing support from the cil wants to view this
munity functions. to hire for commercial Her neighbour Emily said. ment application be- he said. NSW Government. facility as a long term
purposes, weddings Yan said her con- fore it is endorsed by He also raised an- asset it is hard to
Neighbouring Park and other events,” she cern was with ampli- General Manager the council to be sent other point about be- Local resident Mrs see how a sufficient
Road resident Barbara said. fied noise and how Lisa Miscamble none- to a local independ- haviour on the oval Dawson questioned income fee can be
Enwright expressed “Staging large anti-social behaviour theless acknowledged ent planning panel for and the need for pri- whether or not the received from hiring
concern about the around the premises the residents’ con- consideration. government fund- fees from community
will be prevented. cerns. ing was intended to groups.”
support a commu-
Council rejects $2m Gladesville
Reserve synthetic turf deal
A TWO MILLION dollar government grant that could have fund-
ed a synthetic turf playing field at Gladesville Reserve has been
knocked back by Hunters Hill councillors.
The grant was recently promised by in our own right because we have one ☐ Lawn bowlers, above, flocked to Denistone Bowling Club earlier this month for a charity event to raise funds
Lane Cove MP Anthony Roberts but in three local residents involved with the for Lifeline and, below, competitors in action.
councillors voted by three votes to two club and yet we have the worst pitch in
last week to oppose synthetic turf on the whole association.’’ Denistone Bowling Club Supports Lifeline
the Reserve, with Liberals Clr Zac Miles
and Clr Ben Collins supporting it. All Saints argue that a grass pitch Nearly 50 lawn bowlers spent the day enjoying three games of social bowls for charity earlier this month.
would be inadequate because of the
The council will now pursue a suc- wear and tear on it due to excessive The fundraiser for Lifeline Harbour Organiser, Stewart Skinner, said “I believe this event has created
cessful alternative motion put by Dep- use. to Hawkesbury on April 12 also saw he was overwhelmed by the support a blueprint for other clubs to follow
uty Mayor Clr Jim Sanderson to investi- participants dancing on the rinks to for the event. our lead and organise similar fund-
gate the feasibility of a high grade grass “There is no plan B,” Mr Clayton said. 50s and 60s pop music in an enjoy- raising events,” he said, adding it
pitch - as used by Mosman Council on But many local residents reject this able and memorable day. “It was so uplifting to see people might become an annual event at
the pitch at Middle Head - alongside argument and said the existing grass having so much fun in supporting Denistone.
upgraded changing rooms and seating, pitch is often used by locals for recrea- “It was a day of great fun and com- such a worthwhile cause” he said.
should Mr Robert’s promised grant be- tional activities that include dog walk- munity spirit,” said Jack Lunberg Anyone who wishes to contact
come available for this purpose. ing. from North Ryde RSL, one of many “In addition to the lawn bowls we Lifeline to ask for assistance can call
“Plan B is to go somewhere else!” members of local bowling clubs in had a lunchtime trivia quiz and a raf- 13 11 14. Donations to the organi-
The council rejection came during a Henly resident Mrs Armstrong said. the district who turned out for the fle, both of which contributed to the sation can also be made via www.
heated debate in the Council Chamber “This is a community park, it is not a fundraising day. day’s outstanding result.” lifelineh2h.org.au
where 22 speakers for and against the homeground for anybody.”
proposed turf argued the case that it Local resident Joanne Eckerman More than $5,000 was raised to Chairman of the Denistone/Car- Upcoming Denistone Bowling
is vital to upgrade the current playing agreed. support the work of Lifeline which lingford BC, Mr. Nick Martelli con- Club events include: 7th May Two
field, which is used by the Hunters Hill “This is a stealth privatisation of a provides suicide prevention, crisis gratulated all involved in the event’s Bowl Triples and 23rd May Jackpot
All Saints Soccer Club. public place,” she said. intervention and recovery services. success and praised the generosity Pairs.
But whether or not the adopted al- of participants.
Councillor Collins was furious with ternative grass pitch proposal will be
Mayor Ross Williams, Clr Sanderson funded by the state government is a
and Clr Elizabeth Krassoi for voting matter of opinion, with council staff
against the proposal. unable to produce a government au-
thorised deed of agreement to fund any
“You are an absolute disgrace and project at all.
I’m sorry for this club, this is negligence Councillor Zac Miles said he was with
and I hope you get thrown out of this Mr Roberts when the two million dollar
council in three months time,” he said. grant was promised and he is adamant
it was specifically for synthetic turf.
Mayor Williams said Planning Minis- “That’s it, the grant has gone!” he
ter Rob Stokes had expressed concern said.
about the environmental impact of syn- “The idea that Anthony Roberts is
thetic turf while Clr Elizabeth Krassoi going to commit two million dollars to
said she had not been convinced by something the club doesn’t want is just
the business case to support the intro- not going to happen.”
duction of this type of playing surface Mayor Williams believes the funding
at the Reserve. offer will not be withdrawn.
“There is still an opportunity to get a
“We are where we are today because high quality playing field and I think it is
the business case just wasn’t good important we get it right,” he said.
enough,’’ she said. Club supporters put forward a num-
ber of cases for synthetic turf, which
“I’m sorry for the club and I’m very is common in other council areas but
disappointed.” non-existent in Hunters Hill.
Their main case is that synthetic turf
The debate brought soccer club sup- is an all-weather surface that will allow
porters who want the turf into conflict soccer games in all seasons.
with Henley residents who want the re- “Often our game cancellations come
serve to stay as grass. at the very last minute and they cause
disruption and disappointment,” All
With an estimated 915 local mem- Saints soccer mum Melonie Vale said.
bers, the club argued the existing pitch
is in a poor condition and is responsible
for injuries sustained by young players.
“It would be criminal to stop synthetic
turf going ahead,”Michael Clayton from
All Saints said.
“We are nearly an entire council ward
Work progressing on new ‘Mausoleum Northern Cemeteries Mother’s Day Services
of The Holy Way’ at North Ryde
Field of Mars Cemetery Mother’s matorium
The Mausoleum of The Holy Way at Macquarie Park Cemetery and Crematorium Day Memorial Mass Cnr Delhi and Plassey Roads, North
offers families an exceptional memorial option when it comes to remembering
and honouring the lives of ancestors. Date: Saturday 8 May 2021 Ryde
Work is progressing on the Park, and one that will help corporate a courtyard and Time: 10:15am for 10:30am start, Northern Cemeteries, in conjunction
construction site of a new support Sydney’s growing water features, new land- morning tea to follow
mausoleum that will be- need for burial and vault op- scaping including a sepa- Field of Mars Cemetery with Wilson Family Funerals, cordially
come the centrepiece of a tions. rate reflection garden, and Quarry Road, Ryde invites you to honour the great moth-
major expansion project un- an amenities block. Northern Cemeteries, in conjunction ers (and mother figures) that are no
derway at Macquarie Park “Caring for our community, with Father Greg Morgan, cordially in- longer with us. We provide this com-
Cemetery and Crematorium, in all its diversity, means “Offering this opportunity vites you to honour the great mothers munity service as a celebration of
North Ryde. providing a level of memo- further serves our commu- (and mother figures) that are no longer love, life and family.
rial choice that is strongly nity who now expects and with us. We provide this Catholic mass
The Mausoleum of The aligned with the demands appreciates better memo- as a celebration of love, life and family. Complimentary morning tea to fol-
Holy Way will stand as an and expectations of our in- rial places, spaces, and sur- Complimentary morning tea to fol- low.
impressive semi-open struc- creasing population,” Mrs rounds,” said Mrs Tritton. low.
ture built on undeveloped Tritton explained. Places are limited. R.S.V.P by Sunday Places are limited. R.S.V.P by Sunday
land adjacent to the Sta- “We are really looking for- 2 May 2021 to Amelia a.morgano@ 2 May 2021 to Amelia a.morgano@
tions of the Cross area, in “Our new mausoleum will ward to our new mausoleum nmclm.com.au nmclm.com.au
the Catholic section. give families an additional being ready by late 2021.”
and exceptional option Macquarie Park Cemetery Moth- Each year Northern Cemeteries
Its design complements when it comes to remem- Northern Cemeteries is a er’s Day Memorial Service asks our families to send in wonder-
existing surrounds and pro- bering and honouring the life leading not-for-profit me- ful photos and stories to commem-
vides a sanctuary for re- of their ancestors for – gen- morial provider overseeing Date: Sunday 9 May 2021 orate their loved ones at this beau-
membrance, worship, and erations to come.” five sites located on Crown Time: 10:15am for 10:30am start, tiful event. Dedications will also be
quiet reflection. land throughout the north- morning tea to follow shared on the Northern Cemeteries
Features include above ern suburbs of Sydney and Magnolia Chapel Facebook and YouTube pages.
Northern Cemeteries CEO ground crypts, family vaults Newcastle. Macquarie Park Cemetery and Cre-
Pauline Tritton said the pro- and various columbaria Please send through photos and
ject represents a significant spaces for ash interments. For more information con- stories to [email protected]
commitment for Macquarie tact 1300 389 888 or visit by Sunday 2 May 2021.
The new area will also in- northerncemeteries.com.au
Wednesday 28 April, 2021 THE WEEKLY TIMES 9
Celebrating OF THE
City of Ryde
DEVELOPMENT APPLICATIONS RECEIVED & DETERMINED
For full details of the development applications received and determined
visit www.ryde.nsw.gov.au/eServices
Received between 15 and 21 April 2021
LDA2021/0128 32 Smalls Rd RYDE
MOD2021/0075 388-390 Lane Cove Rd MACQUARIE PARK
LDA2021/0114 1 Finch Ave EAST RYDE
LDA2021/0115 85A Western Cr GLADESVILLE
LDA2021/0118 16 Short St GLADESVILLE
Edna Wilde OAM, Clr Edwina Clifton, Clr Penny Pedersen and City of Ryde Mayor, LDA2021/0120 1/2 Quarry Rd RYDE
Clr Jerome Laxale. LDA2021/0121 326 Morrison Rd PUTNEY
100 years of women in SWAP is a chance to express your LDA2021/0124 50 Buffalo Rd GLADESVILLE
local government creativity through re-purposing LDA2021/0125 1 Stansell St GLADESVILLE
rubbish and recovered materials. At LDA2021/0126 8 Storey St PUTNEY
It was great to join past and present a time when reducing waste is more LDA2021/0127 146 Morrison Rd PUTNEY
councillors to celebrate 100 years important than ever, SWAP presents MOD2021/0078 62 Badajoz Rd RYDE
of women in local government by a fun opportunity to learn new skills LDA2021/0116 27 Hollis Ave DENISTONE EAST
unveiling an honour board which and explore the artistic potential of LDA2021/0117 3 Rokeva St EASTWOOD
recognises every woman who has items you would usually throw away, LDA2021/0119 82 Tarrants Ave EASTWOOD
served as a councillor at the as well as improve awareness of the LDA2021/0122 14 Ryedale Rd DENISTONE
City of Ryde. environmental issues we currently face. LDA2021/0123 14 Ryedale Rd DENISTONE
As always, Council will be running a LDA2021/0129 303 Rowe St EASTWOOD
A total of 17 women have served as series of free workshops throughout MOD2021/0076 2 Hillview Rd EASTWOOD
councillors for the City of Ryde, with the year and has created educational MOD2021/0077 2 Hillview Rd EASTWOOD
Edna Wilde OAM the only woman to resources and videos to help you
create your entries.
have served as Mayor. Determined between 15 and 21 April 2021
With $5,000 in prizes and more LDA2021/0069 63 West Pde WEST RYDE
Mrs Wilde OAM was present at the opportunities to get creative, this LDA2021/0082 195 Buffalo Rd RYDE
unveiling as well as current serving environmental art competition is not LDA2020/0185 19 Myra Ave RYDE
councillors, Clr Edwina Clifton and to be missed. Entries close on Sunday MOD2021/0072 40 The Strand GLADESVILLE
Clr Penny Pedersen. Former deputy 1 August. For more information visit LDA2020/0276 75 Wharf Rd GLADESVILLE
mayors Lyn Langtry and Gabrielle www.ryde.nsw.gov.au/SWAP LDA2020/0348 259 Rowe St EASTWOOD
O’Donnell, and former councillors MOD2021/0041 64 Lovell Rd EASTWOOD
Nicole Campbell and Roslyn Lunsford Launch of the City of Ryde LDA2020/0443 9 Lincoln St EASTWOOD
were also present. Grant Finder MOD2021/0036 18 Hollis Ave DENISTONE EAST
At a time when we need more female The City of Ryde has made it easier HAVE YOUR SAY
representation at local government for community groups, businesses OPEN COMMUNITY CONSULTATIONS
level, this honour board also and not-for-profits to find and apply
underscores how much work has to for grants with the launch of Council’s You are invited to have your say about documents, projects and proposals
be done to make this happen. Grant Finder. that are currently on public exhibition, or provide feedback on services and
Of the 312 councillors who have concerns that affect the community.
served on the City of Ryde and The Grant Finder allows local • Forrester Park Playground Upgrade (Closing 5 May 2021)
Eastwood councils since 1870, only organisations to search for funding • Field of Mars Reserve Masterplan and Plan of Management (Closing 9 May 2021)
17 of those were women. opportunities and filter grants by • West Ryde Town Centre Draft Masterplan Options (Closing 14 May 2021)
specifying location, industry and the • Devlin Street Pedestrian Bridges
It is for this very reason that the type of project. This free service also • Graffiti Vandalism in the City of Ryde
City of Ryde recently joined the provides email alerts and advice for • Immunisation Clinic Customer Experience Survey
Australian Local Government finding and applying for grants. • Traffic & Parking Around Schools
Women’s Association NSW to help Want to find out more?
The Grant Finder is available at To find out more about one of the above projects or for information on how
run forums and training designed to cityofryde.grantguru.com.au to provide feedback, please visit www.ryde.nsw.gov.au/haveyoursay or call
Customer Service on 9952 8222.
encourage more women to run for Sincerely,
Council.
SWAP returns
The City of Ryde’s annual Sustainable Clr Jerome Laxale
Waste 2 Art Prize (SWAP) is back Mayor
Phone 9952 8222
for its 11th year in partnership with [email protected] Ryde Hunters Hill Home Modification
Meadowbank TAFE. and Maintenance Service
SAT LIBRARY EVENT Minor modification and maintenance service to support people
over 65 years of age to remain living in their own home.
1 CELEBRATE THE 10TH BIRTHDAY OF RYDE LIBRARY
Services include: Benefits
MAY Come and join in the fun and get your yummy cookie whilst
admiring our fantastic LEGO display by SydLUG. • Minor carpentry, plumbing and • Subsidised cost to customers
Where Ryde Library electrical work approved by My Aged Care
When Saturday 1 May 2021
Time 10.00am – 2.00pm • Gutter and window cleaning and • Licenced and insured contractors
Cookies limited to 1 per person. pressure cleaning
For more information visit • Option to pay in interest free
www.ryde.nsw.gov.au/10thbirthday, • Installation of lever taps, monthly instalments
phone 9952 8222 or ask library staff. grabrails, handrails and ramps
Contact the Home Modification and Maintenance Team on 9952 8308
or call My Aged Care on 1800 200 422 to be registered.
/CityofRyde Customer Service Centre: 1 Pope Street, Ryde
www.ryde.nsw.gov.au Locked Bag 2069, North Ryde NSW 1670
P: 9952 8222 E: [email protected]
10 THE WEEKLY TIMES Wednesday 28 April, 2021 North Ryde Fresh Opens
DINING & TAKEAWAY
ASHFIELD Three Chefs & Co Dolcini Victor & Julie Dominello open
GOLDEN TIMES RESTAURANT Level 1, Macquarie Centre Shop 1, 90 Charles Street at Blenheim Road North Ryde
WESTS ASHFIELD LEAGUES CLUB 197 herring road , 9808 4111
Macquarie Park Victor Dominello and his wife Julie recently opened North Ryde Fresh - a
Eastwood115 Live8r7p5o2ol2R11d1Ashfield Meadowbank purpose designed and built fresh fruit shop at 10 Blenheim Road, North Ryde.
CAFE DAKOTA
Club Eastwood – The Bizzo Pizzeria Locale Both Victor and straints. So pop down to Opening times:
33 Waterloo Road, Ristorante Julie grew up in the Another service North Ryde Fresh Monday - Friday:
6 Hillview Rd, Eastwood Macquarie Park Ryde area and were - Victor is looking 7am- 6pm and
9874 0221 Shepherds Bay Village Plaza so happy to be able that Victor supplies forward to meeting Saturday: 7am-
Marsfield Shop 6, 1a/11 Bay Dr, to return here with is local deliveries at you! 3pm.
Noble House M9e8a0d7ow61b6a1nk their new venture no extra cost.
Seafood Restaurant Mediterranean Gourmet Pizza after 10 years away
& Pasta Restaurant Ryde-Eastwood working in another NOW OPEN
25 West Parade, Eastwood Leagues Club fruit shop.
9874 1888 Shop 8, 1 Trafalgar Place 9876 8089 North Ryde Fresh
The Coffee Club Victor’s passion
Epping North Ryde Beer & Wine in life is supplying 10 BLENHEIM RD, NORTH RYDE. PH: 02 9888 7310
Golden Hawk fresh produce and
Zappis Pizzeria Café Billys Fresh Seafood, personal service to
Kebab & Burger Chinese Restaurant his customers - no
17 Oxford Street www.releagues.com.au doubt inherited from
Cox’s Rd Mall North Ryde 117 Ryedale Rd 9807 2444 his grandfather who
Gla9d87e6s22v1i8lle 9888 3969 owned and ran a
Top Ryde fruit shop in East-
Cav & Co Caffe Incontro wood for over 20
Soul Origin years.
20 Pittwater Road | 9816 4108 Cox’s Rd Mall North Ryde
9888 9901 Top Ryde Shopping Centre Every morning Vic-
Phatboy Thai Level 1 and LG02 | 8729 0801 tor is up at 2am to
Dragon on the Green go to the Markets to
249 Victoria Road People Café buy fresh produce
9817 0999 North Ryde Golf Club and be back to the
Twin98R8o7a4d4, 2N2orEtxhtR4yde Top Ryde Shopping Centre shop ready to open
Da Toto’ Level LG1, in front of JB Hi-Fi by 7am - provid-
Riverviews Bar ing assurance that
1/3 Wharf Road, & Dining 9808 3171 the produce you
Gladesville 8488 6199 are buying is super
Cnr PitNtwoarttherR&ydMeaRgSdLala Rds Nikan Restaurant fresh.
Ping’s Kitchen North Ryde 9888 7588
100 Blax9la8n0d7 R22d8. 8Top Ryde Victor has a ready
Gladesville RSL Marble Cafe supply of cut fruit
4-6 Linsley Street, Gladesville West Ryde and yoghurt - so
North Ryde RSL easy for you to pull
9816 2999 Cnr Pittwater & Magdala Rds Etna Trattoria up out the front of
his shop and grab
Casanova North Ryde | 9888 7588 10 West Parade | 9807 7479 a healthy lunch for
your children on the
199-201 Victoria Rd. Gladesville Rhodes Woolwich way to school or for
9817 5000 yourself on the way
Oliveto Ristorante E Bar Deckhouse to work. And on the
HUNTERS HILL way home you can
Brays Bay Reserve Clarke Road, Woolwich Dock easily drop past to
Lipari Pizza Bar 4434 Concord Rd, Rhodes 8279 2706 pick up all those es-
sentials: milk, bread,
1/53-55 Gladesville Rd 8765 0006 Cucinetta eggs, cream, banan-
9816 5925 as or all the ingredi-
Putney 100 Woolwich Rd. Woolwich, ents for a tasty graz-
OTTIMO ITALIAN KITCHEN 9817 2125 ing board or pasta
Charcoal Chicken meal.
35 Alexandra St
9817 1110 88 Charles Street Victor even has an
9808 5311 array of sweet Italian
Macquarie Park biscuits for dessert
and beautiful fresh
Basils Seafood flowers for that spe-
cial someone.
58-62 Delhi Road | 8899 8980
In fact North Ryde
DINE & DISCOVER READY Fresh is a bit of a
one stop shop.
New Locations to Pick Up • FRESH FRUIT & VEGETABLES
A Copy Of The Weekly Times In the next few • CONTINENTAL AND ASIAN GROCERIES
weeks Victor and • PREPACKED DELI, MEAT & CHEESE
AM Newsagency Roma Vino Aldi Lane Cove Julie will be intro- • FRESH CUT FLOWERS
1053 Victoria Rd, 3/30 Roma St, The Canopy Shopping ducing frozen home • DELIVERY AVAILABLE IN LOCAL AREA (IF YOU SPEND OVER $40)
North Epping made pasta meals • WHOLESALE DELIVERY ALSO AVAILABLE
West Ryde Centre, Lane Cove - making it even
easier for their val- Opening times:
Moko Eastwood IGA Greenwich Agency 1 Real Estate & ued customers to monday to Friday: 7am - 6pm | saturday: 7am - 3pm
75 Rowe St, Eastwood Greenwich Road Joanne’s Flowers Galore eat a healthy meal
Avon Rd, North Ryde with today’s time re- 30% OFF
Pishon Patisserie Greenwich FOOD BILL
& Cake Café Midway Newsagency Aldi Eastwood
62-80 Rowe St, TO REDEEM
1/77 Rowe St, & Post Office QUOTE DISCOUNT
Eastwood Midway Shopping Eastwood CODE: CASANOVA30
Three Chefs & Co
Boronia Bakehouse Centre Level 1, Macquarie Centre
95a Pittwater Rd, 119e North Rd, Ryde 197 herring road ,
Macquarie Park
Hunters Hill Club Eastwood
10000 Lab Coffee - The Bizzo Ron Schofield Men’s
Hairdresser
& Bakery 6 Hillview Rd,
81 Rowe St, Eastwood Eastwood 4A/ 22 Blenheim Rd,
Eastwood SuperFresh North Ryde
La Vigne Bakery
8/1 Progress Ave, 82 Rowe St, Eastwood
Eastwood
North Epping The Good Fuel Inn * Offer valid from April 14, 2021
Etna Trattoria Pizzeria Uppercuts Butchery
10 West Parade, 8/288 Malton Rd, Cnr Cox’s & Badajoz Call us on: 02 9817 5000
West Ryde Rd’s, North Ryde 199-201 Victoria Rd, Gladesville NSW 2111
North Epping www.casanovaitalian.com.au
Zappis Pizzeria Café Nextra Newsagent
17 Oxford St, Epping IGA Xpress Level 3, Macquarie Centre,
10/275 Malton Rd,
Coles Epping 197 Herring Road,
53/57 Rawson St, North Epping Macquarie Park
Near Marco’s Cafe Dakota
Epping Hot Bread Cafe
276 Malton Rd, 33 Waterloo Road,
North Epping Macquarie Park
Wednesday 28 April, 2021 THE WEEKLY TIMES 11
Ryde Central: an exercise in creative
accounting and underwhelming transparency
proval for Ryde Central, have been contaminated The Mayor’s $110 million, fixed-
with the false statement along the lines of: “In price redevelopment fantasy
2015 SafeWork NSW deemed the Civic Centre
unsafe…..” I Cilyof Qyde Confidential Items Page 166
What’s important to consider here is that Safe- LHtsty'tandOl)OOrll.WIIV
work NSW, as the state’s agency dealing with @yOll' OOOrilep
safety in the workplace has the power to shut
down or ban a site if it is dangerous. It did not. ITEM 13(continued)
TRUTH-0-M ETER Hi Pel", Forecast Budget Funding and Financing Summary TRUTH-0-M ETER
ThertlrtlllinyftpOrtsthithMbfflp!'fl)ifedinrNtlOlltothtold Rydf Ctntt1lbuikli11and,in~rlitulir, thecOilof
itlurbMrnt,IIJrttsofit. ESTIMATE Notes
TherPl)OftSl!!iltsc,1014•2016,
Ryde Central Project Cost ( }!125,000,000
The fflOII ptrnneii! rqxwt !wlr:!lindatts the cmc to ht SUm (in 2014 dollars) or S15.2m in toda(sdolla~. (Target Contract Sum • Project Management •
TRUE FALSE TRUE FALSE
TheWilno1thtcou,th!M!lfil.thtl.tal!functioni11ndfi1forpurpow)~e1hetlir,tmgolficebuildinap10YidH. Contlnoencvl
It was built nMly !IOlfMSKli!iylefwbiihnn/rwofit worbwould nml to~ compliant with current Buildi" Cocle of A~tralia
st.1nclank. Internal Reserves ("2,500,GO( 2
St.1ff rurrtnt~louttd 11NROWOl.dcl~no1 lit.in thtmstin1bui16111, nt(ts.S~atingthe nttd tocorut1llCt1 new offkt building
idjacrnitothtexisnrcbiti!e:to•rommod,ittaluaffcwmdylocated11 NRO. External Loan Borrowings . - (!6~500,000) 3
lamhappytotlabontenrthtrMtuu>UldcJw«kshopl'ltllT11tW'1j9April2019at7JOpm)'llhte"elwilbtdMll~ngtlltc.ostofa '
CLAIM: The Ryde Central
.,,.,•11Nofficebuid'111- CLAIM:Then there’s the $110m - up from from the initial “Refurbishing the
redevelopment will cost $110m
StevenKkldns $98m - Mayor Laxale continues to cite as the Civic Centre would cost four
SOURCE: Mayor Jerome Laxale OimC,orp::»aleServr.es cost of the Ryde Central redevelopment.
VERDICT: False CljofRjde Unfortunately, he also knows the new figure times the $16m figure quoted
P: (02)99528011 is out of date after a confidential briefing of
M: 0466"8762 councillors in early 2020 by Mr Kludass, who by State Member for Ryde
E: ~ ! l ! Y J ! j estimated the cost at that stage, was expect-
W: ~ ed to be closer to $125 million plus GST. (see Victor Dominello and former
secret meeting document above).
The case of the missing Ryde Civic At the same briefing, he also detailed to staffer Steve Kludass who, up
Centre refurbishment option councillors that Ryde intended to break its
own rules and provide less car parking spots until recently, ran the project
And so, armed with the furphy of Ryde’s Civic for the new development than it forces other
Centre being a ‘dangerous’ building, the city’s developers to provide.
Last week, The Weekly Times revealed how a officials deprived ratepayers of their chance to SOURCE:The 25 per cent cost blow out so far is un-
Safework NSW ‘Improvement Order’ over a rel- have a say on whether they preferred a refurbish- Mayor Jerome Laxale
atively minor matter - one fallen roof tile and a ment option for the building. derstandably concerning some councillors.
carpet trip hazard - was deceptively misused to Ryde Councillor Jordan Lane said he’d op-
fool Ryde ratepayers and councillors into believ- The cost of that refurbishment “in today’s dol- posed the exorbitant cost of the Civic Centre
ing the Civic Centre was structurally unsound lars” would have been around $16.5m according VERDICT:redevelopment since being elected a council- False
and dangerous. to an email (pictured above) sent to Labor Dep-
The deception happened in plain sight and no uty Mayor Peter Kim by now-departed chief of lor.
one has yet bothered to address it or correct the the Ryde Central redevelopment, Steve Kludass. “I was initially impressed that City of Ryde
record. had a financial reserve of some $60m in the
Despite this, a conga line of Ryde Council’s bank,” Clr Lane told The Weekly Times.
It was also a success. The ringleaders man- politicians and staffers have continued to inflate “With this project we’ll now end up at least
aged to con a majority of Ryde Council’s ultimate the real cost of refurbishment, including Ryde $60 million in debt and ultimately, I don’t be-
decision makers into making the decision to un- Central’s cheerleader-in-chief Mayor Jerome lieve it’s a cost ratepayers should have to
necessarily evacuate the building and for rate- Laxale. pay.”
payers to then fork out millions for new offices Mayor Laxale, first elected on a platform of
that were just part of a charade. In an open letter to the TWT in which he - not saving the Civic Centre in 2012, is now driv-
surprisingly - criticised Ryde’s State Member, ing its demolition, armed with various claims
And now, communications materials, media Victor Dominello, for his comment piece in the and figures The Weekly Times believes should
commentary in the public domain and even the TWT a week earlier - Mayor Laxale said: “a re- be scrutinised. tempt argue his version of the facts.
documents seeking NSW Planning Panel ap- furbishment of the current Ryde Civic Centre and Understandably. Last week’s revelations
Civic Hall would also cost more than four times Mayor Laxale reacted to last week’s expose
the $16m figure quoted by Mr Dominello.” by playing the man and not the ball, poking were almost entirely supported by official in-
fun at The Weekly Times and avoiding any at- formation from City of Ryde documents.
Mayor Laxale may need to find a new team of
contractors - Mr Kludass could surely assist. MORE ON THE RYDE CIVIC CENTRE SAGA NEXT WEEK
12 THE WEEKLY TIMES Wednesday 28 April, 2021 NOW
A BRIGHTER 2021 OPEN
in the heart of Ryde
Calvary Ryde Retirement Community is set amongst
8 acres of landscaped grounds, where you can join
an established community for people who value their
family, health and independence.
Retirement Living Residential Aged Care
A delightful downsizing dream that opens up a Live a fulfilling, secure and relaxed lifestyle in
wonderful world of comfort. Choose between: one of 116 spacious private rooms with ensuite.
Dalton Residences
Brand new 1, 2 or 3 bedroom apartments
Dalton Gardens
2 or 3 bedroom villas with private courtyard
www.calvaryryde.org.au Call Craig Robinson on
02 8878 5815
for a private tour
Wednesday 28 April, 2021 THE WEEKLY TIMES 13
Getting creative with finance problems
Dr Sally & Mr Sam have just left acquired by their Rather than effec- each year. will be 0% for them
my office very happy indeed. SMSF. tively paying 49% Plus, having the since they’ve run
Since the property tax on the rent, the property tucked their business from
is owned in their 15% tax rate in safely away in Su- there for 7 years.
They have a com- al, to land a variable personal names SMSF will save them per will certainly tick
mercial loan of rate of 2.39%, sure (the same beneficial $61,000 every year. the asset protection * Jason C. Khoury,
$1.4M owing on they’d save $22,000 ownership as their box. JP, Financial Strat-
their building that re- every year, but this is SMSF), the Stamp hen they hang their A Capital Gains egist, iChoice Man-
ceives rent of $180K a little boring. Duty will be a flat boots up, their SMSF event will certainly aging Partner can
per annum from their $500! tax rate will be 0%, occur, but the tax be contacted on
own medical centre We got chatting. saving them $88,000 9743 0000
business. Like many medical
By TWT Finance Editor professionals, they SatOPuErNdFaOyR2I-N2.S3PE0CpTImON
Jason C. Khoury* We could refinance incorrectly assumed
this loan, using their there’d be Stamp
owner-occupied Duty payable if their
property as collater- property were to be
ADVERTISEMENT Eastwood auction
The longest established Strata 1000 sq metre Block
Management in Eastwood 621 Blaxland road, eastwood
Are you frustrated with the service you are currently Brick home within 500 metres to Eastwood station and shops,
receiving from your strata managing agent? offers 3 bedrooms, sunroom, study and separate granny flat.
Then it’s time to change! First time offered since 1926 !!! Auction on site 15th May at 2pm.
Cristina Penedo is the founder of MCP Strata
Management. She is a Licensed Real Estate and C98al0l 4Fr7an2k2B2o|nn0e4r 1fo4r inspection and full details
Strata and Community Managing Agent with years
of experience in the property sector. 221 887
Now Cristina is here to help all clients solve
problems and make their lives easier. 10/35 West Parade, Eastwood
MCP Strata Management services all areas of Sydney, specialising in
residential, industrial & commercial Strata Scheme developments. email: [email protected]
website: www.eastwoodrealestate.com.au
“We pride ourselves on winning the trust
and loyalty of many satisfied customers.”
Talk to Cristina today and find out why we are the best!
STRATA MANAGEMENT PTY LTD
Contact us on: 02 88141668 or 02 88141728
PO Box 56,Eastwood NSW 2122
• Email: [email protected] •
In Strata ... because we care!
Knockdown rebuild specialists - Custom designed and built homes.
New display home now open @ 23 Kingscott Place Castle Hill
Inspect: Wed 1-5pm | Sat & Sun 11am - 4pm
9868 3222 | www.binethomes.com.au
14 THE WEEKLY TIMES Wednesday 28 April, 2021
Handy Phone Guide
The Weekly Times 9807 6666
ACCOUNTING bathroom BUILDING CARPENTRY
renovations CONTRACTORS & JOINERY
ACCOUNTING & TAXATION SERVICES
(continued) TASSONE DESIGN & CONSTRUCT James 0428 581 542
0414 658 956 ANDREW’S BATHROOM RENOVATIONS
0418 493 789 For construction of & repair of decks, pergolas,
• C hartered Accountant & Registered Tax Agent 0414 577 574 For all new work, extensions & alterations, doors & new building work call James
• Provided at reasonable rates renovations or refurbishments. Lic 179663c
www.rgaccounting.com.au • Over 35 years experience in bathroom, MBA Quality work.
kitchen & laundry renovations Lic 100569c CARPET LAYING
AIR CONDITIONING • Qualified & Insured workmanship.
• Projects available on Website BP CONSTRUCTIONS BILL ROWE CARPETS 0410 602 631
ACE AIR CONDITIONING • Call for free measure and quote
www.perfectceramics.com Lic R71536 0411 420 011 Brett 9684 6948 New carpet laid, re-stretching, repairs.
0411 967 333 JAYCORP RENOVATIONS 40 yrs experience.
All building work including renovations,
Sales, Repair & Install Split & Ducting A/C. 0424 261 818 extensions, decks pergolas & carports, CEMENT RENDERING
Lic 236838c bathrooms.
TOWN & COUNTRY AIR CONDITIONING Combined 30 years of experience in bath- www.bpconstructions.com.au Lic 195060c J PRESTIGE RENDERING
room and kitchen renovations. Our aim is to
9481 0667 restore, and recreate a timeless quality finish ALTERATIONS 0410 746 378
in your home. Please visit our website for 0418 484 216 9674 7527
Sales, Service & Installation of all domestic recent projects. Ground & 1st floor additions decks & pergolas. Rendering, repairs, blueboard etc Quality ser-
& commercial air conditioning equipment. www.jaycorprenovations.com.au Lic 306197c Plans drawn from concept to completion.I. S.
www.townandcountryair.com.au Giltinan Builder P/L. Lic 91637c vice g’teed, no job too big or small. F/Q
AU18964 Lic 125392c BEDDING
PROVEN AIR CONDITIONING builders Cleaning
BEDS ‘N’ SECONDS PAUL GILES
1300 776 247 SPINRYDE HOME RENOVATIONS ABC Professional Cleaning
9879 4226
All Air Conditioning Work. 9879 4855 0421 136 088
Lifetime Warranty On Workmanship Quality Australian Inner Spring mattresses,
❁ Repairs Singles fr $139, Doubles fr $279, Queens 7/53-55 Gladesville Rd Hunters Hill NSW 2110 Chinese couple/ Home, Office or Strata. Mov-
❁ Service/Maintenance fr $299. Fast local delivery. Huge range of Your local Extensions/Additions/Renovations/ ing, Spring, Regular. Carpet Steam.
❁ Installation mattresses, beds & manchester. Your local Patio Builder (free quotes) 0421 136 088
www.provenair.com.au Lic 310465C AU50152 bed shop! Paul GIles New & Seconds Mat- Fully Guaranteed to comply with the BCA
Alliance Climate Control tresses. 1A / 28 Buffalo Road, Gladesville (Building Code of Australia)! S & A CLEANING HUS & WIFE (owner)
10% Discount (max $500) to Seniors Card
8036 2372 BLINDS Holders! www.spinryde.com.au 0411 627 847 9630 8722
NSW Builders Licence 45000JP
Air Conditioning Installation, Service & Re- SUNSET WINDOW FURNISHINGS
pairs. Receive $400* Cash-Back trade in old
A/C Daikin & Fujitsu Specialist Dealer, Split & 8765 1733
Ducted.t. www.alliancecc.com.au Lic 271472C
Free measure & quote! Good quality. Holland
ANTENNA blinds, vertical drapes & venetian blinds at Home/professional/spring/
factory prices. Washing & repairing of venetian regular/moving/windows. 15 yrs exp.
MCA DIGITAL ANTENNA SPECIALIST blinds same day service.
CMT Building Services (NSW) Pty Ltd ALBERTO’s CLEANING & CARPET SHAMPOO
0431 444 111 BURRA BLINDS AND SHUTTERS 0416 246 431
Over 20 years experience in all aspects 0418 489 627 9832 7254
Local Tech, free quotes Fully Ins, Pens Disc, Cameron 0401 805 534
Gov app 5 yrs warranty. of renovations, refurbishments, and Home - Office - Strata. Call Alberto.
Plantation Shutters, Roller Blinds, Verticals alterations. Call Chris on 0416 246 431
ARCHITECTS and more. Free Quote. Call Cameron. for a consultation
Lic: 254214C Cleaning – High Pressure
PETER HALL ARCHITECTS P/L BOOKS -
COMIC or PICTURE GRAMERCY PROJECTS NORTH RYDE HIGH PRESSURE CLEAN
9878 5850
0410 743 215 Nathan 0410 427427 9888 5406 0414 765 181
P Hall Nom Arch. 3279 Experienced firm, ca- Driveways, BBQ’s, Pool surrounds, Sealer.
pable of handling all types of work, both resi- Wide range of comics, graphic novels and picture • Design & Construct Custom Built Homes. No job too small.
dential and commercial, alterations or new. books. New and VG condition. All ages . • Extensions, Alteration & Additions.
Gladesville Area. 9816 4082 or 0410 743 215. • Renovation Packages Clotheslines
ASBESTOS REMOVAL • Kitchen & Bathrooms
• Decks & Pergolas DOCTOR CLOTHESLINES 0407 585 691
ASBESTOS AWAY Tony 0405 317 807 • Home Warranty Insurance Available
• No obligation fee quotes
* All types of Asbestos removal www.gramercyprojects.com.au
* Garages & Sheds Demolition NSW Builders Licence 300222c
* Asbestos Pick Ups & Inspections
* Free Quotes * All areas Clotheslines installed from $395. Free quotes on
* Fully compliant with Safe Work NSW Reg. new or repairs.
* Fully Licensed & Insured CARPENTER/BUILDER Full range of folding lines
www.asbestosawaysydney.com.au Face- Call Richard 0407 585 691
book/Instagram: Asbestos Away Sydney
Lic.Class B 210719 M JD CARPENTRY 0414 418 248 COMPUTERS
Matthew
ballustrades For all carpentry, gyprocking, painting and GLADESVILLE COMPUTERS
maintenance works.
WARD STEEL & ALUMINIUM 0401 339 402
bricklayers ASH BUILDING & CARPENTRY PTY LTD
9645 6358 • Free service call
0415 123 658 • Home office support
Manufacture & install steel, aluminium, stainless Residential builders, extentions, renovations, • I.T. specialist
steel, glass ballustrades. Pool & garden fencing, BRICKLAYER/BLOCKLAYER kitchens, bathrooms and decks. • All work guaranteed
auto gate. Custom & design services, free quote, 0411 762 242 • www.g1computers.com.au
helpful services. wardsteel.com.au “Professional and reliable service at a
30+yrs experience. Professional. Small to medium competitive price” Lic 332083C
bathroom
renovations jobs. Insurance work. Replace rusted lintels. Con- Carpenter/Builder 0412 691 470
crete rend3ering. Free quotes.
SPINRYDE HOME RENOVATIONS Lic. R83479 concreting
9879 4855 General carpentry, decks, pergolas, small AAA ALL AREAS CONCRETE
QUALITY WORK GUAGRaAryN0TE4E3D1 163 114 renovations, gyprock walls, repairs, small
7/53-55 Gladesville Rd Hunters Hill NSW 2110 jobs ok. Quality work. 25 years experience. Charlie 0413 777 239
Complete bathroom renovation for $19,999* GSH Bricklaying FRONT FENCES Ted Ryan 0412691470. Lic no 1684c
including tiles and fittings to the value of * Ret walls * BBQ’s & *Besser Blocks. For Concrete Driveways Sydney, all types of concrete
$3,999* prompt reliable service call Gary. Lic No 180752c ACE TRADE BUILDING SERVICES work, Driveways and Pathways etc. Small jobs
10% Discount (max $500) to Seniors Card welcome. Over 32 Years Experience. Lic. 129960c
Holders! www.spinryde.com.au BRICK & BLOCK LAYSItNevGe 0409 124 751 Michael 0407 912 355
NSW Builders Licence 45000JP Extensions, Front fences, garden walls etc. G RIGHETTO & SON 0419 282 402
Plus heritage work. Call Steve. All carpentry, renovations, decks, property
*Quoted prices are based on a 5m2 floor area and do not maintenance & repairs. All general building Garden Sheds, Paths, Patios, Driveways etc.
include asbestos or wall removal* work. Fully insured.
Call Michael Lyall 0407 912 355 Lic No 188739C NOW IN SIX LANGUAGLicE11S427!C
Lic. 55906c
APS BATHROOM & KITCHEN RENOVATIONS RYDE BRICKLAYING & PAVING
0410 454 165
Thinking of Renovating ? 0426 970 190 To advertise
Call us for a free quote Phone: 9807 6666
Bathroom, Kitchen & Laundry 35 Years experience. Repairs, re-pointing,
Renovations Landscape Design, Stonework, Garden Main-
Over 20yrs Experience tenance. Quality workmanship.
Lic 207688c Call Joe Wood 0426 970 190. Lic 208862c
www.apsbathroomsandkitchens.com.au
www.weeklytimes.com.au
Handy PPhhoonnee Guide Wednesday 28 April, 2021 THE WEEKLY TIMES 15
The Weekly Times 9807 6666
concreting (continued) Electricians (continued) EXCAVATIONS GARDENING
TCP CONCRETE (NSW) PTY LTD EASTWOOD Bruce Kennard Pty Ltd FLECK RUBBISH REMOVALS & ABLOOM ACE GARDENING
MINI EXCAVATIONS
0404 770 791 9809 7001 0417 690 627 8819 4980 Sam or Chad 0410 774 647
Domestic & Commercial repairs. Installation, Glen 0418 268 040
Concrete Driveways, Pathways, Slabs- repairs, house, rewiring, security lighting, fans. Restore overgrown gardens, Land & yard
Prompt service. Over 26yrs experience. 22 Thorn Narrow Access Excavation. Excavators from clearing, Trimming, Weeding, Lawnmowing,
Plain & Coloured Domestic & Commercial St Ryde Lic 35887c 760mm wide up to 1200mm wide. Dumper Tip- Turfing, Tree lopping, Stump Removal,
pers 760mm wide. Bobcats 3 Tonne Trucks. All Landscape, Plants, Gurney wash,
over 25years experience Lic 52825c Areas. Best Rates. Call Glen Rubbish removal. Regular Maintenance,
Pens Discount. Fully Insured, 7 Days, Best
concretE Cutting GEOFF NASH ELECTRICAL SERVICES hourly rate. Free quotes. Call Sam or Chad
9807 1957 0419 200 011
FENCING AL’s COMPLETE GARDEN CARE
MASTER CHASING SERVICES All electrical installs & repairs, AH service,
Al 0414 753 258
0403 111 758 competitive rates.. Lic No 90476c PRIMO FENCING 0402 981 141
Qualified horticulturalist, Complete garden
Specialising in concrete cutting, core LOCAL RYDE DISTRICT ELECTRICIAN Specialise in all timber & colourbond fences. maintenance. Lawn mowing, hedging,
drilling, road sawing and wall sawing. Blake 0488 843 433 No job to small. 20 years experience, fertilising, weed control, Comm/Res/Strata
workmanship guaranteed. Call Al
DAMPNESS + Small family owned business Call Colin 0402 981 141
+ No call-out fee a & a absolute best price
+ Seniors discount
ANTI-DAMP + 100% satisfaction guaranteed 9439 8550 Jack 0411 351 161
+ Credit cards welcome LOCAL FENCING 9807 2367
1300 301 210 0412 229 955 Digging, weeding, land & yard clearing, tree lop-
Captain Cook Electrical Lic 288540c Quality timber, c/bond, gates, pickets, pool, ping, trimming, pruning, restore overgrown gar-
* Rising Dampness log walls. Free quotes den, turflaying. Pensioner discounts. Ring Jack
* Condensation & Dampness GET SPARKED ELECTRICAL &
* Sub-floor Ventilation COMPUTERS GECKO PLANTSCAPE
* Rising Damp Contact us for a free quote. Greg 0422 169 313 KOALA FENCING
www.antidamp.com.au Robbie 0412 131 362
Martin 0412 010 212
dentist ❁ How about a safety switch Irrigation solutions for your garden during
❁ New installations or renovations Horizontal & Privacy Fences. Pool fences & water restrictions. Horticultural advice, gar-
PUTNEY DENTAL SURGER9Y8 09 ❁ Data, electrical gates. Timber & colourbond, fence repairs. den maintenance and green walls. Qualified
7110 ❁ Domestic, commercial & industrial call Martin 0412 010 212 Horticulturist fully insured. Call Now Robbie
❁ Fast reliable service. 0412 131 362
• Over 25 years’ experience in Putney
• Renowned for gentleness and care ❁ Servicing All Area Lic 180641c ANDREW SPIES FENCING NORTH RYDE GARDENING
• Exceptional quality at affordable price
• Prompt appointments. 6 days 0410 534 692 0414 765 181 9888 5406
• Bupa Members Gap free regular dental Ryde District Electrician 20+yrs Exp
check-up and mouthguard Specialises in all types of fencing. View Your reliable gardener. Weed, dig, trim, clean,
• Book On-Line Ian 0412 988 012 website @ Andrew-Spies-Fencing.com tree trim/lopping, stump grind, mow, turf,
rubbish removal, maintenance, high pressure
www.putneydentalsurgery.com.au ✓ Same Day Service S mith Fencing 0400 598 403 clean. Call Alan.
✓ Switchboards, Smoke Alarms,
DOG GROOMER ✓ Lights, Power, Phones, Broadband (Points) Timber Boundary Fencing, Gates & Pickets. DOWN TO EARTH GARDENING SERVICES
✓ Pensioner Discounts Small jobs & Repairs Welcome
Groom To You 0400 126 794 ✓ Ryde Area - Hunters Hill & Gladesville psmithfencing@gmail .com Nick 0408 688 949
✓ Small Jobs Welcome
Clipping, bathing, blow dry, nails trimmed, www.secure-electrical.com.au Lic 92264C A XFIX fencing 0498 058 885 Qualified horticulturalist
ears cleaned. Specialising in garden maintenance,
All breeds under 25kg. At groomers home DENISTONE ELECTRICAL SERVICES Small job specialist 30yrs exp. Pine, Merbau, garden make over’s and organic
in West Ryde. c/bond, picket, alum, slat, gates, repairs, pool vegetable gardens. Fully insured. Call Nick.
Ph: Corinne Cucek | Groom To You | Andrew/Electrician 0417 909407 council requirements. Call Andre.
0400 126 794. Tina/Admin 0451 899622 Gardening & Tree Services
Power & lighting, All electrical work, Upgrade JEFF’S Fencing
DRAINER switchboard, Rewiring, Ceiling fans, Smoke 0412 594 911
Jeff 0455 987 989
SYDNEY DRAINAGE EXPERTS Lic 143252c alarm, Data & telephone. Lic 201164c Landscaping, Paving. Garden restoration gar-
Specialising in Treated Pine Timber Fencing. den design 15 years experience. Tree lopping
0414 837 679 Phil 9715 1804 Roger’s Electrical Service Best quality and price. Free Quotes. Call 25% pensioners discount . Free quotes fully
Jeff on 0455 987 989. insured 7days service Simon 0412 594 911
Clearing of blocked drains, sewers / storm water
Toilets, basins, baths, shower, laundry, kitchens 0422 628 109 | 9420 3370 FLORISTS GAS
Jetblasting,electric eel,cctv camera,root treat- • Domestic work
ment. All work guaranteed. 25 yrs exp. 24/7 • Affordable service BLOSSOM HOUSE FLORIST SYDNEY LOCAL GAS SPECIALIST
emergency. Same day service, reliable, profes- • Local and reliable Lic. 121864c
sional, efficient. 9874 1577 0414 837 679 Phil 9715 1804
Local Electrical Services
RYDE SEWERFIX Multi Award Winning Florist Leakfinding, fixes, repairs / renewals, new con-
James 02 8046 9983 Flowers & Gifts for All Occasions nections/servicing/commissioning of room/
9809 4230 0412 200 939 Member Interflora
Fast & Trusted – Master Electrician Shop 27, Eastwood Centre Shi Li Zhao central heaters, fake coal/logfires, commercial
Email: [email protected] kitchens, cooktops, ovens, stoves, hotwater
Sewer & Stormwater Specialist • Electrical Repairs heaters, all makes/models, Rinnai, Rheem, Py-
• Smoke Alarms
• Blockages Cleared • CCTV & Pipe Location • Switchboards upgrades rox, Bonair, Everdure, Electrolux Westinghouse,
• Repairs & Replacement • Free Quotes Chef, Miele, Smeg, Bosch, Vulcan, Dux, Jetmas-
Over 50 year experience Lic. L985 • PowerPoints FURNITURE REPAIRS
& CABINET MAKING
Electricians • Lighting installation ter, realflame, Genesis, bayonets fitted, LP/ BBQ
• SHNeonmioerOsSDaifsecWtoyuCnhtse ckIsN conversions, (carbon monoxide testing). Same
GRANT HEDLEY ELECTRICAL SER- SIXLic 271472C day Service, reliable, professional, efficient. All
VICE • TRADITIONAL FINE FURNITURE work Guaranteed. 25 yrs exp. C/Cards, Eft-
Grant 0403 868 457 / 9489 3543 LANGUAGES 0417 457 897 8765 8949 pos, 24/7 Emergencies. Lic 143252C
Local Electrician. No job to small. Over 30 Custom made furniture and specialist repairs &
yrs experience. Pensioner discount. restoration work. 30 years experience.
GLASs
garage doors
EASTWOOD ELECTRICAL SERVICES GLADESVILLE GLASS SERVICE
9817 3416 9816 3055
Gerard 0408 447 882 Glass repairs Com. & Dom. • Shower screens,
All electrical repairs – residential & commercial RYDE GARAGE DOORS 9809 1965
rewiring. Switchboard upgrades. All new wor mirrors • All glass requirements • Free measure
Installation, sales & service. B & D Dealer. Call and quote. 278 Victoria Rd, Gladesville.
Call Gerard. Lic 82184c www.weeklytimes.com.au for free quote.
16 THE WEEKLY TIMES Wednesday 28 April, 2021
Handy Phone Guide
The Weekly Times 9807 6666
GUTTERING & Ironing services LAWN MOWER REPAIRS PAINTERS & DECORATORS
METAL ROOFING 0411 155 774 (continued)
IRONING RYDE CITY MOWERS 9809 0329
GUTTER-SNIPE GUTTER CLEANERS Free pick up and delivery Twice daily. 6 days JAMES THE PAINTER 0405 765 631
p/w Family owned. 24hr turn around Repairs to most brands of lawnmowers,
9477 5943 brushcutters, chainsaws. Chain sharpening. Interior, exterior, all repairs, Small jobs
Guaranteed service. Factory trained & welcome, reliable, reasonable prices.
We clean roof gutters, no mess, local, qualified technicians. Local pick up & delivery Pensioner discount. Immediate start.
guaranteed, insured KITCHENS available (charges apply) Call James 0405 765 631 Lic 195805c
GUTTER, DOWNPIPE CLEANING SPECIALIST Granite & Marble Natural Stone THE MOWER SURGEON 0407 419 793 pest control
0414 837 679 Phil 9715 1804 9809 3623 3 mth warranty on mower, chainsaw & line Access Pest Control
trimmer repairs & service.
Local, efficient, reliable, neat & tidy, insured, Kitchen & vanity tops 100’s of colours. Est 02 8605 6637
on time. Gutter mesh & guard (install/replace) 60yrs Gladesville. Massage
Leakfinding, gutters, downpipes, valleys, www.ronbennettmarble.com.au All areas, All pests. Termite specialist ( pensioner
flashing, install & repairs whirlybird, venting, QUALIFIED STRESS RELIEVING discounts). Will beat any competitor quote
raintanks, roof & skylight leaks. Lic 143252c 0413 395 444 Lic # 5092837
25 yrs exp, Eftpos, C/Cards Accepted 0406 038 729
Full Kitchen Package $4999
ABC SEAMLESS 9748 3022 Relaxing full body massage. FORENSIC PEST CONTROL PC
Includes; Cabinetry, Oven, Cook Top, All Sydney areas. Ayurvedic Style. 1300 360 457
• Guttering, Downpipes & Metal Roofing Rangehood, Sink, Mixer tap, Tiles Home visit. Call 0406 038 729
• Leaf Protection, Roof Restoration & Cleaning 256-258 Victoria Road, Gladesville The Pest Detectives All termite & general
• Discounted prices & free quotes [email protected] pestcontrol, sub floor ventilation & bird control. PC
• Over 40 years in the industry www.aryankitchen.com.au
• Fully licenced and insured Lic 3433
COMPLETE CUSTOM KITCHENS
• Comprehensive warranties PAINTERS & DECORATORS PEST CONTROL 9449 2948
Glenn 0414 717 111 NOISES IN THE ROOF?
hairdresser PETER PAINTING Be rodent free this winter from
Highest quality custom kitchen renovations Complete as little as $180.00. We also do Pos-
want a great haircut? 0423 808 115 8819 2795 sum Removal! 40+ yrs Exp.
jEoxbp.eArliletnracde.eFs.reUenQbeuaottaebs.lePpernicse.Ds.isBcu. i0ld4e1r42701Y7e1a1rs1 25 yrs exp. Work guaranteed Pensioner Call SPS Pest & Handyman Services
9888 5257 Lic no 301036c
Discount. Free Quotes Lic 157468c BUGZOFF PEST CONTROL
Come & see Abbas Imperial Style Barber,
Midway Shops, 117 North Rd, Denistone East. KITCHEN REPAIRS RYDE PAINTING & DECORATING SERVICES 0423 203 356
HANDYMAN KITCHEN REPAIRS 0412 944 025 ✔Commercial ✔Domestic ✔All pests ✔Termites
Service Guarantee + Free AfterCare Services
S.S. CARPENTRY & HANDYMAN SERVICES Angelo 0408 677 614 Genuine local painter, Fully Insured. All types From $99. www.bugzoff.com.au
of painting, reliable, reasonable price.
Sam 0414 413 326 Hinges, Doors, Drawers, Shelves, Cabinets, Free Quotes -Pensioner Discount. Lic 150743c PLASTERING
Kick-boards etc.
Specialising in all Building, Carpentry & No job too small. Free quotes 7 days. MICHAEL THE PAINTER GYPROCK PLASTERING SERVICES
Gyprocking work. Free Quotes & Pens. Disc. [email protected] Lic no 139738C
Ph. Sam Michael 0412 444 838 Demitri 0404 770 412
All types of plastering * Reasonable rates.
Nicholas carpentry & Handyman • Professional and reliable
services • All types of painting • All areas Call Demitri Lic 288665c
• Reasonable rates • Best quality
Steven 0419 606 288 • Cheapest quotes • Pensioner Disc
• All Trades • Bathroom & Kitchen Renovations Call Michael. Lic 320177c PLUMBERS
• Pergola’s, decks, roofing, gyprock, & paint-
ing • All minor & major repair work • Quote this LANDSCAPING W Z FINE PAINTING SERVICE PTY LTD
advert and get a 10% discount !!! • Call Steven
www.nicholascarpentry.com.au Lic no 108119c David 0450 726 188 BLOCKED DRAINS & SEWER SPECIALIST
* Reliable and professional 9638 1398 0419 409 130
Retired Builder TREEMENDOUS LANDSCAPES P/L * Guaranteed quality and price.
* All types of painting * Fully Lic & Ins. All general plumbing including gas. (24hr
Charlie 0411 703 057 9874 2605 Paul 0407 207 672 * Free onsite quote. Emergency Service) No job too sml. Free
Lic No 310324c quotes. STEMBRIDGE PLUMBING. Lic. 9880
Small Jobs, Repairs, Competitive Rates. Landscape design & construction. Member of AILDM
Call Charlie 0411 703 057 Lic 77216c Aspect Painting & Decorating Mastercard & Visa welcome.
0401 951 257 COTTAGE & DOMESTIC MAINTENANCE
0414 808 809 9808 3020
MORNING BLUSH LANDSCAPES All types of painting, reliable, g’teed service, free Phillip Draper West Ryde Lic 3906
quotes, pensioners discount fully insureds
0419 227 477 Lic149577c
Qualified Craftsman & Handyman Paving, Decking, Pergolas, Planting/Turfing EDGE PAINTING Sam 0433 742 162 POOLE & CO PLUMBING 0412 200 939
Drainage, Retaining Walls, Brick & Block 9809 4230
Ring Tristan Tall 0413 878 479 Concreting, Pathways, Driveways, Fencing.
Indoor and outdoor jobs. Most trades. * Master Painters Association Member.
Email: [email protected]
ABN: 59832391719 * Dulux accredited *Specialised in repairing & Your Local Plumber for 50 Years.
* Blocked drains cleared
repainting. Interior/exterior * Taps & toilets
Ph: 0419 227 477 Lic 282208c
* Pensioner Discount *Quality Guaranteed. * Hot Water
www.edgepainting.net Lic 267578c/MPA280514 * Gasfitting
www.pooletheplumber.com.au
hot water services Lic 985
RYDE HOT WATER SERVICE Laundry/Bathroom Honest painting 0452 639 991 RYDE SEWERFIX
9809 4230 0412 200 939 Nicholas Carpentry & Over 20 years experience. Specializing in 9809 4230 0412 200 939
Handyman Services repairing cracks, peeling, mills removal. Sewer & Stormwater Speciali st
Installations, repairs & sales. Electric and gas Interior&exterior, free quote. Fully insured. • Blockages Cleared • CCTV & Pipe Location
hot water heaters. Steven 0419 606288 Seven years warranty. Eason 0452639991. • Repairs & Replacement • Free Quotes
Lic No L985 Lic 312751 Over 50 year experience Lic. L985
Full premium renovation service - waterproof,
A HOT WATER SPECIALIST tile, remodel or tailor designs. All budgets. SYDNEY PAINT CO PAUL RUFF & SON PLUMBING
Quote this advert and get 10% discount!! 0414 457 417
0414 837 679 Phil 9715 1804 www.nicholascarpentry.com.au -All types of painting - Mould removal & re- 0418 961 406
Servicing / repairs / installs, Gas, Electric, NSW Building Lic No 108119c Est. Locally 1981
pairs - Fully licensed & insured - Free quotes Lic 3792
LAWN MOWING
Solar (all makes/models) Rinnai, Rheem, – Call Les Lic: 362645
JAYS MAINTENANCEJaPsLoUnS0424 619 816
Bosch,Pyrox,Aquamax,Solahart,Thermann, PERFECTION PAINTERS To advertise
Junkers, Bayard, Vulcan, Hocking, Everhot, SERVING THE LOCAL AREA FOR OVER 10 YEARS. Lawn, Phone:
Dux, Edwards, Beasley, Roomheaters Same gutters cleared. Fuly Insured. Cal Jason Joseph 0451 123 231
day service, reliable, professional, efficient. 9807 6666
EAfltlpwoso,rk24g/u7aErmaenrtgeeendc.ie2s5. Yrs exp. C/Cards, * Reliable and professional * Pressure Cleaning
* Roof Painting. Interior and Exterior.
Lic 143252c Free & Quote Insured
www.paintedtoperfectionpainters.com.au
Lic. 269706C
Wednesday 28 April, 2021 THE WEEKLY TIMES 17
Handy Phone Guide
The Weekly Times 9807 6666
PLUMBERS (continued) PLUMBERS (continued) roof repairs Sewing Machine
YOUR FAST LOCAL PLUMBER Ryde City Hot Water & Plumbing BOB THE ROOFER 0418 677 188 Wanted To Buy 0401 802 752
0414 837 679 Phil 9715 1804
Guaranteed Same Day Service. Prompt, On time, Alfred 0418 976 679 All roof repairs, renewals, restoration. Old Singer or Bernina Machines.
Leak detection specialist. Over 35yrs exp. Any age/condition. Additional $20 if deliv-
Efficient, Reliable, Honest. Blocked drains cleared. LOCAL PLUMBER - 25+ Years Experience. • ered to Drummoyne.
Lic 123259C Call Malcolm on 0401 802 752
Sewer-stormwater, burst pipes, leaking showers Hot Water Repairs & Replacements
stove repairs
Taps/toilets, waterproofing, water filters, hot water • Blocked Drains & Toilets • All General rubbish removals
RYDE REPAIR CENTRE
heater maintenance accredited repairer/ installer. Plumbing Services • Restricted Electrical
0409 833 832
Licence. Call our office on 1300 976 679 or
Alfred on 0418 976 679 Licence No. 111700C Repairs all stoves & ovens, 7 days / fast
service 0409 833 832 9807 9828
Servicing (all makes / models), gas leaks, installs
surveyor
Repairs, connections, appliance repairs,servicing REFRIGERATOR Garry’s Rubbish RemovaL
REPAIRS ATS LAND SURVEYORS
Room-Central heating, fake log/coal fires, stoves Cheapest Price’s
RYDE REPAIR CENTRE 0409 833 832 Call 9808 6854
BackflowPrevention, TMV’s, downpipes/gutters, Garry 0416 295 790
Repairs all fridges/seal washers, Suite 3, 75 Rydedale Rd, West Ryde, ats1@
cappings Flashings), lead, Roof repairs (metal/ dryers, dishwashers. 7 days. 0409 atssurveyors.com.au
833 832 9807 9828
asbestos/Tile / slate) Skylights, leaks / fixes. No * All types of waste (large or small) TILES/TILING
job too big or small. All work guaranteed. 25 Yrs exp. * Household * Deceased estates ACCLAIM TILING SERVICES
* Senior Discount * Free quotes
C/Cards, Eftpos, 24/7 emergencies. Lic. 143252c Gabriel 0404 032 426
GLADESVILLE PLUMBING SERVICES * 30 years exp * 7 days Specilaising in bathroom renos & all types
9817 4777 0413 402 599 We’ll SAVE you. of wall & floor tiling. Call Gabriel Lic 251461c
For all your plumbing needs. Free Quotes. REMOVALISTS FLECK RUBBISH REMOVAL TONY TILING
24hr/7days. Emerg. serv.
Visa/Master/Eftpos. Lic 168655C AB HOME REMOVAL Glen0418 268 040 0414 616 366
CMF PLUMBING 0431 995 369 9745 5772 • All Areas • 24/7 • Free Quotes All Ceramic Tiles (wall & floor) etc.
0411 232 629 9808 4220 • Excavator for hire All waterproofing. All areas. Lic No R78511
• Plumbing, draining, roofing, gas fitting Excellent Service. No job too big or small. Local • Domestic/Commercial
and interstate. $90 per hour. • Good Rates tree lopping
• All types of waste • Senior Disc. Call Glen.
• Maintenance specialist • Jet blaster & CCTV VIC’S TREE CUTTING
• No job too small Lic 117469c
roofing 0404 162 752 9858 2874
FRANK DRAPER SEWER REPAIRS & safety rails
REPLACEMENTS 0438 065 852 J & M SCHALK. Tree pruning and removal, stump grinding. Fully
Free Quotes, High Pressure Water Jetter Service. - 9878 4483 0408 642 056 Safety Rails by Rails 2U ins. Free Quotes. Qual Aborist. Family business.
Ryde Lic 181690c
Les 0439 967 102 S T J Group Tree Services
RYDE GAS COMPANY Roof repairs. Metal, tile & leaking roof replac-
ing valleys, F/Q, Lic R91302. Make your home safer by installing internal and 0401 181 780
9809 4230 0412 200 939 external rails by experienced installer.
Local Gas Specialists LOCAL SYDNEY ROOF SPECIALIST Can supply and install large range of rail sizes, Fully Insured • Fully Qualified • Tree
· Portable Gas Room Heaters Serviced no long waiting lists. No job too small. Senior services - removal, clearing, lopping,
· Carbon Monoxide Testing 0414 837 679 Phil 9715 1804 Discounts. Obligation Free Quote. Ph Les stump grinding, hedging, pruning Free
· Hot Water Heaters Quotes • call Steve
· Leak location & repair Leak finding/Repairs (tiles, metal, slate) shingals/
· New installations, replacement & additions Tree Lopping Services
· Bayonets & BBQ conversions. Lic. L985 skylights, asbestos, copper, Waterproofing,
Lead, Flashings, cappings, ridgepointing, rebed- 0412 594 911
ding, Chimney’s,Stormwater Drains Cleared, SKIP BINS
TAP RESCUE 1300 827 000 relayed, Diverted, fixed. (Gutter’s/Down- The arborist tree lopping. prunning. stump
pipes) renewal, cleaning, whirlybirds. Same PAYLESS MINI SKIPS grinding storm work. Emergency services
We repair, supply, install direct to you TAPS, day service – reliable, professional, efficient. qualified arborist landscaping . Best and
TOILETS, Hot Water Systems, Water Filters All work guaranteed. 25 Yrs exp. C/Cards, 0402 844 744 George 0415 224 460 cheapest service. 15 years experience.
and more. NO CALL OUT FEE! 0414 333 461 Eftpos, 24/7 Emergencies. Lic 143252c Free quotes fully insured 7days service
Lic 40572c 2-3-4m. Fast reliable service, specialising Simon 0412 594 911
in small drives. Call George
LOCAL PLUMBER sam’s roofing P/L ATTACK TREE SERVICES
Solicitors
0488 801 042 Sam 0416 178 058 & CONVEYANCING 0419 227 477
• Taps, Hot water, Blocked Drains, Blocked pipes All metal roofing & guttering, no job too small OSBORNE HOWELL 9807 3222 ✓ Qualified Arborist ✓ Tree & Hedge Pruning
• 24/7 EMERGENCY Plumbers 33yrs exp. Ph Sam for quote. Lic 215152c ✓ Tree Removal ✓ Palm Tree Tidying
• On-time & Reliable Over 50 years in RYDE. ✓ Stump Grinding ✓ Rubbish Removal
• Plumbers you can trust Top ryde top roofing Shop 6, 43-49 Blaxland Road, Ryde
• All works guaranteed 0410 322 681 9871 0313 (Entry via Argyle Ave) Wills, Estates, Call Bassam 0419 227 477
• $0 CALL out Probate, Conveyancing, Family Law, Com-
• You approve the price before we start! mercial Leases, Sale of Business. To advertise
$50 OFF when you mention this AD Phone:
Need a Local Plumber Fast? • High pressure cleaning 9807 6666
• All roof repairs & painting F/Q.
9191 7353 • Dulux Colour. • Pens Disc Lic 136874c
Do you have no hot water? roof painting LEES & GIVNEY LAWYERS 9816 1122
Is your drain blocked?
ADroeyyoouurwtaanptsaannedxttorailegtasslepaokiinntg?? AARON’S ROOFING Established 1983 -
CFoarllfJaesrtefmrieynodnly9s1e9rv1ic7e35w3ith a smile Accredited Specialist: Family Law and
100% Satisfaction Guaranteed 0410 322 681 9871 0313 Wills, Estate Law; Conveyancing, Enduring
Power of Attorney. Home visits available.
PURE PLUMBING PROFESSIONALS High pressure cleaning. All roof repairs & 243 Victoria Road, Gladesville
The Punctual Plumbers - 9191 7353 colour 20% off. F/Q Pens Disc.
Security Doors
• Local Business Award Winning Plumbers PETER PAINTING 8819 2795
• $0 Call Out Fee* • Fast Emergency Service MICKS STEELWORKS 0412 078 671
• Hot Water Repairs • Blocked Drains Cleared 0423 808 115
• Taps and Toilets • Noisy Pipes • Gas Fitting Security doors/windows/grills, Fences,
• Seniors Discounts Gates, Customisation, Galvanised –
www.pureplumbingpros.com.au Powder coating. Call for free quote Lic T8505631
To advertise High pressure clean & painting. Free quotes.
Phone: 20% off quoted price. Work Guaranteed.
Lic 157468c
9807 6666
18 THE WEEKLY TIMES Wednesday 28 April, 2021
Handy Phone Guide
The Weekly Times 9807 6666
TV REPAIRS VENETIAN BLINDS weddings WINDOW CLEANING
EXCELLENCE ELECTRONIC ENTERPRISE
AMORS VENETIAN BLIND LAUNDRY RAY WOOD PHOTOGRAPHY (continued)
0412 566 100 9807 2772 8765 1733
0414 843 759 SPIC AND SPAN WINDOW CLEANING
• Install, DVD, Setup box Foxtel/Optus Gentle pressure clean, wax finish, re-cond. of all
• Get your DIGITAL Ready makes, free wash with all full reps. Same day serv. WINDOW CLEANING Greg 0411 055 476
• All TV, DVD, Hi-Fi, Microwave, Vacuum, An- Meas & quote on venet, vertical & Holland. Gladesville.
tenna • Owner operated for 20 years NO STREAKS WINDOW CLEANING, Also soft house wash. Greg: H/ pressure clean-
WASHING ing. Sydney Water exempt.
WEST RYDE TV & DIGITAL BOX SET UP 9808 6773 Eugene0415 258 454
MACHINE REPAIRS OUTLOOK GLASS WINDOW CLEANING
9804 6954 Prompt, friendly, reliable service, F/Q, fully ins.
RYDE REPAIR CENTRE 0409 833 832 Eugene 9874 2815 David 0412 667 525
DVD, home theatre, plasma TV Antenna,
install & repairs 35 yrs exp. Pen Disc. Repairs all washers, dryers, fridges/seal, dish- Pressure clean/softwash. Fully Qualified. Fully
washers. 7 days. 0409 833 832 9807 9828 Insured 20 yrs exp. Call David
EKLY TIMES, Wednesday January 30, 2013
Trades & ServiTcraedess &9Se8rvi0ce7s 6
OORS, WINDOWS IRONING ROOFING GgLAlaSsSsSsEeRrvViIcCeEsS
HAT Stand classic stylish Cat of the Week
for Sale and good quality 2 Wanted
CABINET Six piece glass choices $20 and $30 Ph PHOTOS Old B/W, Rural,
line near new, selling 0425 370 022 Social Scenes, Street
very cheap 10c Ph 9888 HEATER Tower Delonghi Shots, Travel up to 1960’s
9611 classic better type vgc Ph 0407 926 172
BIRD Cages with mobile great value $55 Ph 0425
stands suit medium size 370 022
b92irP6ds1A7$250INeachTPhIN040G7 VACUUM super Cleaner Wanted To Buy
bagless power
hardly used $40 Ph 0425
FOOD Warmer on 370 022 OLD Tools, Old Lego’s,
casters Salton brand ROOM Dividers office or Guitar, DVD CD, Old
3 heat sections ideal home very good quality Games winter cloth
for BBQ’s or parties look fantastic $25 and jewellery Bric a Brac Call
74x64x38cms $30 Ph $40 Ph 0425 370 022 Now 0431 296 741
0407 926 172 RECORDS From the 60’s
to the 90’s. Please call
DVD Player TEAC $30LPich enMcOeBNILIoTY: 2W0a6lk7er1w3itch Darren 0412 423 538
0415 953 099 chair strong and vgc only
Shop local promotes campaign benefitsLOUIS Vuitton Paris $45 Ph 0425 370 022
al ladYieROsYpUDarTEtnHNOeWRrINCSi.InXSLsrM.oUthpLeer anodB.gsorn ctatsinesed to fitnd arhomae tionmugnMtIRh’enieW,isgRtNneepmof$HPcPClaDbRL00cMch$x$$o01aLlloogyeDGaeoarraEuruAnoasa1e214O894nonlaaEEhadvua5daEeomtElsnvaco105,91MoltnllypethEiUAcynin40PsshNneelht550rkleenfeifTktoog$PceP0PFtdtiNheansdsPees’wi,cdnekl1dEminSnerS099wehihtr8DBGrhvta,R0n0ateiic55Rdil2Fssccr1cDdilas40Vi0sr$EaCava033hrifFtcri$ieceato2cIteRe42ttsDee1ltyms4aPeoiaiy$2somlof00ldGis51erreE0saruln1io$1hvifeG95feepPs99eye$5socr0olHsi$pdu5sPe10r3w0teor099aEoar5lkrdBs,e1aab0dm79trhioc4itn9ft$lidvbgfapn0tnyhlate0Phai05BtRi.1mxoaea51e$oaoforctu0eebei0mr,gna35caocairicea3m02ggnh0ercyan4rl$Alnr4tkrrff,9p0i5oylyl02nDgd1e$l0lls1ca1Sy65e,,inT92m5ef4lwc901ssseoc3a$rw$o9ct0ke29i3oomeOomStts5da910a-siTwhh-fnfnvairPPtcslstaptung50a9vnzuaaWrtatteeoHiie’Rohpdohh3n10h91eceersllllup.rronlllllldAWeevFapetPpoodpeyeepeeeFpnifanhWwJR$uf$P$si-0l24to0iTcQ2wrsdbroninrrosinoAlops421o3411efOsoenLeACiuzOilsntoppeptId snewr.015n303leChNmgeAitcIDdbtye,tgoemooL.er00658PurnoraeNsKtEceDb.1tS,otihrno1stibaarnwr41lnETBlncinsa.orRo.Lcs abot0uR5wodleols19eBoStTbEd.saaitpvteERttTArenatd$mte61scgtrpSDrch.rlhioalRryHoen$f1yoCyllcaeisaIhior.akoreR73ntstdi23t,crnsenievKO0fn$dtrowniR47rdOlhspla00aitfdarldysdaLig4ng1spaSii!epnT99ioO0ntoeglOteae!i3gpe5esssbaeaazloonornraMtd8e0nc&tdeDnelndlnretta$ertPatleet/maedeedlhawor4hsc4Ow.bShaolwatRl1e$p.temsiol10milszf,anuvleners6r6r03cl6reyeooo4sPiuee,1stoogoCeo0ls92dffopAuB8cnri3Si,rsnlriaei8tleruaz2laoegrootrpcovstiffsEf7ai.ePPlnoe1hckieiasrios’hvmmw3tstoil9lDtlrdd.efs6hnheecetssslsseyiRrtt-,.3Yien0sRfrcsaat0sdspeeeoe**S****CmBAwpwCB3AeSoc0b9pEmLPaotGIFRHH848SutsaovlTluiOoahrceshraomirsoum862ndAwsdseooonli1o,aeiAmeaXseltasnt974nTttWeglMlmneotneeircmfsreneiacic0eahbGenr(dniit30aeTNenPobdtQcttse.ls0agsCwuor08iri(/ng.Rlado.dhtmaeaias4udreOLa80L,vR3ubn’n2PGesie2o–goll4niTkfomlmyoe1ns,fafht1tev0ashEirIcere0tcdaaebsWUamco1.xDsm0eny&at,rcswegdorSp8is0tiobcrngwsudaovirPmelm0teerliAhluneituapent,uhyrsohorepoace4gIicoopeaonttGrade6hwaptsmvtTlynywbp1oDBaen65a,moteCtwcstlirtbpaladuaAsu.rEespesioiiO7smn9ctdnfv,tdooAetaeeyotk8ocIegRSritnerNom3ahalPt6anstenohndtrulssrhS&vdo9nhisstnernnu,..tna,onordynoleoeAp)il)cetufiurwytmtlaobnhlubnJSJpctsrJfPocssAOigFTooheerheooooraesrelfI“““TBrttreeb.feoshrefromsixBWByLctmsnneeiuisJhpertncaYYscTvntehdaiiiooreyaeepetnnsugeeochbItniohdooentc,ntottceoeetethsoatiltourptih,WephiooiruOuuathnaoemnsnrtcfaubfGaeiswaetprnlnorcroeWyfeBfettadv,nasn.ngeoyerwgieelyhunsoarr’hhnaalsiordsapgsmolldadertpoaroisdiddysaotrOpjetiar,.NeuouirteurhaclnnelcoCCapntetioalGntvafoLssknvlsneaenssanrfdheundiidtsAeaeleeni.trdvslvnrall0Wneo,yoyeaceVtniuusobnnddscalil4imsecvgcssnlawioiodrsosaeelsuemc0orbbiaaottoiuohntrsienn.neenosrt9neniictnaBloeaorgndsnoadvudvergpieytmreilraa7tmrteipdsJdoginennheLllissseesg4leraJnotolecdtoedescha1rolis’ptelyanomas,roasRrdshtone4geuiietavchhdaWneotftn1aupehatlyi..aabyf4tesgotatesoeradhoaie.eirrtorcdvwgenlfedterdanenhralidaavepgyaelevluLni9le,owehinykrr”cennped8ervvotekkegsoasoa1eeub’eehhhtgswdCu7lvaraydikooeutrseyloiCh4t,lWmmlrenthoslwsKaae8ihdamotiaceef2nnmn9teeetoutaial,a,idddgos2eyl””--rrt,ll0rEe1nNtcicSpmcACSssacsetnebncaaeeoc3nhhaahLnnyonnannuaeiierru““HCanitlgeoeeetWYviloljscddcidymllsljadoygoeoTletci.ewotpeeCiaSheebnyhruolhmhsisiouclnosenntaoyeobnpmeaMisfutBdcuomlmcmosscuconohpLsghMaseRnsaetwsueuaiRtureasooentlparicilabterlpayloqtrilorydpiswEnaielylshadSeeddsspmlsuseowrcpniaxnoctiehehogoohteYtueimhereiioodsoeeonhpngePnolurwnodalCractemxxdgprnp.phummrbsnovurrllppsoT.pybcipPooeraesvmD”hiqcuattcoLeesuoWsaelliccryiuloeuppsscnev.eorrnuooinurralaitrRiipdoeeeeTnssskele-----r-----rlllEnsetpsM☐yTlcWeogapoWaTecRdlCuecWaaTMicrkodelsTSwiauacoalOanngowtlcliacemebtrigoibssaslhalmeuoVdamnEarrsvuksxaJoie.etnBnopefTrcEieehfifttauWe!yirsrnosrntr.satTi”iiVavnnReonmaeroggsdfrnAtsie-PknSthiudjf8Aptaieoehrn1anc-reLw2iesjmagiaplestlnlaoohtia.httsoomineFoPpnpdonHreielcP,ro0Ostnic4muztTacaz3’rOoseueol3drrrcneiajaat5enwami1Ltncirot2i--tshn- eGyGOULD League of
SOLICITORS DRIROENCALTDOSR. YouritMCa$rsl2hsIi0XoeFMefPonehAnsoeS0etTs4umEs2psR5eaddl3llm7meKe0iuxep0amcn2hwae2sos$nto7eed5rdpinattMromahagnerssnpfoiiMoteoielrdatsnnc..qPuhSea0ari4nep2dE2Coa9sC3trw7eotaon0toht6rd(ree7r/,Voelryy nRe:a0so4na1b0le) 543 643
local, the majority WINSTON READFORD
of the money stays
in your community NOTARY PUBLIC Ⅰ SOLICITOR Ⅰ CONVEYANCING
and our local small
CIELwBSUEoDoBdSIDEveTrayb::leESbOeEAareugCtiGofunRl LEETToSATaRdRvYeYr(tDiPsehE (NEAR GLADSTONE AVE) CZINNER & CO.businesses are also
9809 1022) big employers of 165 Coxs Road
design $35 only with Phone: 70 Teams loinca2l 0r1es2idienntcsluidn ing teamsS!olicitors &
13(cnrwChaouvmel Setrenet’) s
Under 6’s to All Age, Over 3N5O’RsT,HORvYDerE 45’s &Conveyancers
special lamp $20 Ph
THE WEEKLY TIMES0425 370 022
9807 6666 www.weeklytimes.com.au Super League.F 9888 3865 W
We value participation, fairT p98l8a7y2a88n8d 15/1 Jordan Street
fun. Gladesville
OBITUARIES 9816 2133vens registration is now open
w.gladesvilleravens.coAmU.aTuO DIRE9C80T7 O66R66Ymale Ua6ndtofeOmvaelre4p5l’asy. ers fromMhucfidomeiotrgohsrgahktogicEBDoCSJACcC-BM2rittoo1fEptnAuAAhralyhrrlim.hPLrrserRrMiNmaiaigMOmsnlIeetsaimNlNfnPt,tsedNf1aiai,eSEeasEOBEeSr1fgilnHenyMeSdpcp.NKtoEticdu.pIpeLewLBinannSrCipC-ifLnaAnustgaaohdgoetgMPrleprwefeRuiral.ama&isooedaxrantoeAlslcoaryw1aCvsHghgtmofiena0eIee,obfirvydliNf.drArdlvin-3eoneelmyoeVapacor0rPnl7eareriornala9tdwridlmlUfil-rhmatllMsd'aFoymrsBais.e.P1yesrni2eaciMerp6adadaoluhaAHr.3itsaidatsdanmapnsynhorc.i,ewiMerealimiyoAlddlahFa,rUnaep1yo(sNCAar8gMnrnseOAipa9aswlol.ematpnt3leas,Alocirrsvn0earyyitf),l’paUqesSyrrunTM&4fAy-oCSTaufoa1iew1fYpEoOaan4tOEap1hgrrPLR0adMCIpirl4oed5liyLsaREnpHeor5r,t.sE9AgLit’l9hsaaEnsl.srUfCyLpbMnteogRm-emrLoddr.iLoaadlma1loIPKig1rn.tnoAeGjelaer17aolhkafslve.w.Fear.niosorisFHixlnaeeadfniFTgogae1yrdfo“rLaFnnh0’mhMurEats0datbmhgAAdndewtieeeeLhpeesrmogrtralirr.yi.eyel”iyUsuCylAyesutoF-nWaogaeAetfosrd1P1evretRpa.fm7nenaadrz5yi.eGa.sia-elld8imsnlr'Aoren32eeLstrPg.b0deayrdLeR.an‘teaAieiodeswALasoanwlvsaergiAee9csalotxsFddah7.elynfiif’urarlslpssgittpneeadopgecBASNNNCTCirpevHEononoOUtRrrrrRiEdeiRttvAnmTCCshhVTGdooOKIRRigHiC3OxxoyypEs’’EssddOSR,wnsSeeFe&&Y&DE&i4tDtiBBtROFCtoCEiaaUhaVtddLnLRBEiaaInUoCURLjjaeooTAdzznEITINCKRRNCS.NEooH5HaaC&ddSssSCLE,,ELRUU99RV88TVS88ICC88IHCIE55OE11S99SN88ClRWW9Su3TeMEI2bMsSNotVATRicspSGeRytaCohdHYharediDoaS9doREhvRSr8oaESnoteeuaMP0tswwedruFAAWcn,7taSIbrwNidRkRHRnsd6aSaFRaeawdaE6nEyoeoryPn6kE.pesAgruw36Io2lltRPUielrrTSce9ednsa8tadksn:0tRForws8tsFrdkre3eAy0eeaikeb3(nrdb3IotArbncNerui6rlusdoroa’uIoiaesrnwdNtvrylaeeayeGDn9dirmd9fdasSoiaeBa.mEnao7mErtASs’PPHRaerU–nsthheeSdLl–.seoaoa.ldrnnF1aee?eeL2IOr3R::2upnfet993fSpic28mtaTgVe61rmi47c1iYiat5a•34solO4n86lrtlIis79Ea•Umrco78liRaz•RCtmeaApdsPPShwP2“tbWelFho,leh(K)Chtei2iew(clocphteeGogceanneot/pororrogpodhwO.coLrr1romvh.oanr(6eHWnaA6aF.lnr“RSw0ln0nobvc,eceNe,noe&WDoYwLiete34tear2aee4,rlAwygNWdri3sDEtThlycayoei)cC:W3oSaolM-:eeeaoaalSfeElasOaA-hl4efb&9soYY9lnn@E4allnlenL9nV&nm9lA,E@lareN7vTnNpD9mCdrcRe8sIlpoerrahg8jcbeLaASfoOs4ScgLiNsWeWhBorayen,eyii0ThLglWToyw3eRlinaoe0liaClsrElalA:glielnYEalaeb:nplet2xOe7asYrRtagrY7ox1c2awlgFh1dYgmaaNl2avwwalAiu1ataB3nitvPV2Pln1We3Osv1i.lnain.23geUeE3.c0aStcdcU1ei&c2dY&ithds2nBno0oml3nR21ttyAoerLuBmeagRlmu0N2ImaoeC2srsRnLeCo.Cta)sa..2t,)IdEaaa2edduRCduu”r,Ssl.ubM
We also aim to provide develoEpAmSYePnAtRoKpINpGortunities 20
for all our players.
[email protected]
Wednesday 28 April, 2021 THE WEEKLY TIMES 19
Hunters Hill humbles Epping in Rugby classic
Hunters Hill Rugby Club is going from strength to strength, humbling a hard hitting Epping side 40-12 on
Saturday says club spokesman Luke McCormack.
☐ “Hunters Hill Centre Josh Camroux bursts through the midfield on “After a powerful showing in of big hits. 40 to 12 win.” the game saw a breakdown of
Saturday” Photo by Pete Kenny Photography of Framing Life” Round One where we swept “The Hunters Hill team were All Hunters Hill teams now sit the Hunters Hill game structure
to seven victories in seven and Epping were able to exploit
grades, Hunters Hill Rugby put led well by eventual Player of at the top of their respective these lapses in concentration.
on another strong performance the Match Steve Morton. ladders and have a tough away
when travelling away to Epping assignment next week against “Coach Graham Stokes gave
on Saturday. “Hunters Hill’s well oiled University of NSW at Dacey- some stern words at half time,
backline really laid on some ville this Saturday. and the team returned to the
“First Grade was an extreme- dazzling tries led around by the basics, and drove a strong fin-
ly physical encounter with a wily Jake Henwood. The matches will start at Da- ish in the second half, posting a
plucky Epping providing plenty vid Phillips Field at 10.45am. 43 to14 victory.”
“After some initial resistance
the side drove to a strong win “In second grade periods of
Netball community celebrates start of 2021 season
Federal Member for Bennelong John Alexander had a playful dig at his state political colleague, State Mem-
ber for Ryde Victor Dominello, after shooting the first goal of the 2021 ERNA (Eastwood Ryde Netball Asso-
ciation) season in his first attempt.
”Wonderful to again shoot the first goal at at the season opener ”were there long
the 2021 Eastwood Ryde Netball Associa- enough to see the absolute chaos getting
tion netball season opening ceremony last out of (not only) the netball car park but -
Saturday morning!” Mr Alexander said. even worse - the soccer carpark!!! Argh!!!
”Victor Dominello MP had the first at- ”Seriously, parking needs to be looked at
tempt, but alas it failed to find the ring - I and maybe traffic controllers.
can report I only needed the one oppor-
tunity to claim the bragging rights for the ”Between soccer, netball and hockey
first goal.” there would be thousands that commute
in this area.”
He said ERNA was a wonderful commu-
nity organisation and a key driver of sports ERNA has 24 affiliated clubs and is home
participation which had many benefits in to the ERNA Hawks Premier League teams
physical/mental/social health and wellbe- and has dedicated pathways for players
ing. aspiring to compete at representative level.
”I highly recommend preventative health ☐ Pictured, left, Federal Member
sports participation, and not just for the for Bennelong, John Alexander,
kids, the big kids as well!” shoots the first goal of the ERNA
2021 season at his first attempt as
But with the soccer season also under- friendly challenger, State Member
way and matches being played nearby, for Ryde Victor Dominello looks
it was hard to miss the frustrating traffic on. Above, local players and of-
chaos with car parking facilities in peak ficials are joined by the local MPs
demand. and other local leaders including
Ryde Council’s unofficial ‘Minister
Posting on ERNA’s Facebook Page, Jes- for Sport’ Clr Roy Maggio and Ryde
sica Mills Cirene said she hoped both MPs Sports Foundation’s Paul Moujalli.
TWT On-the-Spot PHOTOS
Hunters Hill Women 20 M Tennant R Stephens J Bowling Round-up Galati d B Williams B Williams Thomas J Clough d G Mitch-
Hope L Macdonald 16 Rk 3 C J Klueckmann 35/11 A Crock- ell P McPhie 32/25 D Pocock
Tue Apr 20 Club Pairs C/ships Bamback M Burkett C Benson 4 v Dundas Sports D Byron D 70 (10) d Warringah 39 (0) Gde C Banks d Denistone 20/13 J Mazzaferro 21/15 J Uren P art G Hatch I Christopherson T Locascio d Z Bosnjakovic J
J Lloyd G Blunt d M Nemeth V 21 J Bryant J Bax J Jones 13 Singleton P Harbrow J Bou- 7 Lane Cove 68 (10) d Manly Denistone d M Johnaston M Murphy d T King A Beloe 34/5 d C Madafiglio B Morton E Hae 25/22 Sun Apr 25 Anzac
Elias, J Doyle L Cook d K Sag- Rk 5 A Barton P Ying R Inchley los won 19/18 D Oppedisano 49 (10) Cookatoos Balmain 72 Caldwell K Judd 24/15 C Norgate N Holman N Elder Coleman 27/25 D Moody R Day J Fleming B Cutrone A
gers A Dale Social Triples F 27 C Toms A Broholm 8 Win J Fry M Hollier R Matheson (5) d Lane Cove 24 (0) Social S CHRIS DALE d N Ward S Merani R Hurley Court S Skinner F Mc Garry d Blake d D Pocock B Carabetta
Palmer E Wilton K Stewart d J Rk 4 Jackpot not won AGM lost13/25 S Mewburn W Da- Walder M Collum C Albert d J 30/19 G Monk R Preston d B Nicoll N Martelli G Drabsch G Hatch 25/24 S McClatchey
Maclaine J Beale P Hirst details President C Benson VP ley M Havron P Delves won Davey D Lloyd M Terry 21/20 North Ryde RSL Men C Carmichael P Roy 19/16 J G Carroll 20/16 K Johnson D R Issacs S Skinner d C Smith
LYNNE M Burkett/A Broholm Secretary 22/19 Pts 2-8 Gde 6 v Pen- DAVID ERSKINE Arkins A Cukon dr R French B Lee V Ardino d A Rozsnyoi J J Rae I Christopherson 30/27
l Humphreys Treasurer W Hy- nant Hills J Havron W Spaul R Apr 14 Social E Sinanain R Took 18/18 Thu Apr 22 Social Hae J Myers 23/20 T Stanis M P Stewart E Bell J Mohan d A
Denistone Women land Delegate S Fennell Match Gallop R Phillips won 28/10 B Putney Tennyson Bowls Inchley B Iacono d S Rotondo R McDonell J Dixon R French d Wilson K Graham d A Issacs T Mahony B Smith S Arkin 21/19
selection S Hardacre K Russell Swan N Swancott M Gardiner G Higinbotham T Vanderlaak R Robinson R Dickinson P Roy Marcellino R Johnston 24/16 G Drabsch S Berry T Stanis d
Tue Apr 20 Social F LagdonE R Inchley Welfare J Greene So- K Douglass lost 14/21 R Kern Wed Apr 21 Minor Singles C/ 25/15 T OShanassy G Inchley A 26/25 D Baillie C Norgate R R Ralston D Pocock L Hansen M Armstrong B Nicoll G Mitch-
Whatmore R Holman d P Stew- cial Committee J Hope P Ying R Watkins C Thurmer S Garvey ship K Jennings d M John- Wray dr T Oshanassy C Costa MacKenzie d E Rayner H Jones d J Rae S Layburn Tb Thur- ell 27/12 C Cupitt B Cupitt K
art McClean M Pollard 23/13 H B Law C Renwick won 22/14 Pts 9–1 Gde 7 v ston 31/27 Social K Andrews N Ferris 22/11 Apr 21 Social E J Forbes 28/21 Sat Apr 24 So- tell 27/22 J Welsby J Woods Johnson d M Woods M Lyall R
Higgins N McCleod E Tulloch COLLEEN RENWICK Wenty Leagues S Colquhoun K Wooden A Bolster K Be- Sinanian J Lundberg T Vander- cial T Slater A Cukon d B Logan T Chan d B Shirley G King J Ralston 21/14 M Little T Little
J Elliot d A Mahony M Sugula A Robinson R Stanton R Vass atty d M Caldwell M Caruso laak D Hope d E Sinanian S Ro- J Mazzaferro 26/13 J Forbes N Knight 25/16 Fri Apr 23 Jack- A Moylan d L Crow D Lee C
R Lightfoot B Peddell 26/6 B North Epping Women lost 8/34 R Delves B Forrest D K Judd K Lake 20/18 T Ryan tondo A Wray J Grabiec 19/17 Ward P Roy d J Forbes K Li R pot Pairs A Gordon J Barker Madafiglio 20/17
McGrath C Minque A Ross E Thompson G Stace lost 12/35 R Rees A Rodger d F Cornelis R Hochstetter W Coelho J Hui Preston 22/20 Apr 24 Pennant d D Pocock R Ralston 17/12 DAVID POCOCK
Bell d M Armstrong R Pacey Tue Apr 20 Social H Stibbs R C Watford L Driessen T Warner J Carrington D Walker 17/14 d G Orsatti P Collins S Plem- Reserve Comp Dundas White S Arkin G Erickson d A Rozs-
M Woods C Cupitt 21/20 C Knott P Spaul d S Quessy S R Crowne lost 15/20 pts 0-10 K Riley L Ager B Prentice d B ing 14/12 D Fenelon C Costa P d D Dheurle J Arkins J Higgins nyoi V Ardino 22/14 N Benson Hunters Hill Men
Heming S MClatchey S Baillie Odbert G Tucker 23/12 S Ar- KEN DOUGLASS Jasprizza P Davidson J Stan- Auberson J French d A Barko- G Pincini 25/16 Pennant Rd 7 D Bremner d E Tulloch J Elliot
B Smith d C Smith A McKeon chibald S Farrelly J Swan d A ton 26/14 P Smith C Dale P vski A Hollard N Ferris T Pisano Gde 2 Merrylands d Carlo Dis- 25/12 B Carabetta G Carroll d Sat Apr 24 Pennants Rd 7 Gde
E Leemakers H Simmons 15/11 Baguely L Watford J Havron Lane Cove Bowls McClean d P Dobie D Divine 26/16 R Inchley G Inchley A trict 9/1 Gde 4 Carlo District G King S Skinner 27/14 A Mc- 3 Hunters Hill d Greenlees Park
S Younie P Nealon C Jackson 17/7 Prem J Palmer V Riley P Joint 23/11Sat Apr 24 Pen- Benson d A Cusack P Cusack d Greenlees Park 9/1 Gde 5 Shane J Walker d M Woods M 61/50 (9-1) GP d C Sandstrom
M Miller d S Younie S Shirley P dr Prem S Caswell M Garrick Sun Minor Singles S Hobson nants Gde 4 Bye Gde 5 North M Gale 19/16 Apr 10 Zone 10 Concord Community d Carlo Lyall 28/14 P Downing D Nel- R Bauer W Cappelletto R Rose
Dick R Isaac 17/9 16/16 d R Marshall 31/22 Mon Minor Ryde RSL 10 pts d Putney Pennant’s Rd 7 Gde 5 Section 2 District 10/0 Gde 6 Bye son d A Weaver P Hodkinson 24/14 W Farthing G Burkett
COLLEEN HEMING SUE ARCHIBALD Singles K Mulhall d C Board- 62/41 North Ryde d E Lam A North Ryde RSL d Putney Ten- GEOFF YOUNG 29/15 S McClatchey C Hem- T Burt J Stewart d GP 22/12
man 31/6 Major Singles R McDonald K Jennings J Mc- nyson 10 pts to 0 Gde 6 Sec- ing d B White J Rae 31/16 N K Stuart C Bass R Brennan T
North Ryde RSL Women North Epping Men Marshall d Kay Mulhall 31/28 Connell 25/13 North Ryde d K tion 2 North Ryde RSL lost to Denistone Men Martell G Drabsch d J Fleming Beno d GP 25/14 Gde 4 Castle
Wed Minor Singles S Hobson Beatty J Stanton D Paananen Greenlees Park 10 pts 0 M Little 26/22 F McGarry D Hill d Hunters Hill 69/56 (8.5-
Tue Apr 20 Memorial Day Rk 2 Wed Apr 21 Club G Giudice R d V Solway 31/23 Social H D Walker 21/14 North Ryde d P IAN PENDLETON Sun Apr 18 Major Singles D Walker d R Court P Dawson 1.5) R Gledhill G Barron B Car-
C Toms P Ying J Bax F Lanc- Kern R Crowne d J Royer C Fox G Boardman Kay Mulhall Harris L Ager K Lake R Marrins Butt d L Hansen G Erickson d K 23/18 K Lake B Jasprizza d penter V Moscato d CH 22/20
ett 8 A Richardson M Martin C Watford R Peterson 27/15 T d H Fox S Smith B Patterson 16/14 Gde 6 Merrylands 9 pts d Carlingford District Men Graham E Coleman d A Blake R Johnston J Knight 25/20 B Hunter G Jones G Bricknell G
Bamback P Ferris 16 Rk 4 B Carters A Robinson J Fry d R 23/16 D Hillerman P Wade d M Putney 1 pt 81/42 Merrylands d J Myers d S Skinner J Peisley L Mohan D Roughley d C Norris dr CH 21/21 CH d J Juni-
Law A Broholm C Candrick I Seidl J Clough D Byron 22/17 Knight G Moon 19/12 D Mad- M Caruso P Davidson R Rees Wed Apr 21 Social J Higgins d G Gudmunsen G Drabsch d Madafiglio A Haworth 29/23 U per B Stuart S Crowhurst I Ross
Hitchens 13 Y Roberts R Ste- R Watkins R Gallop K Douglass son S Creedy d D Erskine Kevin I Radovnikovic 36/10 Mer- J Roddy R Palmer d B Wood D Moody B Carabetta d C Pid- Bendt W Henden d R Newman 28/13 Gde 6 Wenty Leagues d
phens M Burkett S Beram 12 d N Oppedisano N Swancott Mulhall 18/16 M Cosby M Col- rylands d P Noone J Elliott B T Siviour W Dewhirst 26/21 B dick D Roughley d D Douglas C O’Connell 18/12 G Hatch K Hunters Hill 71/48 (10-0) WL d
Rk 6 J Hope M Tennant J Au- R Matheson 25/24 J Taylor R lum O Hostrup d G D’Souza J Reynolds C Dale 24/10 P Smith Cupitt B Goldsworthy R Sum- P Dawson d P Dale J Knight d Graham d L Crow T Thurtell O Vandoros B Love M Burton
berson 24 J Bryant W Hyland L Thorp R Phillips d A Macleod W Davey C Albert 12/10 D Lloyd P Dobie A Bolster P McLean merhayes d F Woodley K Lip- M Lyall B Cutrone d G Stewart 20/16 D Kosh R Goggin d A R Hopwood 23/16 WL d R Col-
Humphreys 10 Win Rk 6 These Spaul P Delves 19/16 T Warner M Smith M Popovic d C Board- d Merrylands 22/21 Cockatoo scombe R Hall 28/19 J Hobson L Crow d T Gardiner Av Crock- Blake S Armsworth 22/21 D lyer M Roberts G Thongsophon
ladies will have their names D Dyer M Hollier d O SHerrard man S Shortis J Bowring 17/12 Cup Denistone 3 pts d Putney D Kensett-Smith d D Livesey art d Z Bosnjakovic Wed Apr Yates M Hogan d C Campbell J McDonald 22/16 WL d P
engraved on the Memorial Tro- P Harbrow M Havron 27/21 Sat Pennants Gde 6 Lane Cove 1 pt 37/35 M Texier B Prentice 21 Social D Alice T Locascio D M Knight 35/10 Z Bosnjakovic Langwill D Beauchamp J Stuart
phy Thu Apr 22 Rk 1 M Bass L B Swan W Daley d G Scott R I Christopherson d V Solway R J Mobbs 26/16
Humphreys S Beram I Hitchens Vass 30/18 Pennants Rd 7 Gde Patterson 30/12 L Thomson JJ
G Scott d R Morton M Lit-
tle 29/12 Sat Apr 24 Social G
FOOTY VWESTS DRAGONS SATuRDAY,
TIPSTERS MAY 2ND, 4.05PM
TIGERS
WIN STADIuM,
WOllONGONG
JOHN ANTHONY JOHN O’BRIEN JEROME lAXAlE JIM MORRIS VICTOR DOMINIC BOB DWYER THE ONE-EYED TIGER RON RYAN STEVE COlQuHOuN Guest Tipster
AlEXANDER ROBERTS Director, Ryde Mayor, Director DOMINEllO PERROTTET lord Mayor, TWT’s fearless Chairman, Putney Manager, The JOHN KIM
MP, Bennelong MP, lane Cove Eastwood leagues City of Ryde Parramatta courrnebsipaossneddent Eastwood Club
North Ryde RSl MP, Ryde MP, Epping Bowling Club Managing Director,
Rabbitohs Rabbitohs Raiders Pacific Blue Health
Storm Storm Rabbitohs Raiders Rabbitohs Rabbitohs Raiders Storm Bunnies Rabbitohs Raiders
Titans Titans Storm Storm Storm Storm Storm Broncos Mexicans Storm Storm Raiders
Titans Titans Titans Titans Titans Panthers Bananabend- Titans Storm
Panthers Panthers Panthers Panthers Eels Broncos Panthers Broncos
Eels Eels Panthers Eels Panthers Panthers Eels Roosters ers Panthers Eels Panthers
Eels Roosters Eels Eels Roosters Warriors PantherPets Roosters Eels
Roosters Roosters Warriors Warriors Dragons JelliedEels Eels Warriors Roosters
Warriors Warriors Roosters Wests Tigers Roosters Roosters Dragons BondiChicks Roosters Wests Tigers Warriors
Dragons Dragons Warriors Warriors Cowboys 39 Warriors Dragons
Dragons Dragons Dragons 37 Kiwis Wests Tigers
36 37 TIGERS
39 33
37 36 34 36 32 33
20 THE WEEKLY TIMES Wednesday 28 April, 2021
Tigers commemorate our Anzacs
By the one eyed Tiger
The Tigers released a stir- brotherhood, a sisterhood
ring Anzac Day message on and a connection,” he said.
Sunday.
“It is an emotional and
Read by Tigers Football spiritual connection derived
Manager and former soldier from human nature.
Jimmy Wright, it paid tribute
to the men and women from “It is about the spirit that
TWT Tiger Territory who lays within us.
have served our country in
war and in peace. “It is about mateship.
“We reflect on the Anzac
“From the inception of spirit .. the Australian way...
the Anzac spirit in World Lest We Forget.”
War One to current sur- The Balmain Tigers were
viving members, the stoic wartime Premiers in 1915,
courageous mature grit 1916, 1917, 1919, 1939 and
and compassion coupled 1944.
with the larrikinism of the
Tigers Football Manager and former soldier Jimmy Wright Anzacs is what I think de-
fines the Australian fabric
of mateship,” Jimmy Wright
said.
“Anzac Day is a proud day
of reflection yet a sad day of
remembrance.
“We honour these every
day Australians who were
prepared to make personal
sacrifices for the freedom
and quality of life that we
enjoy today.
“They are gone but they
will never be forgotten.”
Jimmy spoke about his 20
years of service, his wife’s
current service and the ser-
vice of his grandfather who
fought in the British Army
during World War Two.
“Anzac Day is about a
Mothers’ Day 2021 GIG GUIDE
BOOK ONLINE AT:
SUNDAY 9 MAY www.releagues.com.au
SPECIAL MOTHER’S DAY RAFFLE AND PRIZE DRAW FREE!
CELEBRATE MOTHER’S DAY RAFFLE RYDE RETRO MANIA
AT RYDE-EASTWOOD
Ticket sales from 11.30am. DANCE TO DJ LOUIE WITH HITS FROM THE
SUNDAY 9 MAY The raffle starts at 2pm. 70S, 80S, 90S, NOUGHTIES AND TODAY!
Treat Mum to a meal at one of SPECIAL PRIZE DRAW FRIDAYS 28 MAY, 25 JUNE & 30 JULY
our four dining options: FROM 8PM TILL LATE!
Buy a drink at the Main, Bistro, Oasis and
• SPECIAL MOTHER’S DAY LUNCHEON function bars between 11.30am and 2.30pm
The Heritage Function Centre from 12pm - $55 to receive an entry ticket.
Book online or at club reception. The draw starts at 2.45pm.
• The Palm Court Bistro - Steaks, Pasta, Prizes Include . . .
and kids’ menu. • 2 x $250 Myer Vouchers
• $100 Beauty Voucher
• The Coffee Club – Coffee, cakes • 32 Inch HD Television
and snacks for mum.
• The Golden Hawk Chinese Restaurant -
Exquisite Asian cuisine.
Conditions apply.
THE EVERLY BROTHERS
& THE ROCK ‘N’ROLL LEGENDS OF THE 50s & 60s
SATURDAY 5 JUNE. 8PM. TICKETS $35
RYDE-EASTWOOD LEAGUES CLUB 117 Ryedale Road wWw21Te11wes71.ltr:e4RRl0eyyda2ege9ude8Nas0Sl.ec7WoRm22o4.1a4a1u44d West Ryde NSW
Tel: 02 9807 2444 www.releagues.
Wednesday 28 April, 2021 THE WEEKLY TIMES C
Sunday,
April 25, 2021
Northern Cemeteries sponsor the annual Anzac Day Service for North Ryde RSL Sub-Branch at Macquarie Park Cemetery and Crematorium RSL Memorial site on the Thursday before April 25
Anzac Day. Northern Cemeteries Head of Marketing Evelyn Santoro welcomed everyone on the occasion of the RAAF Airforce Centenary acknowledged by Paul Auberson senior VP NR RSL who
presented Evelyn with a bouquet of appreciation. Gordon Macpherson gave the Anzac Day Address with welcome by Sub-Branch President Mick Leayr and acknowledgement of Country by Susan
Moylan-Coombes. Centenarians Olive Jardine and Les Osborne were special guests escorted by their sons. TWT -0n-the-spot PHOTOS.
fHaomnioliuesrifnogr our We are here to
years to come answer all
your questions
For more information
get in touch today
1300 389 888
The new Mausoleum of The Holy Way at
Macquarie Park is an impressive semi-open
structure that incorporates:
Castle Hill RSL Pipe Band traditionally lead the Anzac Day dawn service parade at North Ryde • Crypts
but this year had to remain content in playing in the North Ryde RSL Club foyer prior to the ser- • Vaults
vice in the club auditorium. ANZAC Commemoration Address was presented by Ryde Secondary • Ash garden
College captains Jordan Lau and Delphi Siahu who were presented with framed Certificates of • Columbaria
Achievement by North Ryde RSL President Mick Leayr and Gordon Macpherson. TWT on-he spot • A courtyard, water features, as well a reflection garden to honour
PHOTOS.
the life of our ancestors for generations
Price includes the complete package: interment, inscription, and
ongoing maintenance with no further costs.
Northern Cemeteries is a not-for-profit organisation taking care of community needs.
Macquarie Park Macquarie Park Cemetery & Crematorium
North Ryde Cnr Delhi and Plassey Roads, North Ryde NSW 2113
D THE WEEKLY TIMES Wednesday 28 April, 2021 Sunday,
April 25, 2021
KOKODA TRACK MEMORIAL WALKWAY SERVICE
ANZAC and Field of Remembrance
Service was held at Kokoda Track Me-
morial Walkway last Saturday with An-
zac Address presented by Mrs Renee
Wilson CEO Australian War Widows
NSW.
Wreath laying ceremony was led by
Rhondda Vanzella OAM with Mayor of
Canada Bay Clr Angelo Tsirekas.
Pictured left Parramatta Citizen of the
Year Heather Gillam, Ryde’s Don Bai-
ley and Sydney Legacy President Nikki
Hollis of Henley. Pictured right, former
Concord Hospital executive Alice Tang
with two candidates for next Anglican
Archbishop of Sydney Bishop of South
Sydney Michael Stead and the Dean of
Sydney Kanishka Raffel.
TWT on-the-spot PHOTOS.
Hunters Hill 98th Combined ANZAC Service
Major Damon Hietbrink President of Hunters Hill RL Sub-branch presented the Commemorative Address at last Friday’s Hunters Hill 98th Combined ANZAC
Memorial Service outside the Hunters Hill Town Hall because of Covid-19 restrictions. Prayers were offered by Pastor Alejandro Grancha, Rev Michael Armstrong and Fr Aliki Langi. Honour Roll
was read by Young Citizen of the Year Oliver Gardiner, Trumpeter was Jacob Love, Boronia Park Public School performed. Piper Richard Knight played and Clr Justine McLaughlin was MC. TWT
on-the-spot PHOTO.
The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
The Weekly Times - TWT - cheekily describes itself as a campaigning, crusading, truth-seeking, death defying, Aussie battler-aligned, one-eyed-Tiger-led news organisation dedicated to Sydney's north west.
It's one of the few remaining independently run community newspapers and turns 100 years old in 2021 - so if you want to show your support for independent media, have a quick look at the paper, submit a letter to the editor via its website or like or share one of its posts on social media.
The flip book - or digital edition/replica - of the 28th April 2021 edition of TWT can be reached here: https://weeklytimes.com.au/the-weekly-times-twt-28th-April-2021/
And the most current edition of TWT is always reachable using this short address: bit.ly/OurTWT
Discover the best professional documents and content resources in AnyFlip Document Base.
Search
The Weekly Times | TWT | 28th April 2021
- 1 - 24
Pages: