National Pet Directory

FALL 2020

Health & Weight
pg. 28

Business Building
pg. 24

REGULATIONS

AND

Your Kennel

4 Breeding
Genetics
STEPS TO
To Meet
STRATEGIC Your Goals
GROWTH



Rating NOFautnullrA5aS0llpl0DeB0caKutyrllubigmsht

#20PL $54.00 #30PL $64.00 #15PL $48.00 15 & 20 WATT
BEST SELLERS
» Dust proof LED light » Dust proof LED light » Dust proof LED light
» 20 Watt 12-24V DC » 30 Watt 12-24V DC » 15 Watt 12-24V DC 12V BULBS
» 3,000 Lumens »4,500 Lumens » 2,250 Lumens
» Approximately 71/8" Long » Approximately 81/8" Long » Life 50,000 hours
» Life 50,000 hours » Life 50,000 hours » 5 year manufacturer warranty
» 5 year manufacturer warranty » 5 year manufacturer warranty » Approximately 61/4" Long
» Deodorize | De-Allergize | De-Pollute » Deodorize | De-Allergize | De-Pollute » Deodorize | De-Allergize | De-Pollute

ELECTRIC

#16PL $31.50 BEST #9PL $24.95 #30EPL $64.00 KEKNINNGEL
» Dust proof LED light SELLER
» Dust proof LED light » Dust proof LED light
» 9 Watt 110V AC » 30 Watt 110V AC
» 16Watt 120V AC AC » 800 Lumens » 4,500 Lumens
» 1600 Lumens » Life 15,000 hours
» Life 15,000 hours » 5 year manufacturer warranty » Approximately 81/8" Long
» Approximately 4" Long » Life 50,000 hours
» 5 year manufacturer warranty » Deodorize | De-Allergize | De-Pollute » 5 year manufacturer warranty
» Approximately 51/8" Long
» Deodorize | De-Allergize | De-Pollute YODER,S» Deodorize | De-Allergize | De-Pollute
» Dimmable

Woof Woof Tina, Yelp Chester, Drieds&Gifts
The only thing worth barking I agree, It is much easier to
about is the new lights we got,
bow-wow! What a difference, breathe & my last babies
the light doesn’t hurt my eyes, are fat, content, & healthy.
I can sleep better, I feel better, No one has been sick, I feel

breathe better, & I actually look much better with more

& smell better! energy, and also noticed less 7062 COUNTY ROAD 77 | MILLERSBURG, OHIO 44654

odor in here. PHONE: 330.674.5603 | FAX: 330.674.5606

inTshtaalnlikbnsuglmPbsuarsete-lrigfohrt A few lines your way to express my
gratefulness for the LED Pure-light, light
testimonies bulbs I ordered from you. First thing
I am very impressed with the bright
We started using some LED Pure-light bulbs The drain odor in our kennel day light like light they put out, this 15
in our kennel and we want to order more became a lot less after we installed watt bulb is a lot brighter than my other
bulbs, as we are seeing great results. We like 2 19 watt Pure-light bulbs. Also cheaper one was and it takes less battery!
the type of light they produce like natural noticeable was healthier puppies. No one in the house was sick all winter.
daylight. No mores sick puppies since we are I would recommend Pure-light I usually have allergies during the winter
using the Pure-light bulbs, plus best of all, bulbs for your kennel. when I’m indoors a lot, not this year.
less odor in the kennel! My house also no longer has that usual
-ohio musty-stale smell, the air just smells so
sincerely, a.s. fredericksburg, oh clean and fresh! I definitely want to order
more bulbs .

yours truly, r. stolzfus, narvon, pa

the coating of the bulbs is now double strength, therefore giving them twice the purification.

HOW IT WORKS BREAKING DOWN HARMFUL POLLUTANTS LIKE The Super Oxygen Technology applied
CARBON MONOXIDE, BENZENE, AND FORMALDEHYDE to this bulb has been shown to discour-
Light Enhanced Super Super Oxygen Bacteria and viruses Byproducts are age 99.9% of harmful bacteria, viruses,
bulb TiO2 Oxygen molecules attack are dissolved and harmless water and mold including:
surface coating on molecules bacteria, viruses pollutants are decom- and CO2
bulb created and pollutants posed » Salmonella
» E-Coli
-OH -OH -OH -OH -OH -OH -OH H2O H2O » MRSA
-OH H2O » SARS
Viruses -OH Viruses -OH » STAPH
-OH -OH H2O H2O » Strep
-OH -OH -OH -OH -OH -OH » BIO-film Cold and Flu
-OH -OH » CRE
-OH -OH CO2 » Black Mold
-OH -OH VOCs VOCs
CO2 CO2
-OH -OH -OH -OH CO2 CO2
-OH -OH

National Pet Directory | Fall 2020 3

Editor’s Note Thank your Puppy Customer
with a treat for the puppy & the owner.
Greetings of cheer in this beautiful fall season. We
hope this finds you in good health and spirits. A The Puppy Basket $28.00
big thank you to all of our advertisers, readers, and
contributors- your continued support is what makes Emma’s Cinnamon Bun popcorn,
this publication possible. Zerbe’s chips, Stoltzfus Meats beef sticks,
Lately, we have been heartened by the Helmut Old-fashioned rootbeer, and doggy treats.
Schmidt quote "The biggest room in the world is
the room for improvement." Whether you have CuoasrvAttadeoiddmldaaybgtbolieyef.tasr.
been running a kennel for years or you are starting
out with your first litter, there is always something We can ship directly to your PH: 717-509-1546
to learn for all of us. Striving for excellence reflects customer or deliver to your
well not only on our individual businesses, but on location. 5% discount for 10 Fax:717-661-7939
our industry as a whole too. Continual learning
spurs the growth and progress that brings success. or more. www.dutchbaskets.com
We hope this publication brings you encouragement
and educational resources along your business
journey. Are there ways we can serve you better?
Perhaps article topics you’d like to learn more about,
special requests, or opinions? We would be glad to
hear from you, call or write anytime!

Best wishes, The National Pet Directory Team

4 National Pet Directory | Fall 2020

Contents

Business Resources Features

7 A to Z Vet Supply 29 Paw Print Genetics 16 Strategic Growth
43 Beaverdam Pet Food 45 Pequea Ln Animal Houses
31 Beco Equipment 39 Premium Pet Food Entrepreneurial lessons from the farm
4 Blu Flame Heaters 39 Pro Pac Pet Food
51 Community Connection 14 Puppy Saver 48 Industry Licensing
13 Ductless System 50 Purina Pro Club
4 Dutch Baskets 47 Red Flannel Dog Food Understanding animal regulations
27 Elite Nutrition 19 Revival Animal Health
41 Ex-Cell Pro Pet Food 17 ROF Whelping System 24 Business Building
15 EZS Whelper 5 Tigworxs
10 GDM 44 Trail Farm Supply 5 foundational steps to pet marketing
39 Graber Dog Food 9 Vibralife
6 Wagler’s Kennel Products 38 Health & Weight
2 Great Lakes Pet Food 28 Wall-Mate
8 Health E Oil Impact of obesity on pet wellbeing
6 Hilltop Frenchies 3 Yoder’s Drieds & Gifts
41 Joy Dog Food 26 Breeder’s Basics
49 King’s Pet
44 New Fab Enterprise Genetic choices & your kennel

Breed Index Custom Stainless
Steel Products!
37 Akita
21 Belgian Malinois Gates, Dog Cages, Kennel
33 Bernedoodle Products, Dividers, Channels,
32 Bernese Arches, Name Plates, & more!
35 Boston Terrier
34-35 Cavalier Mfg. by 293 Old Pequea Ln
35 Cocker Spaniel Honey Brook, PA 19344
32 Dachshund
21 German Shepherd 610-273-7972
20,32 Labrador Retriever
37 Mastiff
23 Newfoundland
22-23 Pembroke Welsh Corgi
14 Pomsky
33 Poodle

5

6 National Pet Directory | Fall 2020

National Pet Directory | Fall 2020 7

8 National Pet Directory | Fall 2020

Vibralife
717-687-7492 • [email protected]

Raising puppies in a world of harmful chemicals, drugs, and antibiotics can be
challenging. That’s why we created the perfect pair of all natural products that can
take your puppy’s health to a level you’ve only dreamed of. No harmful chemicals.
No side effects. Just a vibrant life for the pets you love!

+=

Vibralife helps eliminate parasites and toxins, strengthen the immune system,
establish a thick and shiny coat, and heal the gut lining and stomach with all-natural
ingredients.

Vibralife X is a quality natural dewormer blended of select herbs, including black
walnut, sage, wormwood, papaya, clove, fennel, and garlic.

Ask for these products at your local hardware, feed, or breeder supply store.

Puppies in Paradise, LLC • Paradise, Pennsylvania 9
National Pet Directory | Fall 2020

10 National Pet Directory | Fall 2020

National Pet Directory | Fall 2020 11

Write a Story

A big thank you to all of our creative readers who sent submissions
for the Spring 2020 Story Contest. Here is the 2nd Place winner.

Sly Fox’s Encounter
with a Wall

Mr. Sly Fox stretched and luck at my favorite – the chickens! cunning skills, several unfortunate
yawned, he rose from his warm Darkness finally stole hens were doomed that night. The
nest in his den, which lay hidden across the land and the farmer and poor chickens became supper for
on the side of a noll behind a pile his children’s voices faded away. old Mr. Sly. After his dinner, Mr.
of large boulders at the edge of Soon the lights that had twinkled Sly licked his lips with satisfaction
the forest. He stealthily stepped in the window became dark. Sly and thought to himself with pride,
out into the evening twilight. His Fox waited a while longer to be “What a clever individual
soft, red coat glistened in the last sure he was safe, then swiftly and am I! Sometime soon I will
rays of the evening sun while cunningly he snuck toward the take the opportunity to feast on
his bushy tail was twitching, he sleeping village below. With an air another delicacy… maybe a young
started sniffing the soft breeze. of conceit and a smirk on his sly goat?”
He sat on his hunches viewing face, Mr. Sly Fox approached his Meanwhile, Mr. Billy
the quiet valley below, where the destination. He did so in such a Goat and his Mrs. became quite
little farms were nestled among noiseless slink the unsuspecting concerned for their dear little
the grassy meadows. Vast lush chickens never knew that they kids. For they feared they would
green fields and a winding stream were about to be terrorized from be Mr. Sly’s next prey. The Goat
stretched out before him. Sly fox their peaceful roost. couple had heard all the clamor
licked his chops and his stomach Much to the naughty and ruckus the night before when
grumbled in protest, there was brutes delight the latch on the the thief had descended upon the
no doubt in his mind that he henhouse door stood slightly ajar. poor chicken’s coop.
intended on a good meal of Mrs. This will make his hunt a prime This caused Mr. Billy Goat
Smith’s chickens. Maybe if those time and an effortless, hot pursuit to become very observant and
tasty chickens were all shut in of squawking hens and flying protective of his precious little
safely for the night, he would have feathers. With his quick wit and herd. He held his little horned
to find something else to satisfy
his ever-growing appetite. I must
be shrewd and wait till the farmer
and his family are all tucked away
in dreamland. Then I shall see
for myself to happen upon a feast
of chickens, or maybe, let’s see…
Mr. Billy Goat and his Mrs. seem
to have some new little ones with
them in the back pasture. Hmm…
a tender young kid would sound
delicious too, but first I will try my

12 National Pet Directory | Fall 2020

head high and alert for any snatched one of Billy’s precious am!”
suspicions of Old Mr. Sly Fox. kids and was swiftly dragging To his utter dismay, he
But as several days passed by him away! Billy Goat gave one frantically skidded to a halt as
old Billy began to relax since no bellowing Baaaa!! Mr. Sly Fox he struggled to keep his balance
more havoc had been raised. He gave an astonished glance toward when he found himself at the
began to let his youngsters play the charging Billy and instantly brink of a well!
in the pasture farther away from dropped the kid and darted to the Old Billy didn’t waste any
his watchful eye. The little kids East, as a way to escape, with Billy time in fulfilling the plan that
frolicked among the daisies and close behind! had entered his mind. With one
buttercup and nibbled the lush But, alas, Mr. Fox was not fierce shove from his horned head
grasses, things were so calm and so shrewd this time. He didn’t bowed low, the fox went sailing
peaceful. When all of a sudden, realize what thought had suddenly headfirst into the water below!
out of the blue, at the edge of the entered old Billy’s mind. He would With thrashing and gasping the
pasture a streak of red flashed at chase old Sly Fox right to the little fox was soon on his feet. He felt
startling speed toward the helpless hand-dug well at the edge of the so grateful that the water only
baby goats! Poor Mr. Billy was pasture. In hot pursuit, Old Billy came up to his shaking knees.
rudely startled from his nap in rushed after Mr. Sly. Meanwhile, Fortunately, he was not any
the warm spring sun, with awful Mr. Sly was dashing for safety deeper in the water for this poor
dread in his heart. He dug his from those hard-rounded horns frightened creature.
sharp hooves into the soft earth that were quickly gaining speed A frog with a bulged
and with an alarming speed, he from behind! A few more leaps eye sat staring at him and with
hurtled toward his enemy with and I’ll be free, he chuckled blinking eyes wondered how
his horned head bowed low he proudly to himself, this crazy fox had fallen in. The
charged! The sly thief by now had “Wow, what a clever fox I old Goat chuckled with glee and

Mini-Split Ductless System!

Finally an Energy-Efficient Solution to give your dogs the comfort they deserve!

Kennels, Milking Parlors, Woodworking Shops, Office Spaces, Cabins, Rec Rooms!

• Heats & cools • Improved efficiency (19-20 Seer)
• Uses up to 60% less energy than traditional air

conditioning systems • No more ductwork
• Easy installation • Better zoning capabilities
• Flexibility on placement location • 110V capability
• 4 batteries & 4 solar panels should last up to 4 days!

New! We now have Dealer inquiries welcome!

Dual Zone Systems

in stock. (2 indoor heads

on 1 outdoor unit)

New Holland, PA • 717-799-6610 • Please contact Isaac for more info.

National Pet Directory | Fall 2020 13

wondered how clever old Sly felt So old Sly vowed he’d leave that night,
now. Billy the learned over the stone And never again give Billy such a fright,
wall of the well looking at Mr. Sly Thus, the Old Goat he bowed his head low,
Fox. The fox shivered with fright and While Sly Fox, he stretched high on his toes,
with tears in his eyes. He proceeded I’ll get you out, just grab ahold of my horns,
to plead for mercy while Old Billy And leave this place and remember you’ve been warned,
beamed with pride. He was proud he
managed to save his dear little one So the humbled fox he slunk away,
and taught Old Mr. Sly some dignity! And Billy never saw him again not even to this day!
The frog with the bulging
eyes began to fret that his home Written by: Ruth Hoover
in the well had been invaded. The
Sly Fox was an unpleasant guest
and he implored Old Billy to fetch
the fox out. So, Billy with a tender
spot in his heart gave into Froggies
imploring and Old Sly’s pleadings.
He said that he would rescue his
enemy only this once. But he only
if the Sly Fox promised to never set
foot on the farm again…

“Reuben” Puppy Saver

Pomsky · 20 lbs. · Friendly • Lightweight Poly Box
Blue Merle with blue eyes
• Stainless Steel Edging
Samuel Fisher, Kirkwood, PA · 717-529-4066
• Electric Heat

• Sloped Floor

Prices starting at

$495.00

Rent for $20 a week

Dealer inquiries welcome

Contact:

Kenton Zimmerman

610-286-1795

Call for nearest dealer

Saving just OPTIONS:
one puppies • Digital Thermostat
life pays for
• Stainless Steel Safety Rail
the box!
• Available In Two Sizes
30” x 38” or 38” x 46”

14 National Pet Directory | Fall 2020

EZS Happy, healthy
Mother & her
WHELPER
babies!
CANINE APPROVED
New!
> Slanted Floor
> Removable Mat DisfoproCEsleaaabsnlyeinBPgoaxds
> Safety Rail
> Stainless

Steel
Structure

Save More The Whelping Box helps eliminate...
Puppies
· Suffocation caused by roaming
& make-shift heating pads

· Neglect caused by the mother’s discomfort

Without · Fire Hazard from overhead lamps
· Getting Up through the night in the dead of winter

the Stress · Bacteria & Odors leftover from previous litters
The Whelping Box can also serve
as a heated bed for your grown dog!
“The peace of mind that
comes with this box is worth Our whelping boxes are skillfully handcrafted in Lancaster County,
the purchase price alone!” & come with a 1-year full warranty on the EZS WHELPING Box,

- M. Miller, PA & a 10-year limited warranty on all stainless steel parts.

DEALERS Bird-In-Hand Pet Structures, 470 Millwood Rd, Willow Street, PA 17584 • 717-435-8222
Cedar Creek Kennels, 11113 Witmer Rd, Grabill, IN 46741 • 260-417-6609
JB’s Feed & Supply, 5075 TR 401, Millersburg, OH 44654 • 330-893-3684 Digital thermostat for electric heat
King’s Pet Products, 3867 Old Phila Pk, Gordonville, PA 17529 • 717-614-9484
Peaceful Acres Ag, 650 Lyons Rd, Millerstown, PA 17062 • 717-438-3121
Straightline Enterprise, 11950 W. 400 S, Millersburg, IN 46543 • 574-596-1126
Sunny Ridge Farms, 11965 State Route 304, Mifflinburg, PA 17844 • 570-966-4208
Stutzman’s Feed Mill, 85 E County Road 250 N, Arthur, IL 61911 • 217-543-2195
William Miller, 564 Spencer Ln, Fredericksburg, OH 44627 • 330-749-6266
Homer Stoll, 10964 E. 275 N, Loogootee, IN 47553 • 812-709-1546
Gun Dog University, 12797 E. River Rd, Bridgeland, Utah 84021 • 435-790-6130
Samuel Glick, 545 Roller Rd, Elizabethville, PA 17023 • 717-917-0948
Steve Stoltzfus, 1697 Beaverdam Rd, Honey Brook, PA 19344 • 610-469-4014
Affordable Pet Supplies, 270 Buck Hill Rd, Kinzers, PA 17535 • 717-947-0127
Nate Bailey, 775 N Main St, Mantua, Utah 84324 • 801-920-9449

Call Abner at 717-803-0730 or visit us at EZSWhelper.net or email [email protected]

National Pet Directory | Fall 2020 15

Strategic Growth

Entrepreneurial Lessons from the Farm:
Cats and a Milk Bowl

What do cats and a milk
bowl have to do with your
business? I grew up on an Amish-
Mennonite farm in Georgia, and
as a child I loved to go to my
Uncle Amos’s nearby dairy farm
and watch them milk the cows.
Every morning and evening before
leaving the barn, they would pour
plenty of fresh milk in a large
flat bowl on the ground. The first
time I saw this I was quite curious
about what I figured must be the
last step in the cow-milking, but
could not imagine why. Then I
found out.

In no time at all, cats appeared, and satisfying the much-loved For example, if you want high-end
racing in from all corners of the rodent dispensers, the farm cats. I clients, you should not market to
farm. I will never forget that wondered if my business was that low-end clients, and vice versa.
scene of fifteen cats of all colors attractive, and to whom? If your target market is a male
stationed around the milk bowl— approaching retirement age,
lamdmtwcsYesntwfiitaohthonbekroaaarwyieoamaoteftlmrnshiwkrwuamtcnstaspsuesahetnbitdhdaispltndryhlnaosinaiubocg,amtokwndaywlageawsewibt.drcmyglnewhe.eAokasnldIretfrIia.ueishtnksfitrssstruotnagIst,alttaetrrmhmwbteueaiwdlrcgksahntttbrhaesoetotiofna,fwtfneachkANltacdeirdtntwriorsvctetaga!ahhleancslsTrteseet9ssthiniunyfs’e2srigmnok“%gTnme”rorurtTYamspewhssohptkateeuaorIryotynruk’nsltoeposeuattvelnraeedsseemtmxlofciulikekfcmWwwbomHhefqln?layhswuueoohhvootyaYnhywewaoaneawnuost?tabstrre’aatutdryqeliWidrdyrgietodoousgegdooeoonhuaoeheeruotret.t,mstrthabathhtmI“cttmhmettuithee’eWaaosiyesannyiyenraynsytirbgytghrnh!ldkp?tkoeutoeehgoeooteDoysiote,itris?kisn,?on,”tg. casting a wide net by marketing
to 25-95 year-olds is a serious and
expensive mistake. If your sales
are almost always to a family with
children, only focus on “families
with school-aged children” in your
marketing strategy. This doesn’t
mean you are excluding any
potential customer, just that you
aren’t wasting your resources.
In a different analogy, let me ask
you: If your goal is to catch a lake
trout, where is the only place you
would go to fish?
In one of my businesses, a
cleaning company, we determined

16 National Pet Directory | Fall 2020

that our target market is women included the delicatessen, the car they have members of my target
aged 40-60, who drive high- wash, nail salons, hair salons.... market in their chairs all the time!
end cars and live in gated then it hit me! Hair salons were And they do hair; my company
communities. You may be my magnet—my milk bowl! cleans homes—so there is no
thinking that I am limiting myself Why would I waste my time conflict or competition, no reason
and my company if I market only tracking down individuals in to not send their customers to me.
to this profile—not at all! my target market when they But why would they?
already gathered at hair salons,
Now that I had defined my “cats” specifically, salons which were in I had heard that people do
(my target market), I had to the local upscale neighborhoods? business with those they KNOW,
address the best way to attract In my analogy, cats were enticed LIKE and TRUST. But nobody
and satisfy them. My mind shifted by the milk, but if any other food knew me, which certainly had to
to the milk bowl. What was the scraps were also offered, they were come before they could learn to
“milk bowl” in this cleaning eager consumers. Related to my trust me. I wasn’t so sure if they
company strategy? I asked myself business, I wanted my service offer even liked me....this was my first
a very important question: Where presented to the eager consumers rodeo! So, what did I do? I made
does a 40-60 year old female that who had already been attracted to them like me! I would walk in
drives a high-end car and lives in the salon. I asked myself, “How do with a box of fresh donuts and a
a gated community go often and I attract the middle-aged female smile and say, “Good morning!
on a regular basis? (It is useful customers in hair salons to my I’m Dave with Got-A-Maid and
to brainstorm and note as many company?” If only I could get the I brought everyone donuts!” I
places as you can.) hair salon owner and employees would set the box down on the
to refer them to me. After all, counter and start walking out.
We came up with a list that

National Pet Directory | Fall 2020 17

Every time, someone would 1well as being effective, it is also a Identify and describe your
stop me before I got to the door. ideal customer, being as
“You’re WHO? And you brought highly efficient approach? Instead
us donuts?” I was their new best of going after one client, go after a detailed and specific as you can.
friend. company that already has dozens
I was able to tell them about of your ideal clients and build a 2 Determine where these
my service and share with them relationship with that company. people already hang out or
my mission statement for the We know that people want to do are drawn to on a regular basis.
company. I offered to clean their business with people they know,
place for free just so they can see 3like and trust. Imagine what
our quality and attention to detail. Connect with those people
I would also tell them that I would could happen if you could build a who already have a “milk
be bringing them more donuts relationship with enough people bowl” attracting your target
next month and—“Here are some and companies that know, like and market and create a mutually
‘referred by’ cards. Just write your trust you, and are willing to send beneficial referral partnership.
name on a card and give it to your their clients (your target market)
favorite client. We will reward you to you. 4 Go above and beyond to
for every client that you send to show appreciation for each
us.” Each hair stylist took a stack and every referral.
of cards, which they could turn
into cash quite easily. “Oh, and by People are Small business owners I coach
the way,” I would add, “would it report that this strategy has
be okay if we send our high-end 4 TIMES saved them enormous amounts
clients to you?” I collected their of time and money. More than
cards to pass on to clients. Now I more likely to buy when that, when you are focused on
was practically family! referred by a friend how to build a mutually beneficial
The lesson is to look for ways to referral relationship, you get the
give rather than only focusing on Nielsen’s “Trust In satisfaction of knowing that you
how to gain. The really neat thing Advertising” report are helping another business
about this approach is that any owner in growing their company.
business can attract more (and I know a farm owner/dog It is energizing, never draining,
more qualified) customers with breeder, for example, who told to put your marketing efforts into
a milk-bowl-and-cat system in me that they have established a building fulfilling relationships.
place. great relationship with a local
What is the best form of veterinarian. They use the vet’s Coaching point: Who already refers
advertisement? Word of mouth— services, and when the vet has customers to you? Thank them,
you’ve heard it hundreds of times. a client who is looking for a again. Who also has contact with
What do you need in order to reputable place to get a dog, the your ideal customers? Think of how
have people talking about the farm’s brochures are at hand you can help them, first.
greatness of your company? Great for the vet to easily share. A vet
relationships! is an obvious relationship— I Article contributed by: Dave Kauffman
This is known as relationship encouraged my friend to identify Empowering Small Business LLC
marketing or referral source three or four other potential “ideal www.EmpoweringSmallBiz.com
marketing. Can you see that as referral partners.” To talk with Dave about speaking to your business or
Do you want to efficiently at a church or company function: (813) 580-8920
18 attract customers to your
business? Establish ideal referral Author, Seeds: Grow Your Business with 31
partnerships with these steps: Entrepreneurial Lessons from the Farm (2019)

National Pet Directory | Fall 2020 People-Centered Leadership (2018)
Freedom to Succeed (2016)
Master Certified DISC consultantZiglar Speaker/

Trainer/Coach

“ An ounce of prevention “
is worth a pound of cure.
Benjamin Franklin

Think of how much healthier your animals would be
if you prevented health problems instead of treating them.

That’s working smarter, not harder and it’s the stuff
geniuses are made of.

Learn more at RevivalAnimal.com/Prevention 19

National Pet Directory | Fall 2020

Are you looking for a...

Labrador Retriever with Style & Color?

“Rosie”

Due in late July.

We have white Pups available August 26!
AKC registered. 5th generation of white bloodlines!

“Trumpet”

“Prince”

CHARCOAL LAB STUD SERVICE WHITE LAB STUD SERVICE
AKC & ACA registered. Proven sire. AKC & ACA registered. Champion bloodline.

717-768-3503 Abner Kauffman • Narvon, PA

20 National Pet Directory | Fall 2020

Mixed Malinois w/Shepherds or pure German Shepherds

“Dino” “Darth” “Max”
German Shepherd Belgian Malinois Belgian Malinois
(His sister is the #1 canine in Holland.)
(Well-bred)

Puppies
available!

717-824-1398

Dan Kauffman
Honey Brook, PA

“April” “Bella”
German Shepherd Dutch Shepherd

“Moe” “Brock” “Sarge”
Belgian Malinois Belgian Malinois
German Shepherd
(Darth’s son)
Well bred. Just the beginning!

National Pet Directory | Fall 2020 21

22 National Pet Directory | Fall 2020

Pembroke Welsh Corgi Pembroke Welsh Corgi

Bingo

ACA-registered; Proven sire; $200 Stud fee Registered AKC • Proven

“Brett” has been passing on his unique New blood line, throws large litters

markings & producing large litters. Honey Brook, PA • 610-806-3082
Quarryville, PA 717-917-4495

Newfoundland 23

“Bady”

• Imported
from Serbia
• AKC-registered
• Hip & Elbow-

Certified
• Proven

Gideon Zook
New Holland, PA
717-847-1024

National Pet Directory | Fall 2020

Business Building

As the saying goes, “A picture is worth a thousand words.”
A good-quality pet photograph starts with you.

Studies have shown the average a simple background helps create arrive after their typical naptime.
person gets distracted after an image that directs the focus to
only 8 seconds. This means your your pet. Keep in mind the colors
Grooming
4pet photo and the first impression of the background and select We see and care for our pets
it makes is a vital component to something your pet will stand out every day. So it can be easy to
engaging your customer. Here are against. Try to avoid areas with overlook a patch of tangled
5 tips to curating the ideal photo loud distractions, like next to a hair or an overdue trim. Yet it
to boost your pet business: busy road or excited children. A is important to take note of the
relaxed pet first impression they will
1Make a plan in a peaceful make for viewers who are
Having a plan for your photo environment People form a considering a purchase. A
session makes all the difference. is much good bath and brushing
Check your schedule to ensure easier to first impression the day before a photo
an adult will be available to direct and session makes a big
direct everything on photo day. keep still for in a mere difference in the end
Decide exactly which pet(s) will that ideal result.
be photographed. Have a good pose. 50
idea of where you would like the
photographs to be taken. If there 3Time it milliseconds 5Have a backup
are any props you want to use, like well Even with the best
planning, things can
bows or special collars, have them Being mindful of your pet’s go wrong. Maybe you wanted
ready in advance. Arranging a personality and temperament a photograph on the grass, but
clear plan in your mind will create will set you up for success. If it’s raining. Or perhaps your
a photo session that is an efficient you’re wanting a photo of your pet doesn’t want to behave. Be
and a stress-free experience. Plus, stud dog standing still, consider prepared with an alternative
since many photographers charge letting them out for some indoor photo location in case the
by the hour, efficiency can render exercise to burn off any anxious weather turns. Having a special
valuable cost- energy before treat or toy on hand can also
savings. photo time. provide needed encouragement to
On the other a stubborn pet.
2Consider the 90% hand, perhaps Studies revealed that people
surroundings you need
It’s easy to put all of customers say that some photos
your focus on the photo quality is the
most important factor highlighting
main subject and remember 20% of what they
overlook what may your cute playful read, but 80% of images they
be going on around in an online sale puppies. In this see. A good-quality photo can be
case, be sure the a valuable business investment.
Etsy buyer surveys

your pet. Choosing photographer Remember, your pet will be ready
a location that has is scheduled to on photo day if you are!

24 National Pet Directory | Fall 2020

WINTER EDITION 2021

Schedule your FREE photography & design today!

National Pet Directory DISPLAY AD Order Form - WINTER 2021

1. Ad size:  Full  1/2 Horizontal  1/2 Vertical  1/4  1/8

2. How many times would you like run your ad:

3. My ad will be sent by:  On file  Mail  Email (Designer's Name: )

 FREE Ad Design (I've scheduled my ad by January 15th 2021)

4. Payment:  Enclosed  Send an invoice

Business Name: Contact:
Address: Phone:

Email: Fax: Call:
To schedule your
Mail: OR Email: OR display ad and
Send this form, with a clear FREE ad design
Send all details
ready-to-scan ad to from this form and a 484-798-2358
National Pet Directory print-ready PDF ad file to
PO Box 522, Quarryville, PA 17566 [email protected]

Ad Deadline: January 29th

Free ad design for ads booked by January 15th!

Save with Multi-Issue Discounts

National Pet Directory CLASSIFIED AD Order Form - WINTER 2021

Name: Address:

Phone: Category (Choose One):  STUD  PUPPY  KENNEL  MISC.

$19

$19

$38

$38

Need additional characters? Please included them on a separate sheet of paper. Up to 50 characters included per $19 charge.
Up to 2 hours free design valid when ad is scheduled by January 15th 2021.

484-798-2358 • [email protected] • PO Box 522, Quarryville, PA 17566

The Advertising Source foNratAionalllPeot DfirYectooryu|rFPall e20t2s0, Services & Pet Supplies! 25

Breeding Genetics

With over 400 different dog breeds worldwide, there are endless options for
your kennel. Genetic consideration can help narrow your focus.

Understanding genetic
terminology and practices
can be very important for your
breeding program. A firm grasp
on these concepts enables you
to develop a kennel that meets
your business goals and market
your puppies to your ideal buyers.
Let’s delve a bit deeper into
understanding the key genetic
practices of breeding.

PUREBRED, following of Crossbreds. Since
CROSSBRED, then, Crossbreds have grown
or MIXBRED? in popularity, as they can
produce offspring that combine
You’re likely familiar with the positive attributes of two
breeds. The key distinction
bwrotoPbamwswacarwocreoeeeplhpnnarffteuooaihfpsshoeceptaddtrsryeekrsihehrvcherepeeckemmondotiaerofebahrlfhioesdcmoytiifnirrbbirhtcrantauawenghllseteergniedacrennnetrnecsordgt;edtc,aoo,meongscbodtsuoe.dmtrAdehsre,eePnsbntitrhchuhtsebeearpyprcanbedtsaebanebadcceresrurcrleiedttooeetineidhwssdwdsDenateeeoafssesdtrold.eflhyeiostoossfodonamydoigfiogcmgbiatgafosnrwf,n,elfieeltdbioyrsremseupnPal1bAdadnitpaea9rkucmioectpr5celtfrce,fageh0eeietutedebray’lrshisarlrirsars,pseeceeae.ttscadiedaAdnhtt’ssranestmenidorPdnotr’oseaetiAfngstrrsdigRmcsaateerhbngereyiisKhcftoaoSBaAaePATSLCsfIeerirnuxnnlhhynrrhauuigasmdmcncasddbeinsernalIth.hmlopetrneneditaCGBoabnrchhlcTaiplodirziroe,eeCsesczalgeeaoprrecautesldtmdskoiuen,i,dososcadbo.sanipnal,fnfeiorsceo of Crossbreds is the ability to
trace (with documented proof)
26 National Pet Directory | Fall 2020 their ancestry back to two
Purebred dogs. There need to
be three generations of careful,
documented breeding before a
breed can be officially recognized.
There are various registries for
Hybrid dogs including AKC
Canine Partners, National Hybrid
Registry, Designer Breed Registry,
American Canine Hybrid Club,
Designer Dogs Kennel Club.
Crossbreds may also be known as
designer breeds or hybrids.

Lastly, a Mixed Bred dog has more P-Generation and F1 the parents, then children, then
than one breed in its bloodline. The P-Generation is the grandchildren, and so on. In
These dogs have unidentified foundation of a breeding program. parallel, with dogs we have the
parentage and lack documentation It includes a Pure Breed male P-Generation, then F1 generation,
of their ancestry. Often it is and Pure Breed female, which then F2 generation.
unknown how many different are then mated to each other. Let’s examine a Crossbred F1
breeds contribute to their genetic The P-Generation should always Labradoodle. Starting with a
make-up. be purebreds. It can help to Purebred sire and Purebred
remember these as “parent” or dam, they would produce an F1
GENERATIONS “purebred” generation. litter of Labradoodles. The chart
From the P-Generation come the below illustrates the breeding of a
You’ve probably heard terms like Filial generations. The term Filial Crossbred F1 Labradoodle.
F1 or even P Generation used. refers to the generation(s) after
But what do all these number the parental generation. Filial is P Generation P Generation
and letter combinations mean? a technical term for offspring. Purebred Purebred
In essence, these abbreviations This is what the “F” in F1, F2, etc Labrador Poodle
are simply a method to track stands for. The numbers designate
a dog’s lineage. Keep in mind how many generations down the F1 Labradoodles
that the ability to register your puppies are. 50% Labrador & 50% Poodle
Purebred or Crossbred is reliant Consider this terminology in
on documented proof of the dog’s comparison to what we use for
lineage. Next, we’ll cover the key people. A lineage starts with
terms you’ll use in keeping track
of your dog’s ancestry.

A.S.A.P. Puppy 12 gram tube $8 Because

Contains Colostrum Your Dogs
Natural Antibodies Depend
Failure To Thrive / Weak puppies
Great Immune Booster on You...

Essential Dog 2 lb. $30 / 5 lb. $65 / 30 lb. $279

Daily vitamins and minerals
Haircoat and body condition
Energy and Immune Building
Highly absorbable iron encourages
good cycles and helps with breeding

Odon, IN ∙ 800.990.9926 27

National Pet Directory | Fall 2020

F2 and F3 Now let’s take a look at this puppies will likely look like an
As we continue down the lineage, process using the Labradoodle even mix of the qualities of the
breeding two F1 dogs together, example below. Note, that in two breeds. For example, they will
creates the F2 generation. this breeding approach each likely show slightly curly hair, but
Next, from two F2 dogs, you generation remains 50% Labrador not the very tight curly hair of a
would get the F3 generation. and 50% Poodle. Therefore, the purebred poodle.

F1 Labradoodle F1 Labradoodle F1 Labradoodle F1 Labradoodle

F2 Labradoodles F2 Labradoodles
50% Labrador & 50% Poodle 50% Labrador & 50% Poodle

F3 Labradoodles
50% Labrador & 50% Poodle

28 National Pet Directory | Fall 2020

Test for specific traits such as colors Use code:
and coat types
NPD2020
Receive results in only 14 days from
the time we receive your samples in Save 50% off diseases, coat
our laboratory colors and traits when you
order testing on 5 or more
Receive free genetic counseling from
our veterinarians and geneticists to dogs!
better understand your results Call us to order!

Produce desirable puppies that
your buyers want

Get results that you can trust with Sale expires December 31st, 2020
99.9% accuaracy

Call Us: Direct 509-483-5950 or Toll-Free 855-202-4889 (US & Canada)

National Pet Directory | Fall 2020 29

Backcrossing example, we can see this breeding appearance, their health and
What if you’re looking to create a program illustrated below. temperament are vital traits to
breeding program of Labradoodles It’s a wonderful world of consider too. Keep in mind what
with very curly hair? When you’re possibility. Begin to consider traits your buyers are asking for
looking to intensify the traits of what you would like the results or excited about. Be sure to keep
a particular breed within your of your breeding program to records of the lineage of your
Crossbreds, a breeding technique be like. Whether you choose to puppies. Taking good notes of
called Backcrossing is used. pursue purebreds or crossbreds your mating will help document
Backcrossing is when you mate is a matter of preference. Be what is working well and areas
an F1 dog and a P Generation (or honest about the strengths and for improvement. Afterall, a main
purebred) dog. The offspring of weaknesses of your dog. With goal as a breeder is to produce a
this mating would be called F1b. careful examination you can better quality dog, and a better-
For example, if you’re looking to seek a mate that will help to quality pet for our customers.
amplify the hypoallergenic trait, balance or eliminate those flaws. With a little understanding and
breeding F1b Labradoodles would While it’s easy to focus on a dog’s planning, you can develop a
be a good consideration. Focusing breeding program you and your
on our Labradoodle Crossbred buyers are excited about!

P Generation P Generation KEY
Purebred Purebred GENETIC
Labrador Poodle TERMS
BTahciskcmroastsiinngg is
C P-Generation

F1 Labradoodles P Generation The parent generation,
50% Labrador & 50% Poodle Purebred comprised of two
Poodle Purebreds.

Filial

Refers to the generation(s)
after the parental

generation, or offspring.
This is what the F in F1,

F2, etc stands for.

F1b Labradoodles C F1 Labradoodles
25% Labrador & 75% Poodle 50% Labrador & 50% Poodle

CtHoesrPeeoeowdineletsettnrasariifttiesd F2b Labradoodles
37.5% Labrador & 62.5% Poodle

30 National Pet Directory | Fall 2020

National Pet Directory | Fall 2020 31

Mini Dachshund “Frankie”

“Bear”

ACA registered

Mini Bernese “Rover”

Weighs 35 lbs. Bernese Mountain Dog

Coatesville, PA 717-844-3160 AKC Registered • Proven Sire
Progesterone Testing Available
Honey Brook, PA • (610) 235-6385

“Milo”

White Lab • AKC & ACA Registered Toy Poodle Stud (proven)

1561 Beaver Dam Road, Honey Brook PA Blue & White Parti * AKC Reg. * 6 lbs.

(610) 273-3818 Leola, PA * 717-656-0881 Ext. 0

32 National Pet Directory | Fall 2020

Prince BERNIe

MINI BERNEDOODLE MINI POODLE
ICA-registered AKC & ACA-registered • 15 lbs.

Also... Shihtzu Stud Service • ACA-registered • Chocolate & White

Proven Breeders • 717-803-5212 • 209 Cedar Drive, Leola, PA

Valiant Copper Man Mini Poodle Stud Service

Red & White Parti

Apricot Standard Poodle AI w/ Progesterone Testing
AKC Registered · Proven Breeder · 50 lbs.
{ 10 pounds }
Greencastle, PA · 7 1 7-494-6745
$50 per puppy, $75 boarding fee

Gordonville, PA | 717.799.2210

National Pet Directory | Fall 2020 33

How cold is too cold? Flexu s

°F Breed Size ! Other Ca va lier Stu d
Factors
Key Blue Merle • A1 available
SMALL MEDIUM LARGE AKC & ACA Registered
Honey Brook, PA • 484-798-9881
60° 1 1 11 +2
No evidence KENDON

55° 1 1 1 of risk; If wet
50° 1 1 1 Have fun weather
outside! is present
go 10°

2 colder
45° 2 2 1 Risk is unlikely;

Have fun -1

40° 3 3 2 outside, with
care.
If Northern

35° 3 3 3 breed or
3 heavy coat

Unsafe potential go 5°
depending on
30° 3 3 3 breed; keep warmer

watch on your

25° 4 4 3 pet outdoors. -1

20° 5 4 3 4 If dog is
acclimated
Dangerous
weather to cold

15° 5 4 4 developing; go 5°
use caution. warmer

10° 5 5 5 5

Potentially

5° 5 5 5 life-threatening

cold; avoid

0° 5 5 5 prolonged
outside activity.

Winter Tips (717) 947-3441
 Ice, snow, rock salt and general cold weather can cause damage to your
pet’s paws. Check them often and watch for signs of limping, cracked paws, or Cavalier · AKC register pending
ice accumulation between their toes. Blenheim · 12 lbs.

 Antifreeze and rock salt both pose a risk to pets if ingested. Clean up any 828 Winter Hill Road, Strasburg PA
antifreeze spills, and clean paws immediately if walking over rock salt.

 Cold weather can make certain medical conditions worse, like arthritis or
heart disease. Annual checkups help make sure they’re ready for cold weather.

Adapted from the Tufts Animal Care and Condition scales

34 National Pet Directory | Fall 2020

“Tyler” “Rocky”

Cocker Spaniel Blue Merle Boston Terrier
AKC & ACA registered • Proven breeder CKC registered • Proven breeder.

275 West Center Square Road, Leola, PA 17540 • 717-598-0312

King Charles Cavalier “James George Hostetter”

-Boulder Ridge Rambo

DOB 11/20/2017 • ACA Registered • Proven Boston Terrier · ACA & AKC Registered
Produces puppies w/Queens Thumbprint • 16 lbs.
$350 flat rate • East Earl, PA • 717-445-0782 Typically throws red, blue, & black puppies

Proven Breeder · $60 a puppy · $50 boarding
Ronks, PA · 717-687-9004

National Pet Directory | Fall 2020 35

DENTAL CARE Preventative oral care can help boost
For Your Dog your pet’s health and save you money.

#1Dental disease is the illness

affecting pets, and can affect heart,

kidney, and lung function.

Good dental care can help a pet live up to SUSCEPTIBILITY

20%
longer

80% Small breeds of dogs tend to
have more dental build up than
of dogs have some form of dental disease large dogs, often due to the
by the age of 3 according to the American overcrowding of teeth.
Veterinarian Medical Association.
Dogs with a lot of muzzle hair
such as poodles and schnauzers
tend to have more oral
problems.

Toy breeds that open-mouth
breathe are more prone dental
build up because their mouths
are dry.

Bleeding Red, swollen gums or Bad
from the brownish yellow build breath
mouth
up on teeth

5

signs of
dental disease

in dogs

Reluctance to eat Frequent pawing or
36 rubbing at the face

and/or mouth

National Pet Directory | Fall 2020

TIPS FOR “Willowbrook Bandit”
HEALTHY TEETH
Akita · AKC & ACA Registered
3 AND HAPPY DOGS
START NOW Champion Bloodlines
According to the American Veterinary
Medical Association, Up to 80% of pets Proven Stud · DOB: 02/14/19
actually have dental disease by the age Henry Fisher, Lancaster, PA · 717-725-1432
of 2. But there’s no need to worry, since
dental disease is highly preventable. English Mastiff Stud Service
Starting early makes all the difference.
Start brushing puppies’ teeth at 5 months, Maple Grove Zac

or once all of their teeth are in. It is Champion & Grand Champion bloodlines
easier to teach habits young, so ~200 lbs~ Good Temperament~
Atglen PA 717-380-6772
brushing early starts healthy habits.
37
REGULARLY SCHEDULED
The American Animal Hospital
Association says dogs should have their
first cleaning by age 1 for small breeds,
and by age 2 for larger breeds. Regular
dental cleanings will save money in the
long term, helping prevent dental disease
and costly teeth extractions. It’s
important to keep in mind that vital parts
of the teeth are not visible because they
are under the gumline. Veterinarian
dental cleanings use X-rays which reveal
tooth problems the eye can’t see.

TOYS
Chewing helps scrub away food residue
and build up. Durable toys with a slightly
abrasive quality actively clean dog’s teeth as

they chew. Wondering how to strike
the balance between a toy that is too hard
or soft? Use the fingernail test. Press your
fingernail on the toy and if it has no give,

it could likely run the risk of being too
hard and causing tooth damage. Look
for a toy that has a slight give under

the fingernail test.
Another dental benefit of chewing is
increased saliva production. Saliva helps
reduce tartar deposits. The hard calcified
formation of tartar is a major contributor

to tooth decay.

Health & Weight

A dog’s health can be greatly impacted by their weight. As an owner, you
have a vital role to play in setting the stage for wellbeing.

Healthy food is a vital part of
a healthy dog. But can there
be too much of a good thing?
Yes! Dogs, like all animals, gain
energy from the food they eat.
If dogs gain more energy than
they can use, that energy stores
in their body as fat and results in
extra body weight. It is in the best
interest of the dog and owner to
take steps toward maintaining
good health and preventing costly
medical complications whenever
possible.

UNDERSTANDING they look so cute.” However, with Let’s dive a bit deeper into
OBESITY 56% of dogs in the United States understanding the role these
Many people find it hard to considered obese, it is the most factors play, so we can help set
believe that obesity is an issue common medical disease in dogs. our dog up for a healthy and
for dogs, much less that it can be Obesity is associated with serious productive life.
harmful for them. It is easy to look medical complications such as GENETICS
at a chubby dog and think “Awe, diabetes, reproductive disorders, When it comes to genetics, this
gastrointestinal issues, some forms is the contributing factor to
BREEDS PRONE of cancer, cardiovascular and obesity that an owner has the
TO OBESITY musculo-skeletal disease. Research least amount of control over. As
has also revealed obese dogs have breeders, one of the goals of the
Beagle a weaker immune system and that breeding program is always to
Basset Hound the average lifespan of overweight produce better dogs. Certainly,
dogs was up to 2 1/2 years shorter. the genetic predispositions of
Bulldog It is clear that maintaining a a breed cannot be completely
Cocker Spaniel healthy body weight for your dog changed. However, becoming
is an essential task. knowledgeable about the strengths
Dachshund There are four key factors and weaknesses of a breed
Dalmatian that contribute to obesity in provides the opportunity to create
Golden Retriever dogs: genetics, reproductive preventative habits that set a dog
Labrador Retriever management, diet, and exercise. up for optimal health.

Pug
Rottweiler

Terrier

38 National Pet Directory | Fall 2020

RABER DOG FOODAevlaiivlearbyle
G D

Adult 24/16 Puppy Starter 28/20 Puppy Starter 27/20
chicken & rice chicken, rice & egg chicken, pork & wheat

Distributed by: Amos Smucker 717-768-7579
49-A N. Harvest Rd Bird-in-Hand PA 17505

CONTACT YOUR NEAREST DEALER: aSvhaaivlaibnlges
Levi Glick Drumore, PA 717-284-3006

Ben Smucker Smyrna, PA 610-593-5948

Jonathan Byler 16720 Dry Run Rd. South Dry Run, PA 17220

National Pet Directory | Fall 2020 39

REPRODUCTIVE feeding with smaller portions can feeding the pets on any given
MANAGEMENT actually lower the risk of obesity. day, the schedule stays the same.
The reproductive management Frequent and smaller portions Regulating and being thoughtful
of dogs also has direct links to give dogs smaller amounts of about giving treats is also
their weight. Each owner has energy at one time that can then important. It can seem convenient
to keep treats right at hand by the
kennel. However, consider storing
Metabolism is the process by which these occasional items in a special
the body converts what an animal place, that is also out of reach
from eager young hands. This
eats and drinks into energy. can help make giving treats an

intentional act, rather than a fun
different goals and intentions be burned much easier and faster reflex that is easily forgotten.
for their pet. Some may find that throughout the day.
fixing their male dogs is the best Another simple tool for
option for their situation. This can The number of people in your maintaining a dog’s healthy weight
have a number of benefits such household can also affect your is a baker’s measuring cup. As
as reducing the risk of testicular dog’s weight. Interestingly, owners, daily life can get hectic
cancer, prostate disease, or research found that households and it is easy to be unaware of
controlling aggressive behaviors. with more people are more likely how much food a dog is getting. A
It is important to keep in mind to have obese dogs. This is mainly measuring cup will easily ensure
that studies suggest neutered dogs because each person wants to give feedings are precise. Being precise
are more likely to become obese. a dog a treat! Everyone, especially about exactly how many calories
This is due to a decrease in their young ones, likes to see a dog and nutrients a dog is getting is
metabolism. happy and showing their best critical to their health.
behavior and excited for a reward.
It can be just as fun for people to
DIET
As an owner, you dog's diet is one give a treat as it likely is for a dog EXERCISE
of the factors you have full control to receive one. But imagine a dog Physical activity is a great way
over. What, when, and how to feed is given two meal portions daily to help control weight gain in
your dog are significant decisions. and then 6 family members each your dog. Creating opportunities
These daily decisions can seem give an additional snack stick for daily exercise can keep them
small and trivial. However, they treat. A dog could easily become healthy for years to come. Studies
arguably have the biggest impact overweight due to the excess show that for every hour of
on an animal’s weight. calories from exercise a dog gets
extra feeding. per week, their risk
In one study, veterinarians kept of obesity reduces
track of how many portions Preventing over As little as by 10%. Plus, the
owners fed their dogs on a daily feeding can be intensity of the
5 pounds
basis and how the number of achieved by a of extra weight can activities has little
portions effected the dog’s weight. simple feeding effect on the overall
The results showed that regardless schedule that increase a dog’s benefit. So, whether
of the type of food, owners who is posted for risk for medical you take your dog
fed their animals twice a day had all family for a vigorous run
conditions.

less obese dogs than owners who members to see or merely play some
fed their dogs 1 time daily and and marked light catch, the
3 or more times daily. The study off throughout the day. That dog will have a similar reduction
also showed that more frequent way no matter who oversees in the risk of obesity. Ensuring

40 National Pet Directory | Fall 2020

Proud to support the dog breeder industry
since 1945.

For distribution or dealer
inquiries, contact:
Chip Kohser
Sales Manager
412-596-0264

[email protected]

joydogfood
Joy Dog Food

JoyDogFood.com

National Pet Directory | Fall 2020 41

exercise for a dog can be a great obvious the waist and abdominal part of the process. Expect to
opportunity to include children tuck is, how much excess fat is create a weight loss plan that will
in the chores and good habits of beneath the skin and how much last at least 3-6 months. Change
caring for animals. muscle mass is present. Measuring feeding amounts gradually
ASSESSING WEIGHT a dog’s BCS can provide a more over 1-3 months. Incrementally
By definition, a dog is overweight comprehensive health assessment increase the length and intensity
when they are 10-25% over their and is common practice among of exercise over several weeks.
ideal body weight. Healthy weight many veterinarians. See the This balanced approach will help
is also more than just a number chart below for full details on the your pet adjust to the new routine
on a scale. Muscle mass and numeric BCS ratings. and reduce begging behaviors.
body fat also have an important
role. To evaluate a dog's health TAKING ACTION Time and resources dedicated
on an integrated level, a Body Perhaps, after a weight assessment, to a dog's diet and weight are
Condition Score (BCS) can be you discover it will be healthy always a good investment. Early
used. A BCS is a visual, hands-on to reduce your dog's weight. recognition and awareness is the
assessment administered while Remember that extreme diets ideal defense against avoidable
a dog is standing. Providing a and sudden intense exercise can and costly health complications.
numeric value from 1 to 9, the be harmful to your dog’s health. Prioritizing your dog's physical
BCS is based on four criteria: Generally, a dog can safely lose wellbeing can be pivotal in
how easily felt the ribs are, how 1-3% of its body weight per creating a fruitful kennel.
month. Patience is an important

Images courtesy World Small Animal Veterinary Association

42 National Pet Directory | Fall 2020

BL\�fil)AM

ALL NATURAL dog & cat food selections UALITY MEAT & PROTEIN
- including bones, chews and treats!
AVAILABLE AT DEALER LOCATIONS American grown Pork & Chicken

Mohawk Valley Ag Lapps Farrier Service FOUR DIGESTIVE AIDS
95 Willow St 180 Hawkins Road
Oxford, PA 19363 Prebiotics, Probiotics, Chicory & Yucca
Fort Plain, NY 13339 Ph. 484.748.4091
Ph. 518.993.2543 ORGANIC SELENIUM YEAST
Levi Stoltzfus
Eash Harness 815 Compass Rd Research shows benefits in reducing
& Supplies Honey Brook, PA 19344 cancers, and the onset of Alzheimer's
Ph. 717.618.9968
10459 CR 42
Millersburg, IN 46543 S.L. Sales
19900 Sunny Lane
Ph. 574.642.4374 Platville, WI 53818
Answering Service:
Fayette Sales
& Service 1.608.574.0241

4348 Yost Road Stoltzfus Pet & Feed Supplies
Waterloo, NY 13165 552 Cains Road
Gap, PA 17527
call between:
7:45-8:30 AM Ph. 717.442.17527
Ph. 315.549.8312
United Fencing
Franklin Stauffer 13379 Dover Road
306 Wood Thrush Lane Apple Creek, OH 44606 Ph.

Mt. Pleasant Mills, 330.857.1543
PA 17853
Wood Ruff Feed & Supplies
Hillside Garden Center 3365 S. 400 E.
1401 W. Kings Hwy.
Gap, PA 17527 LaGrange, IN 46761
Ph. 717.442.3167 Ph. 260.350.5714

• No By-Products Beaverdam Pet Food
• Natural preservatives 12933 Sussex Hwy
• No corn, wheat or gluten Greenwood,DE19950
• No artificial coloring or flavoring Phone: 302.349.5299
• Family owned & operated since 2003 Fax: 302.349.5750
Email: [email protected]

THERE IS A DIFFERENCE... ALL NATURAL
MADE&GROWN
For more information contact the following distributers in your area
IN THE USA
PA - Daniel Stoltzfus I 5280 White Oak Rd, Paradise, PA 17562 I Ph. 610.593.7548

OH - United Fencing I 13379 Dover Rd, Apple Creek, OH 44606 I Ph. 330.857.1543
IN - Shipshe Farm Supply-I 2380 N 925 W, Unit B, Shipshewana, IN 46565 I Ph. 260.768.7271

CALL FOR A FREE SAMPLE PACK & A FREE BROCHURE!

National Pet Directory | Fall 2020 43

HIGH QUALITY CUSTOM KENNELS

PLAY STRUCTURES & ACCESSORIES

STAINLESS STEEL · ALUMINUM · PLASTIC · POLY

CALL TODAY FOR A FREE QUOTE

33906 STATE ROUTE 643, BALTIC, OHIO 43804 · T: 330-595-9900

KENNELS

5013 Townshi3p3Ro0ad-83599,3M-i3lle0rs8bu6rg, Ohio 44654 Portable Puppy Pen Vertical Rod Fronts with
CALL FOR A CATALOG! Solid Partition Walls
Stainless Steel Fronts Custom sizes available
(Optional)

44 National Pet Directory | Fall 2020

National Pet Directory | Fall 2020 45

DOG BARKS Barking is an essential communication
Translated tool for dogs. Decoding their meaning
can help you respond effectively.

Continuous rapid barking at a mid-range pitch

This is the most common type of barking. It likely means “There is a potential problem! Someone
is coming into our territory! We may need to take action!”

Barking in rapid strings with a few pauses at a mid-range pitch

This usually suggests that a dog is sensing a problem nearby. This bark is saying “I suspect that
there may be a problem or an intruder near our territory. I think the leader of the pack should
look into it.”

Prolonged barking, with moderate to long intervals between each bark
This is a sign of loneliness and getting board. A dog is communicating “Is there anybody there?
I’m lonely and need companionship.”

One or two sharp short barks at a mid-range pitch

This is usually good news and a typical greeting sound. This often replaces the alarm bark when
dog gets more familiar with the stranger. This is the dog version of “Hello there!”

Single sharp short bark at a lower mid-range pitch

This is often given by a mother dog when disciplining her puppies. It may also indicate annoyance
in any dog, such as when disturbed from sleep or if hair is pulled during grooming. This is a dog
telling you “Stop that!”

Single sharp short dog barking noise at a higher mid-range

This is a startled or surprised sound and can mean “What’s this?” If it’s repeated two or three
times, its meaning changes to, “Come look at this!” to alert the pack to a new event.

Stutter-bark at a mid-range pitch

This is often accompanied by front legs flat on the ground and hips high. If a dog’s bark were
spelled “ruff,” the stutter-bark would be spelled “ar-ruff.” It means “Let’s play” and is used to
initiate playing behavior.

Rising bark – almost a yelp, though not quite that high

This is a series of barks that each sound something between bark and yelp but not quite that high
pitch. Used during a rough-and-tough tumble play time and shows excitement, it means “This is
fun!”

Single yelp or very short high-pitched bark

This is in response to sudden or unexpected pain and usually happens
when dogs play with other dogs or small children. This can be
simply translated to “Ouch!”

Series of yelps

This is usually a sign that the dog is in severe fear and pain.
The dog is saying “I’m hurting! I’m really scared.”

TIPS TO
STOP YOUR DOG

4 FROM BARKING
IGNORE BARKING
You don’t want to reward bad habits. If
a puppy barks each time when you
come home or enter a room, then avoid
eye contact, turn your back, and do
not pet the dog. Once the dog calms
down and sits, then give praise. Even
negative attention, such as scolding,
can also increase a puppy’s barking.

Remember, consistency is key.

TEACH COMMANDS
Start training with one command first.
For example, train a dog to respond to

the “quiet” command by allowing
around three or four barks, and then
saying “quiet” in a clear and calm voice.
If it stops barking, give praise or a treat.
If the dog resumes barking, stop all

praise and treats. Once the “quiet”
command is mastered, move on to

training the “speak” command.
Learning new commands may take
weeks, so be patient and stick with it!

STIMULATION
Tired dogs bark less. Giving a dog
enough exercise can release suppressed
energy. Some dogs also bark excessively
when they are bored. Providing mental
stimulation, such as puzzles and treat-
dispensing toys, can be a great solution.

LIMIT DISTRACTIONS
Dogs can get caught up in everything
they smell, see, and hear. Loud noises
can be big distractions that provoke
barking. Try to keep their kennel to
a quiet area. Territorial or protective

behavior can be brought on from
diversions they are seeing. Curtains
or shades are a great tool to block

visual disturbances.

47

REGULATIONS

Understanding your federal rights and responsibilities as an owner in the
animal industry can safeguard your pets and your business.

Laws and regulations are often
encountered in daily life. In
addition, some business sectors
are responsible for compliance
with laws at the local or federal
level. Many of these laws, such
as paying taxes, are a familiar
routine. However, there can also
be occasions where navigating
the laws and regulations can seem
confusing or even overwhelming.

As a part of the animal industry, The AWA requires that basic treatment of warm-blooded
you may have heard of the Animal standards of care and treatment be animals, except those (such as
Welfare Act. But what exactly provided for certain animals bred farm animals) that are used for
is this? Why does it exist? And and sold for use as pets, used in food, fiber, or other agricultural
who does it apply to? Many biomedical research, transported purposes. Currently, coldblooded
individuals and businesses that commercially, or exhibited to the animals, such as snakes and
sell or adopt out dogs, exhibit public. Individuals who operate alligators, are exempt from
them to the public, transport facilities in these categories coverage under the Act. Animal
them commercially, or use them must provide their animals with shelters and pounds are regulated
in research must be licensed or adequate care and treatment in if they sell dogs or cats to dealers
registered under the Animal the areas of housing, handling, or research facilities. Pets
Welfare Act (AWA) by the United sanitation, nutrition, water, owned by private citizens are not
States Department of Agriculture veterinary care, and protection regulated.
(USDA). Let’s take a deeper look from extreme weather and AWA AND DOGS
at this law that can impact an temperatures. Although Federal The AWA and associated
animal-related business. requirements establish basic regulations require a USDA
THE LAW standards, regulated businesses license for anyone who (for
The Animal Welfare Act (AWA) are encouraged to exceed these compensation or profit) buys,
was originally passed by Congress standards. sells (including adoption), or
in 1966 and is implemented by the EXEMPTIONS negotiates the sale of dogs for
U.S. Department of Agriculture The AWA regulates the care and research, exhibition, or use as a
(USDA). The Animal Care (AC)
program of USDA’s Animal and
Plant Health Inspection Service
(APHIS) administers the AWA,
its regulations, and standards.

48 National Pet Directory | Fall 2020

pet; or for hunting, breeding, or situations where obtaining a the USDA Animal Care:
security purposes at the wholesale license is required. USDA Animal Care
level. Additionally, the AWA 2150 Centre Ave.
restricts the import of dogs for The USDA Animal Care program Building B, Mailstop 3W11
purposes of resale, prohibits dog- can be a useful resource to help Fort Collins, CO 80526-8117
fighting ventures, and provides navigate federal requirements Phone: (970) 494-7478
protections to prevent the theft of affecting dog owners. Having E-mail: [email protected]
pet dogs. an understanding of animal USDA Animal Care
Your specific activities involving related regulations will set your 920 Main Campus Drive, Suite 200
dogs (and other regulated business and your animals up for Raleigh, NC 27606-5210
animals) will determine the success. For additional questions Phone: (919) 855-7100
type of license. The chart below or detailed information about E-mail: [email protected]
provides common examples of becoming licensed, reach out to

USDA LICENSING

EXAMPLES WHEN A LICENSE IS REQUIRED EXAMPLES WHEN A LICENSE IS NOT REQUIRED

Wholesale sales of dogs for use as pets or for hunting, breeding or security Buying dogs solely for your own personal use and not selling or exhibiting them

Transferring dogs (and receiving any compensation) to another individual, Selling at retail (including adoption) dogs when the purchaser uses the dogs for
business, or organization for subsequent placement or adoption hunting, breeding or security purposes

Retail sales (including adoption) of dogs where the buyer, seller, and dog are not Retail sales (including adoptions) where the buyer, seller, and dog are physically
physically together in the same place so the person buying or acquiring the animal together in the same place so the buyer can observe the animal prior to purchase
cannot observe it prior to purchase or taking custody or taking custody

Sales (including adoption) of imported dogs where the buyer, seller, and dog are Maintaining a total of four or fewer breeding female dogs and selling (wholesale
not physically together in the same place so the buyer can observe the animal or retail) only the offspring of these dogs (born and raised on the business owner’s
prior to purchase or taking custody premises) for pets or exhibition

Exhibition of more than eight dogs Participating in dog races, field trials, coursing events, purebred dog shows, or fairs
or exhibitions intended to advance agricultural arts and sciences

This is not an exhaustive list. Additional situations do exist. For complete information contact USDA Animal Care.

King’s Pet LLC. IDENTIFY WITH Your Supplier for Raising
a Happy, Healthy Puppy!
COLOR!

3867 Old Phila. Pike, Gordonville, PA 17529 12 Pk. for $33.48, that’s only $2.79 each!
Store Hrs: Mon.-Wed: 8 - 4:30, Fri: 8-7
Sat: 8-12. Closed Thurs. & Sun. Call King’s Pet LLC (717) 614-9484 • KingsPetLLC.com • Follow us on

NEXT DAY DELIVERY

FOR ONLY $7 ($75 order), Bulk = $11

Classified successful breeding program. cost effective! 717-407-0750
Advertising Results with bacon flavored
Petandim include nicer pups, STUD
MISC no heart issues, no hernias, ACA Maltese Stud Service
Attention dog breeders! no luxating patellas & better Proven Aggressive $2 OBO
Healthy parents equals survival rate! First ever activator Boarding fee + $200 live pups
for dogs formulated to combat also EZS welder 22 x 30 for rent
oxidative stress damage! Very 484-798-7326

National Pet Directory | Fall 2020 49

SOMEWHERE BETWEEN THE

PASSION

AND THE

PAPERWORK IS A

PARTNER

TO HELP YOU ALONG THE WAY

MASTER LOGO

At Purina® Pro Club®, we understand that your dedication to breeding
exceptional dogs comes with the task of running a successful
program. With our free puppy kits, discounts on Purina nutrition,
one-on-one expert support and more, your hard work can go even
further. JOIN TODAY AT PURINAPROCLUB.COM.

Purina trademarks are owned by Société des Produits Nestlé S.A.

50 National Pet Directory | Fall 2020