The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by Salasiah Binti Mohd Taib, 2020-10-20 23:53:59

The Sun Daily 21_10_2020

The Sun Daily 21_10_2020

œ œ INSIDE
 

Vital to have staff page No Deepavali page
welfare-productivity bazaar in ‘Little
TELLING IT AS IT IS 2 4

balance India’ this year

ON WEDNESDAY OCTOBER 21, 2020

No. 7643 PP 2644/12/2012 (031195) www.thesundaily.my

RELIEF RUSH ... Residents
scooping water from an open tub

delivered to their flats in Batu
Caves, Selangor yesterday. The area

was among several in the state
that were affected by supply

disruption caused by the closure
of treatment plants due to river
contamination. – ASHRAF
SHAMSUL/THE SUN

DoE should do more
█ BY NICOLAS ANIL oProactive steps needed to prevent water consumers was similarly disrupted due to
[email protected] cuts due to dumping of pollutants into rivers, discharge of effluents into Sungai Gong.
say stakeholders Saral noted that following the previous cases
PETALING JAYA: The Department of of pollution, the Selangor Water Management
Environment (DoE) has to play a bigger board was to come up with measures to
role in addressing the issue of frequent monitor rivers for early detection of effluents.
water disruptions in the Klang Valley. She pointed out that drones were only useful
Stakeholders are of the view that it should in detecting coloured discharge but other types
take more proactive steps to put a stop to the of sensors are needed to uncover colourless
dumping of pollutants in rivers. authorities have yet to learn from similar immediately,” she told theSun. effluents.
occurrences previously. On Sunday, water supply to more than 1.2 Saral also expressed hope that owners of
They also stress that the department should factories be educated on ways to
beef up enforcement of waste management Its president, Saral James Maniam, noted million households in the Klang Valley had to keep rivers clean.
rules to prevent further deterioration of the that all the Selangor government did was be cut after the discovery of pollutants in Sungai “Some of these factories Turn to
nation’s water resources. instruct the owners of illegal factories to legalise Selangor. The areas affected included Kuala continue to dump waste into the
their operations. Lumpur, Petaling Jaya, Shah Alam, Gombak —
The Malaysian Water Forum is of the view and Kuala Selangor.
that the latest incident of pollutants being “This is where DoE should step in and river because the owners are not page 3
discharged into Sungai Selangor shows that the ensure that such illegal activities are stopped Just last month, water supply to millions of aware of the implications or they

Public Bank Rewards you in your Golden Years

Open a new 50SA with initial deposit of RM500 or Top-up RM8 Cash Reward for each category when you perform the following:
RM500 in existing 50SA and participate in 50FD
to enjoy promotional FD rates. Registration 3 DuitNow Transactions 3 Bill Payments and/or JomPAY.

2.10%p.a. 2.20%p.a. 2.30%p.a. Sign up for Will & Wasiat Writing Services
at a promotional fee.
3-month tenure 6-month tenure 9-month tenure

Minimum placement: RM5,000 / Maximum placement: RM5,000,000

Enjoy monthly interest payment

Promotion Period: 1 October 2020 to 31 January 2021

PUBLIC BANK BERHAD 196501000672 (6463-H)

• Eligible products / services: 50 PLUS Savings Account (50SA), PB Golden 50 PLUS Fixed Deposit (50FD) and Will & Wasiat Writing Services • Valid for new and existing 50SA and 50FD accountholders aged 50 years old and above • Fresh Funds only. Fresh Funds refer to funds that do not originate from any existing deposit accounts of the Eligible Participants maintained
with Public Bank Berhad (PBB) / Public Islamic Bank Berhad (PIBB) • The Eligible Participant is required to open a 50SA with initial opening deposit of RM500 (new account holders) or top-up RM500 in the 50SA (existing 50SA account holders) and allow the said deposit amount to be earmarked for 4 months in order to be eligible for placement into the 50FD under the
Campaign • Protected by PIDM up to RM250,000 for each depositor • Terms and conditions apply. 50SA: • The earmarking is to be made at the Account Holding Branch • The Eligible Participant is required to prematurely withdraw the 50FD placement should he/she performed an early upliftment / cancellation of the earmarked amount in the 50SA. 50FD: • The promotional
interest rate for 50FD is applicable for one (1) cycle only. Upon maturity, the 50FD will be automatically renewed at PBB’s 50FD prevailing board rate for the same tenure • Interest is calculated on the actual number of days • The promotional interest rate is fixed upon participation / placement • The 50FD interest will be credited into Eligible Participant’s 50SA on monthly
basis • In the event that the Eligible Participant withdraws the 50FD placement prematurely, he/she will not be entitled to enjoy any interest • Partial withdrawal of the 50FD placement is not allowed. Cash Reward: RM8 Cash Reward will be given to the first 1,000 Eligible Participant per category per month throughout the Campaign Period when they perform the following
categories, i.e. PBe Registration or 3 DuitNow Transactions or 3 Bill Payments and/or JomPAY• Each Eligible Participant is eligible to win one (1) cash reward under each category throughout the Campaign Period. Will & Wasiat Writing Services: • The Eligible Participant will be eligible for promotional fee when signing-up for Will & Wasiat Writing Services with PB Trustee Services Berhad

2 theSUN ON WEDNESDAY | OCTOBER 21, 2020
NEWS WITHOUT BORDERS

Council for statistical Work-life balance
system gets approval paramount, says MTUC

KUALA LUMPUR: The national sometimes vary.
statistical system needs to be “The granular administrative
strengthened to ensure that data is important for the
existing data is coordinated and government, hence, it will be
can be used by the government able to reduce dependency on
to formulate policies or make primary data collated via census
decisions. or survey. o‘With working from home the current “Employees cannot be treated like
Minister in the Prime “Indirectly, the usage of norm, employers should not issue orders cattle. In the modern employment
Minister’s Department secondary data can reduce costs after duty hours’ relationship, mutual respect is
(Economy) Datuk Seri Mustapa on data collection.” important whereby an employer
Mohamed said the Cabinet on Mustapa said the Cabinet had should respect employees’ rights.”
Sept 9 approved the also agreed to give a bigger role to
establishment of a National the Department of Statistics Lawyer Xenia Z. C. Lok said the use
Statistics and Data Council to (DOS) as the central agency in of WhatsApp as a means of work-
serve as the highest advisory coordinating the national █ BY ELLY FAZANIZA work more than five consecutive related communication is reasonable.
body to provide direction for the statistical system. [email protected] hours without a resting period of at
national statistical system and A National Data Highway PETALING JAYA: Employers must be least 30 minutes and not more than “Issuing work orders after working
coordinate information. Analytic Centre will be set up attentive to the wellbeing of eight hours in a day. hours for actions to be taken when an
“This is suitable for cultivating with the cooperation of DOS, the employees while ensuring that employee resumes duty should be
a culture of decision-making Malaysian Administrative maximum productivity is achieved. Abdul Halim added that employees acceptable, especially when the nature
based on facts,” he said at the Modernisation and Management need to be mindful of “perks” provided of work is providing essential services
opening ceremony of the Planning Unit, and the ministries With work-from-home being in their contracts signed upon or resolving emergencies,” she said.
National and World Statistics involved, to ensure that planning widely adopted, many employees employment.
Day celebration and the Malaysia and decision-making processes have voiced grievances that work has “But constant work orders that
Statistics Conference 2020 are based on analyses in line with affected their personal lives. “Can the company pay overtime for demand employees’ immediate
yesterday. digital initiatives. non-executives, as these allowances attention during personal time is
He said existing data today is The improvement in the Malaysian Trades Union Congress are for those in the management level? unacceptable, and gives rise to abuse.
“all over the place” while the national statistical system will (MTUC) president Datuk Abdul Halim This must be spelt out explicitly in
methodology, standards, bring a positive impact, he Mansor said an employer cannot use their employment contract. “If everything has been made clear
concept and definition added. – Bernama social media apps to issue work orders by both parties before the relationship
after an employee has clocked off. “If these are not mentioned in the starts, then disputes can well be
China remains nation’s largest contract, an employee is not obliged to avoided. The Act governing
FDI contributor “This is where employers need to reply to the employer.” employment should not be made too
respect work etiquette and set clear rigid in this sense.”
KUALA LUMPUR: China has August, while in 2019, the two- professional boundaries. It’s Meanwhile, labour lawyer
been Malaysia’s largest foreign way trade hit US$76 billion. important to see this as a human rights S. Muhendaran said employees According to blog.flock.com,
investor in the manufacturing matter that can cause undue stress for should be able to spend time with France and Italy have implemented a
“Despite the current Covid-19 employees,” he told theSun yesterday. their families “unless the issue is a life “right to disconnect” law that bans
pandemic, Malaysia and China or death matter, and has to be done after-hours emails.
continued to show sincere Citing section 60A (1) of the urgently”.
friendship to support each other Employment Act 1995, he said an Germany has been considering an
and overcome difficulties employee shall not be required to He added that the Human “anti-stress” legislation, while a Right
together in these trying times. Resources Ministry should take the to Disconnect Bill is being considered
lead to amend the Act. by the Lower House of the Indian
“I hope the corporate elites Parliament.
from both countries will
sector for four consecutive years continue to collaborate in sectors Creative industry needs help to boost GDP contribution
since 2016, with 32 foreign direct such as digital economy big data,
investments (FDI). innovative economy, as well as
The FDI amounted to industrial innovation and
US$452.43million (RM1.9 modern agriculture,” he said KUALA LUMPUR: Malaysia’s employment dropped to 5.7%, He said the creative industry
billion), approved in the first six when delivering his keynote creative industry needs more support according to chief statistician Datuk accounted for only 859,900 people
months of 2020. address at the 10th Malaysia- to help raise its economic Seri Dr Mohd Uzir Mahidin. employed in 2019 out of a total
Deputy International Trade China Entrepreneurs Conference contribution. working population of 15.1 million.
and Industry Minister Datuk Lim 2020 held virtually yesterday. “All the main indicators show that
Ban Hong said Malaysia Data from the Department of the creative industry contributes very The main contributions of the
approved 79 FDI worth US$3.74 Statistics shows that it has recorded little to the Malaysian economy,” he creative industry by classification
billion from China last year. the same level of contribution to said yesterday in a virtual were multimedia with 50.7%, closely
In terms of total trade, he said gross domestic product (GDP) presentation titled “Overview of the followed by culture and art at 49.2%.
the bilateral trade between growth in the last five years. Arts and Culture Sector of Malaysia
Malaysia and China stood at and its Future Outlook” at the Mohd Uzir said at the global level,
US$48.47 billion from January to Exports from this sector Creative Economy Forum 2021: the creative economy continues to
contributed only 0.2% to GDP growth Focus on Arts and Culture. make a significant contribution to
last year while its contribution to world trade. – Bernama

Sarawak formulating new policy to fulfil green agenda KUCHING: The Sarawak organisations for planning to
government has engaged have the twin towers achieve
Abang Johari (back, left) at the groundbreaking ceremony yesterday. – BERNAMAPIX several academicians and green building status upon
professionals to devise a new completion, adding that it
policy on state forestry would be in line with the state
matters as part of its efforts to government’s development
fulfil its environmental approach until 2030.
sustainability agenda. Abang Johari said the
development, carried out in
Chief Minister Datuk the city’s prime area, would
Abang Johari Abang Openg be very significant to portray
said yesterday the experts the Dayak community’s
engaged were currently achievements in Sarawak, as
deliberating on a new well as to reflect the state
approach to develop the government’s inclusive
forestry sector. policy.
With the three major races
“Our next development of Dayak, Malay-Melanau
agenda up to 2030 will be and Chinese having almost
through the core the same proportion in
development of a digital Sarawak’s population, the
economy and environmental state government would have
sustainability. We want to to adopt a common platform
protect our environment and to ensure all communities get
we are going to have a new equal opportunities, he
policy on forestry, with the added.
hope that we can also claim “We know that no one
carbon credits.” community can rule the state.
It must be the collective
He was speaking at the responsibility of all
ground-breaking ceremony communities to develop it
for the development of and this will be my political
Panggau Dayak Towers, a platform. We cannot stray
twin 10-storey building from that. Therefore, the
project by the Dayak Cultural approach of inclusivity must
Foundation and Dayak be there.” – Bernama
Chamber of Commerce and
Industry.

He lauded the two Dayak

3theSUN ON WEDNESDAY | OCTOBER 21, 2020
NEWS WITHOUT BORDERS

E-payment options catching on

o Even stall traders their lunch or dinner in cash. Instead, they whip of efforts to help businesses and the economy Ong said.
adopting system in line with out their smartphones when given the bill, and recover from the fallout of the Covid-19 For Raziq, the change to online payment has
Covid SOP and to widen transfer the required sum of money to his bank pandemic, TNG Digital Sdn Bhd chief executive
customer base account. Ignatius Ong told theSun. been a boon. Now, 80% of his customers prefer
to pay online rather than in cash. His next move
█ BY HAKEM HASSAN Mohamed Nakhoe Saidin, who runs a TNG is the company behind the Touch ‘n Go is to adopt the e-wallet system to give his
[email protected] burger stall in SS19, Subang Jaya, has taken it a eWallet. customers more payment options to widen his
PETALING JAYA: Abdullah Raziq Zulkofili runs step further. He accepts payment through customer base.
a fairly good business selling roast chicken rice Touch ‘n Go eWallet and Maybank’s QR pay. He noted that 98.5% of all business
at a stall in Mutiara Damansara here. establishments in Malaysia now are small and “After all, with Covid-19 still in their air, using
Raziq and Nakhoe belong to a new breed of medium enterprises, and more of them are cash can be dangerous,” he said.
However, very few of his customers pay for small entrepreneurs who have taken the digital looking to accept cashless payment for
route to meet younger customers’ demand for purchases. For Nakhoe, most young and middle age
an easier yet safe payment system. customers prefer to use e-wallets to pay for their
Eventually, carrying a smart device rather purchases but the elderly continue to put their
As the Covid-19 pandemic forces people to than cash will be a key feature in our lives as trust in cash.
keep their distance and avoid personal contact, more merchants go on board the e-wallet
this new way to pay has moved from vogue to wagon. “Perhaps they have not been exposed to it or
necessity. do not know how to use it,” he said.
Touch ‘n Go eWallet alone has more than
In fact, the e-wallets have become the focus 250,000 merchants on its list of business users, Nonetheless, he believes Malaysia will
eventually be a largely cashless society.

Awareness, SUCH INCONVENIENCE ... Loan repayment
stern action Nur Natasha Balqis Abdul Qudus assistance to
needed waiting for her turn to collect remain: BNM
water from a relief tanker at a
residential estate in Batu Caves, PETALING JAYA: Bank Negara Malaysia
Selangor yesterday. (BNM) has issued an assurance that loan
– ASHRAF SHAMSUL/THESUN repayment assistance will remain available
for borrowers whose incomes have been
do not know where else to dispose of the affected by the Covid-19 pandemic.
waste,” she said.
“If they are legal, they would have “Borrowers who decline repayment
their own water treatment assistance for now, would still be able to
plant or third parties to do apply for targeted assistance throughout
From it for them.” 2020 and into 2021 if their financial
front circumstances change in future,” BNM said in
page “Setting up a factory a statement.
lawfully would have
entailed going through It will offer assistance to borrowers across
state and environmental a range of income groups, with special
agencies to get their approvals,” she consideration given to households from the
pointed out. B40 category, micro businesses as well as
Saral said apart from educating borrowers affected by movement
factory operators about the damage that restrictions.
can be caused by discharging pollutants
in rivers, stern action should also be “A targeted approach to repayment
taken and fines be based on their profits. assistance extends relief measures more
Klang MP Charles Santiago said it is sustainably, while lending strength to the
the role of DoE to ensure that economic recovery,” the central bank said.
companies adhere to the schedule on
waste management. “Many borrowers are now able and have
Santiago, who is also chairman of the started to resume repayments. For this
Asean Parliamentarians for Human group, resuming repayments would be in
Rights, said this would ensure that the their interest as this would reduce the overall
authorities know “where the waste is cost of borrowings. If their financial
going and who is disposing it”. circumstances change down the road,
But he also acknowledged that DoE targeted repayment assistance would still be
would have to beef up its ranks to carry available.
out these tasks.
“I would like to see an initiative to “Borrowers, who require assistance at this
have a river protection authority. We time, have the opportunity to customise
should have a buffer on both sides of the their repayment plans based on what they
river where no commercial or other can afford. If their circumstances are further
activities are permitted and this should challenged in future, they would have more
be monitored under national security recent repayment records to facilitate further
rules,” he said. assistance by banks.”
On the water disruption issue, he
said the government should get the As of Oct 9, BNM has received more than
factories along the river banks to 640,000 applications for repayment
relocate fast. assistance, with an approval rate of around
“We are losing billions and people 98%. These consists mainly of individuals
are pushed to the edge. The state who have been made unemployed, as well
government should also form an as businesses in sectors that may be still
independent high level committee to experiencing significant operating
look into this,” he added. constraints caused by the pandemic.

There has also been a 40% extension of
the moratorium, with a 60% reduction in
instalments, including those in the B40
group.

IMPACT OF COVID-19 ON theSunGraphics© - Magenan Plan to allow students to stay at hostels
PHYSICAL ACTIVITIES
PUTRAJAYA: The Education Ministry is and more conducive for learning.
o While 55% of Malaysians consider health and personal considering housing Sabah students who are He said limited access to the internet as
sitting for examinations at hostels, Senior
well-being as the key to happiness, the enthusiasm for daily Minister (Education) Dr Radzi Jidin said well as the lack of devices to conduct online
physical activities has faded with rising concern for personal yesterday. learning were also a factors affecting students,
safety as a result of the Covid-19 pandemic. especially those in rural and remote areas.
He said the accommodation would be for
o This is how we measure up compared with the rest of students whose schools have been closed “However, teachers have done their best by
South East Asia. because of the Covid-19 pandemic. providing modules for students who do not
11% No physical activities have internet facilities and devices, especially
16% 9% 20% Less physical This is because parents in Sabah want for those sitting for exams, to enable them to
activities than usual their children sitting for the Sijil Pelajaran revise at home.”
28% 47% 30% 39% Malaysia (SPM) and Sijil Tinggi Pelajaran
No change Malaysia (STPM) examinations to undergo On the closure of schools, Radzi said the
More physical face-to-face learning sessions with decision was made on the advice of the
activities teachers, he told a press conference yesterday. Health Ministry based on the Covid situation.
According to him, although students living
Malaysia South East Asia Source: Ipsos study conducted From Sept 18 to Sept 22, 2020 among in hostels in Sabah have been allowed to “We will abide by the Health Ministry’s
3,000 adults aged 18 and above. (500 interviewees per country). return to their homes following the instructions and for now, schools that have to
implementation of the conditional movement close are those in red zone areas and where
control order (CMCO), most parents wanted positive cases have been recorded.”
them to stay at the hostel because it was safer
He added that 2,601 schools have been
were temporarily closed, involving 1.67 million
students. – Bernama

4 theSUN ON WEDNESDAY | OCTOBER 21, 2020 BRIEFS ANOTHER PERAK
NEWS WITHOUT BORDERS SCHOOL TO CLOSE

One million staff ordered IPOH: Sekolah Menengah Kebangsaan
to work from home (SMK) Raja Lope Nor Rashid in Tanjung
Piandang, Parit Buntar, will be closed
o National Security Council issues directive on new SOP, The offences include not practising physical for seven days from yesterday due to a
with staff living in red zones also required to undergo testing distancing (167), not wearing face masks (159), Covid-19 case detected at the school,
failure to provide screening equipment (58) said Perak Education director Dr Mohd
█ BY NICOLAS ANIL situation in these areas. and other violations (76). Suhaimi Mohamed Ali. The school will
[email protected] “However, there will be some exceptions for reopen on Oct 27. “The closure is to
PETALING JAYA: One million Malaysians There were also 57 illegal immigrants arrested, enable cleaning and disinfection
working in management and supervisory jobs that require workers to be in the office like along with four vehicles seized. works to be carried out by the Health
positions in Kuala Lumpur, Putrajaya, Labuan, those involved in the finance, enforcement and Ministry,”he said in a notice which was
Selangor and Sabah have been issued a welfare sectors.” As of Oct 19, a total of 51,720 individuals uploaded on the Perak Education
directive from the National Security Council to have returned home from overseas. Department official Facebook page.
work from home starting tomorrow until the He added that employers must issue work The closure of SMK Raja Lope Nor
conditional movement control order (CMCO) travel documents for staff who are required to Of those, 8,441 are undergoing mandatory Rashid brings the number of schools
is lifted. work in the office. quarantine, 381 were taken to hospitals for in Perak that have been closed due to
treatment while 42,898 were discharged and Covid-19 to five. – Bernama
Senior Minister (Defence) Datuk Seri Ismail Workers living in red zones must also allowed to return home.
Sabri Yaakob confirmed this after a special undergo swab testing and the cost will be PRIORITISE THE PEOPLE,
meeting chaired by Prime Minister Tan Sri covered if their employers are registered with Meanwhile, Kampung Saguking Laut and MUFTI TELLS POLITICIANS
Muhyiddin Yassin on the ongoing Covid-19 the Social Security Organisation. Kampung Sebor Baru comprising 8,062
villagers in Labuan, Sabah will be placed under KANGAR: Perlis mufti Datuk Dr Mohd
Meanwhile, Ismail Sabri said a total 460 an enhanced movement control order from Asri Zainul Abidin has called on
individuals were arrested yesterday for various today until Nov 3. politicians to prioritise the interests
offences and 440 of those were issued compounds. of the people, especially those who
There will also be a makeshift treatment are affected by Covid-19. Mohd Asri
centre at the Kepayan Prison in Kota Kinabalu said the basis of politics is to look
in light of the increasing Covid-19 cases in the after the interests of all the people,
prison. especially during the pandemic,
adding that politicians should not
add to the people’s burden with
political issues such as power tussles.
– Bernama

Number of
infections still
high, 862 cases

PETALING JAYA: There was a slight dip in the Malacca cancels Deepavali bazaar KEEPING THEM SAFE ...
number of new Covid-19 cases yesterday when A firefighter carrying out
862 cases were detected compared with 865 the MALACCA: There will be no Deepavali bazaar programmes at Jalan Bendahara this year sanitisation works yesterday at
previous day. This brings the total number of held in conjunction with the festival at Little because the safety and health of the people Sekolah Rendah Agama Taman
active cases in the country to 7,681. India in Malacca this year in view of the is a priority. We do not want to create new Sri Andalas, which is in a red
Covid-19 pandemic. clusters in the wake of Deepavali. zone in Klang, Selangor.
“The majority of cases are still originating – ASYRAF RASID/THE SUN
from Sabah, as 673 cases or 78.1% of the cases The state chief minister’s secretary “However, existing shops in the area can these bazaar traders to ease their burden,
were from there,” Health Director-General Tan (Public Affairs) Datuk M.S. Mahadevan said operate as usual but traders must follow the especially families in need,” said
Sri Dr Noor Hisham Abdullah said in a live the decision was reached after discussions standard operating procedures set,” he said Mahadevan, who is also Malacca MIC
press conference yesterday . with the Malacca Health Department, yesterday. chairman.
Historical Malacca City Council and According to him, an average of 30 traders
Three deaths were reported, all in Sabah, representatives of the bazaar traders on In the meantime, Mahadevan suggested are involved in the Deepavali bazaar at Little
involving two women and a man, who were Friday and Monday, taking into account the bazaar traders conduct their business India every year, held for two weeks before
aged between 59 an 90. current situation. online, or at their respective premises and the festival.
residences, including using delivery Hindus will celebrate Deepavali on Nov
All of them had a history of medical “We decided there will be no Deepavali services. 14 this year.
problems, including high blood pressure and bazaar as well as stage and cultural According to Health Department records,
heart disease. “The state government will try to help Malacca recorded 299 positive Covid-19
cases to date, including 16 new cases that
The death toll has now risen to 193, which is were detected on Monday. – Bernama
0.87% of the total number of cases.

The Kepayan prison and Tembok clusters
accounted for 235 cases (27.3%).

“These cases are all within prisons and are
not community infections,” Noor Hisham said.

Of the total, only two were imported cases
involving a Malaysian returning from Egypt and
a foreigner from Indonesia.

Selangor recorded 132 new cases yesterday
followed by Kedah, with 17.

Perak, Penang, Labuan, Negri Sembilan,
Kuala Lumpur, Putrajaya, Johor and Kelantan
all recorded fewer than 10 cases each.

Meanwhile, 634 patients have been
discharged from hospital, bringing the total
number of recoveries to 14,351 cases.

Noor Hisham added that 95 patients are in
intensive care units with 29 requiring ventilator
assistance.

One new cluster, known as the Kertang
cluster, has been detected in Kota Belud,
Sabah.

The index case was found positive on Oct 14
and was admitted to a quarantine and
treatment centre in Kota Belud.

A total of 216 individuals in the cluster were
tested and 21 positive cases have been
reported.

Council launches ‘immediate action plan’ to fight Covid

BUKIT MERTAJAM: The Seberang of a new Covid-19 cluster, the Alma Covid-19 in Seberang Perai. said on the MPSB Facebook page. MBSP will also make the
Perai City Council (MBSP) has cluster, in Penang two days ago. They included increasing the He also said MBSP would MySejahtera application
taken proactive measures by compulsory for traders and visitors
enhancing its monitoring to ensure Mayor Datuk Rozali Mohamud number of staff to four or five enhance perimeter monitoring at at the MBSP public market and
compliance with standard said in line with the announcement people daily, from only two the public market and hawker hawker complex to avoid
operating procedures (SOP) by by the Health Ministry on the Alma previously, to monitor and conduct complex to ensure the premises customers providing false
residents in areas under its cluster on Oct 18, MBSP has body temperature scanning of only has one entry point and one personal formation and telephone
jurisdiction following the detection outlined eight “Immediate Action visitors at the public market and exit point to facilitate visitor numbers, he added. – Bernama
Plans” to curb the spread of also the MBSP hawker complex ,” he registration.

5theSUN ON WEDNESDAY | OCTOBER 21, 2020
NEWS WITHOUT BORDERS

‘Spare the rod and teach the child’

o No perfect model to parenting but abuse, never laid a hand on me. All I got was ineffective, could be physically and teach both parents and children to
neglect and violence can be ineffective: Expert a tongue-lashing,” she told theSun. mentally damaging to a child. handle disagreements and conflicts
without abuse, neglect and violence,”
█ BY SHIVANI SUPRAMANI to “scare the daylights out of me”. But Nur Ashini’s parents were “Parenting is a process, a journey Charanjit said.
[email protected] The belief then was that corporal unlike their peers. In an era when a in which you may have to reflect on
PETALING JAYA: Spare the rod and whack on the rear was the way to go, the methods (of disciplining a child) Dr Arman I. Rashid, who heads
spoil the child was the mantra punishment would make a child a they subscribed to the belief that adopted.” children’s helpline provider Buddy
parents of the previous generation better person in future. Very few hitting a child was wrong, especially Bear, said parents need to be
swore by. children who were subjected to such for daughters. She said the traditional method of adaptive, sensitive and empowering
harsh punishment developed “authoritative parenting” used to be to meet the needs of today’s children.
For them, there was no better way emotional problems later in life, “Apart from the physical damage, seen as the most effective.
to instil discipline in a child than to despite an expert’s view that such my parents also did not want me to “They must recognise both the
wield the cane or “rotan” or, if mother children are more prone to violence grow up thinking it was normal to be “However, many younger parents emotional and physical needs of their
and child happened to be in the later in life. hit.” are adopting combinations of new children and this requires them to
kitchen together, the spatula was a parenting models such as inculcating acknowledge that the children’s
convenient option. As one person pointed out, it was This, she said, had taught her not family values and emphasising on emotions are important and that they
acceptable because her mother also to associate pain with discipline, and belief systems to guide their matter.”
As one person who grew up in that explained why she was being to be brave and emphatic, two decisions,” she said.
era recalls, the sight of her mother punished. qualities she learned while growing He said children who have
whipping out the rotan was enough up. The belief is that it would help to experienced corporal punishment
Nur Ashini Ridzuan is a product of nurture good behaviour in children are at a higher risk of being
the new parenting style. “My parents For the experts, neither way is the and build closer ties between parent perpetrators of domestic violence in
right or wrong way. Sociologist Dr and child, thereby meeting the entire adulthood. “It is evident from
Charanjit Kaur believes there is no family’s needs. research that such punishment does
perfect parenting style and also not bring any long-term benefit.”
concedes that strict parenting, while Modelled on flexibility and
adaptability, healthy parenting can

‘Irish teen’s JAIL TIME... Kan Hong Kit, 33 (in pink) who punched a firefighter who was trying to douse his Woman seeks non-
body found on burning car in Cheras last week, was sentenced to six months’ jail and fined RM6,000 by two Muslim declaration
second search’ magistrate’s courts in Kajang yesterday after he pleaded guilty to two counts of obstructing a
public servant and driving recklessly. – BERNAMAPIX PUTRAJAYA: The Federal Court has fixed Dec
SEREMBAN: The search and rescue (SAR) 16 to hear a woman’s appeal to be declared a
team deployed to look for Nora Anne Quorin Contractor duped in 4WD sale scam non-Muslim. Rosliza Ibrahim, 38, who was born
failed to locate signs of her whereabouts to a Muslim father but raised as a Buddhist by
during their initial search. KUANTAN: A contractor’s hopes of owning “The man later called the victim again her Buddhist mother, is seeking a declaration
a low-priced Ford Ranger was dashed when and asked him to pay another RM11,912 as that she is a Buddhist and not a Muslim.
The Irish-French teenager’s body was he failed to get delivery of the four-wheel advance payment, and to cover the cost of
only recovered when they returned to drive (4WD) vehicle as promised after road tax and insurance as well as the transfer The date was fixed after the matter came up
conduct another search in the same area a paying more than RM14,000. of ownership fee,” he said. for case management yesterday via E-review
few days later, the coroner’s court heard before deputy registrar Azniza Mohd Ali.
yesterday. Pahang Commercial Crime Investigation The victim transferred the money to a
Department head Supt Mohd Wazir Mohd given bank account in two separate Senior federal counsel Shamsul Bolhassan
Insp Hor Ming Jai, 30, from the General Yusof said the 53-year-old contractor saw a transactions on Oct 6 and Oct 7. confirmed the new hearing date. The Attorney-
Operations Force (GOF) in Semenyih, post on Facebook offering the vehicle for General’s Chambers (AGC) is appearing on
Selangor, said the team entered two search sale on Oct 3 for RM36,000. Wazir said the victim was then told that behalf of the government as amicus curiae
zones, marked as “zone five” and “zone six” the vehicle would be towed to his home in (friend of the court) in the appeal.
on Aug 7 and 8 last year, but did not find any Wazir said the victim contacted a man on Pekan and was given the phone number of a
indication of the teenager’s whereabouts. WhatsApp through a phone number given tow truck driver. Rosliza’s appeal was initially scheduled to be
in the post two days later, and was asked to heard before a nine-member bench chaired by
Nora Anne’s body was found in the area pay a deposit of RM2,500. However, the delivery was never made Chief Justice Tun Tengku Maimun Tuan Mat on
marked “zone six” on Aug 13, 2019. and realising that he had been duped, the Oct 6. It was postponed as a member of the
He was also asked to send copies of his contractor lodged a police report on Selangor Islamic Religious Council’s (Mais)
“On Aug 7 and 8, we were the first team to personal documents and bank statement. Monday. – Bernama legal team was quarantined after being in close
enter the zone and no indication (of the contact with a minister who tested positive for
teenager’s whereabouts) was obtained on Covid-19.
both days,” Hor, who is the 22nd witness, said
when testifying in the inquest to determine Lawyer Aston Paiva represented Rosliza
the cause of Nora Anne’s death, before while Selangor assistant legal adviser Siti
Coroner Maimoonah Aid. Fatimah Talib acted for the Selangor
Coroner: Is it easy to walk barefoot in the government, and federal counsel
area? M. Kogilambigai for the AGC. Lawyer Azman
Hor: Difficult. Marsallah represented Mais.
Coroner: Can you describe the condition in
the area? In her originating summons filed in 2015,
Hor: There are narrow trails with steep slopes Rosliza sought for a declaration that she was not
and undergrowth on the left. We did not go in a Muslim and therefore, the Syariah Court had
there but made observations of the area. no jurisdiction over her as she claimed that
she was born out of wedlock. The Shah Alam
To a question by lawyer S. Sakthyvell, High Court ruled against her on June 22, 2017
representing the teenager’s family, who and her appeal at the Court of Appeal was
wanted to know if he noticed any footprints also dismissed on April 25, 2018. On Jan 20,
in an area near a stream, Hor said he did not. the Federal Court granted Rosliza leave to
appeal. – Bernama
“It is a bushy area and if anything passes
through, the undergrowth will split and since Police probe pollution
there was no split in the bushes, we did not of Sungai Selangor
enter the area, that’s the technique,” he said,
adding that the SAR on Aug 8 focused on the KUALA LUMPUR: Police have launched an
area along the stream, where no lead on the investigation into allegations of pollution in
girl’s presence was found. Sungai Selangor. They will be assisted by
Lembaga Urus Air Selangor and the Department
Earlier, three witnesses, consisting DSP of Environment, Selangor police chief Datuk
Hamzah Abd Rani, 49, of the VAT 69 Noor Azam Jamaludin said yesterday.
commando police team, as well as Insp
Khairul Marwan Kahar, 29, and Insp B. Sathia The pollution that left an odour in the water
Balan, both from the 3rd Battalion GOF in resulted in supply disruption to 1.2 million
Semenyih, were called to testify as the 20th, account holders or almost five million
21st and 22nd witnesses respectively. consumers in the Klang Valley since Monday.

The inquest is being conducted by deputy Noor Azam said the investigation is still in the
public prosecutor Ahmad Sazali Omar. early stage and water samples have been sent for
analyses.
Nora Anne, 15, went missing on Aug 4 last
year, a day after she and her family arrived in “The process takes time and requires the
Malaysia for a two-week holiday at a resort in assistance of experts and forensics. Stern action
Pantai, about 60km from Kuala Lumpur. will be taken against those responsible for
causing the pollution,” he told Bernama.
Her body was found on Aug 13, near a
stream about 2.5km from the resort following Yesterday, Environment and Water Minister
a massive search. Datuk Seri Tuan Ibrahim Tuan Man said
operations at Phases 1, 2 and 3 of the Sungai
A preliminary post-mortem report Selangor water treatment plants and Rantau
revealed there were no criminal elements in Panjang treatment plant were suspended.
Nora Anne’s death and that the teenager had
died of gastrointestinal bleeding, due to He said the ministry had identified several
prolonged stress and hunger. industrial areas as the probable source of
the pollution.
The proceeding continues. – Bernama

6 theSUN ON WEDNESDAY | OCTOBER 21, 2020 BRIEFS TURKEY’S DAILY
NEWS WITHOUT BORDERS PATIENTS TOP 2,000

Three billion could be ISTANBUL: Turkey’s daily
deprived of Covid vaccine number of new coronavirus
cases surpassed 2,000 on
BERLIN: Three billion people could o Lack of refrigeration facilities in some development phases. Monday, reaching levels last
miss out on a coronavirus vaccine countries not conducive for immunisation plan “This poses novel logistics seen in early May when
because of storage issues, with some restrictions on businesses and
of the poorest people on the planet Despite efforts to help developing systems lack the resources to carry challenges to the existing medical households were in place. Data
most at risk of being left behind. countries maintain the so-called out large-scale testing. supply chain that conventionally from the Health Ministry
vaccine “cold chain”, nearly three distributes vaccines at 2–8⁰C,” the showed another 2,026 people
Experts have warned that among billion people in the world live in Medical freezers that go down to company said. with Covid-19 symptoms had
the problems facing vaccine areas where temperature-controlled minus 70⁰C are rare even in US and been diagnosed, as Ankara
distribution teams is that large parts storage would be insufficient for an European hospitals. Billions of people live in countries continues to report only
of the world do not have the immunisation campaign to get that do not have the necessary symptomatic cases. The
refrigeration capacities needed. coronavirus under control. For more than two-thirds of the infrastructure to maintain the cold ministry changed the wording
world, however, the advanced chain for either existing vaccines or on its daily reports from “cases”
This includes most of Central Asia, The vaccine cold chain hurdle is technology is nowhere on the more conventional coronavirus to “patients” on July 29. Health
much of India and southeast Asia, just the latest disparity of the horizon, according to a study by candidates, their study said. Minister Fahrettin Koca said
Latin America except for the largest pandemic weighted against the poor, German logistics company DHL. the daily number includes only
countries, and all but a tiny corner of who more often live and work in The Covax Facility project, led by those who show symptoms.
Africa. crowded conditions that allow the DHL said some eventual Covid-19 the World Health Organisation The ministry had said earlier
virus to spread, and whose health vaccines may need stringent among others, was established this that 1,958 patients were
The world’s most promising temperature requirements, up to year to procure and equitably diagnosed on Monday but
coronavirus vaccines would need -80⁰C, given they have leapfrogged distribute vaccines between member later updated the data. The
non-stop sterile refrigeration from nations. The project aims to deliver total number of patients stood
factory to syringe for them to stay coronavirus vaccines to the world’s at 349,519 as of Monday, the
potent and safe. poorest people. – The Independent data showed. – Reuters

Belgium extends UNCOMFORTABLE TASK ... MORE RESTRICTIVE
curfew to allow A health worker collects a swab STEPS TO BE IMPOSED
‘toilet routine’
for dogs sample from a resident to test ROME: Italy’s northern
for the Covid-19 coronavirus at a Lombardy region prepared
yesterday to impose a
testing centre in New Delhi on nighttime curfew, the most
Monday. – AFPPIX restrictive anti-coronavirus
measure the country has seen
BRUSSELS: Belgium’s government, since emerging from a national
struggling to contain what has been lockdown in the spring. The
described as “close to a tsunami” of curfew, from 11pm to 5am, is
new coronavirus cases, has decided expected to begin tomorrow
to push back curfew by an hour so night and last to Nov 13. Health
that people can walk their dogs. Minister Roberto Speranza
gave his consent late Monday
It just took one member of a to the more restrictive measure
government coronavirus committee proposed by the regional
to point out that dogs need time for government, after hours-long
their late-night toilet routines. “You meeting. “It’s an appropriate
have to think about people walking and symbolically important
their dogs after 11pm, you have to initiative that shouldn’t have
give them a little time,” he said. particularly serious economic
consequences,“ Regional
The committee, reported Le Soir President Attilio Fontana said
newspaper, was persuaded, and the in La Repubblica yesterday.
curfew was amended. – AFP

One in 10 Belgians is a proud UK researchers plan to infect healthy IRELAND RETURNS
pooch owner. Cafes, pubs and volunteers to study virus exposure TO LOCKDOWN
restaurants usually allow canine
companions to sit with their owners. DUBLIN: Ireland will go into
national lockdown for a
The decision to extend a curfew to second time in a bid to curb
later than other countries comes as the spread of Covid-19. The
Belgium, like others, battles with the Irish government agreed to
latest wave of the pandemic. impose the highest level of
restrictions across the country
One minister, Frank for six weeks from midnight
Vandenbroucke, told Belgian today. Prime Minister Micheal
broadcaster RTL that everyone in the Martin described the move to
country had to change their level five restrictions – some of
behaviour to stop the virus spreading the toughest in Europe – as
yet further. “very, very serious”. “There are
no laws or powers that can
He said the situation in parts of the change the nature of this virus,“
country, including Brussels, as “the he said. Under the restrictions,
worst, and therefore the most people are being asked to stay
dangerous in all of Europe”. at home, with penalties for
movement outside a 5km
“We are the most affected region radius. – The Independent
in all of Europe. Today, we can still
control what is happening, but with MADRID REGION
enormous difficulties and stress,” he MULLS RESTRICTIONS
added. LONDON: British researchers virus it takes to cause a person to vaccine are less likely to become MADRID: Madrid’s regional
yesterday said they hope to expose develop Covid-19,” Imperial College infected with the virus”, explained the authorities are evaluating
Prime Minister Prime Minister healthy volunteers to the virus that said in a statement. researchers. whether a curfew is needed to
Alexander De Croo said the situation causes Covid-19 in a groundbreaking curb a new wave of
in Belgium was now worse than at the study to discover the amount needed The volunteer would be infected “Our number one priority is the coronavirus in one of Europe’s
previous height of the pandemic in for people to become infected. via the nose, Peter Openshaw, safety of the volunteers,” said Chris hotspots, the area’s top health
March. professor of experimental medicine Chiu, from Imperial’s department of official said yesterday. “A
The Human Challenge at Imperial, told BBC Radio 4 infectious disease. curfew would mean that at
Meanwhile, the number of Programme, a partnership that yesterday. some hours there’s no mobility,
patients in hospitals is doubling every includes Imperial College London, “No study is completely risk free, like France has done for
week. Last Saturday, 351 people were hopes the work will ultimately help to “The great advantage of these but the Human Challenge example,“ politician Enrique
admitted to a hospital, more than half “reduce the spread of the volunteer studies is that we can look Programme partners will be working Ruiz Escudero told Spanish
of the peak of 629 on March 28. coronavirus, mitigate its impact and at each volunteer very carefully, not hard to ensure we make the risks as news agency Europa Press.
reduce deaths”. only during the infection but also low as we possibly can.” Ruiz Escudero said Madrid’s
Covid-19 has claimed 10,413 lives prior to infection, and we can work regional authorities do not
in Belgium, one of the highest per In what researchers called a world out exactly what’s going on at every “The UK’s experience and have the power to enforce a
capita fatality rates in the world. first, the opening stage of the project stage,” he added. expertise in human challenge trials as curfew and would have to ask
will examine the possibility of well as in wider Covid-19 science will the central government.
Health Ministry spokesman Yves exposing healthy volunteers to the The researchers would use the help us tackle the pandemic, Spain’s Socialist-led
Van Laethem told a news conference SARS-CoV-2 coronavirus. results to study how vaccines might benefiting people in the UK and government declared a two-
the number of patients in intensive work and to explore potential worldwide,” he added. week state of emergency on
care will rise above 500 this week. They aim to recruit volunteers treatments. Oct 9 to impose a partial
between the ages of 18 and 30 with no The study is expected to begin lockdown in and around
“Whatever the impact of the underlying health conditions such as Because the study deliberately early next year, said the research Madrid. – Reuters
measures, we will have 1,000 patients heart disease, diabetes or obesity. infects the volunteers, “it should be team from the partnership, which
in intensive care by the end of this possible for scientists to begin to also includes the government, a
month,” he said. – The Independent “In this initial phase, the aim will establish efficacy very quickly, by clinical company and a hospital.
be to discover the smallest amount of testing if those who have had a – AFP

7theSUN ON WEDNESDAY | OCTOBER 21, 2020
NEWS WITHOUT BORDERS

Muted mics at next US debate

oOrganisers hope move will prevent microphones will be muted. to raise a number of allegations supposed to have held a second
repeat of chaotic scenes during first “It is the hope of the commission regarding Biden’s son Hunter, all of debate last Thursday, but the
Trump-Biden presidential discourse which are unsubstantiated. commission changed the rules to
that the candidates will be respectful allow an online debate format after
WASHINGTON: The US debate. of each other’s time, which will The president’s pursuit of such the president tested positive for the
Commission on Presidential Debates Each candidate will be allotted advance civil discourse for the claims in Ukraine led to his coronavirus.
announced on Monday they will benefit of the viewing public,” the impeachment by the House of
mute the microphones of President two minutes to answer the commission said in a statement. Representatives earlier this year. Trump then pulled out of the
Donald Trump and his Democratic moderator’s questions, during which debate, and the two men held rival
rival Joe Biden when they are not time the other man’s microphone Trump’s campaign manager Bill “If the media won’t ask Joe Biden town meetings on different television
answering questions during their will be shut off. Stepien reacted angrily to the these questions, the president will, channels.
final showdown, to avoid the announcement. and there will be no escape for
interruptions that disrupted their last Once they both have had their two Biden,” Stepien said. Tomorrow’s debate will be the last
minutes, there will be open “President Trump is committed to time the two rivals face off before the
discussion, and neither debating Joe Biden regardless of last In the last debate, in September, Nov 3 election.
minute rule changes from the biased Trump interrupted Biden 71 times,
commission in their latest attempt to compared to the former vice- The debate is scheduled to take
provide advantage to their favoured president’s interrupting Trump 22 place in Nashville, Tennessee, and
candidate,” he said in a statement. times, the news site Axios reported. will be moderated by NBC’s Kristen
Welker. – Agencies
Stepien said Trump was planning The two candidates were

BRIEFS THOUSANDS PROTEST
AGAINST JOBS LAW
SAVE THE
JAKARTA: Several thousand SEAS ... Ocean
students and workers protested Rebellion protesters
in Indonesia’s capital Jakarta demonstrate outside the Albert
yesterday against President Joko Embankment on the first day of
Widodo’s new jobs law, the latest the International Maritime
in a series of rallies opposing Organisation climate conference in
legislation that the government London. – REUTERSPIX
says is needed to attract
investment. Dressed in yellow, Thailand suspends TV station over protests coverage
blue and green jackets denoting
their universities, students BANGKOK: A Thai court yesterday government as it tries to end the minister Thaksin Shinawatra and before Prayuth seized power.
demanded the president, widely ordered the suspension of an online protests against Prime Minister his sister Yingluck, who was Protests have only gained
known as Jokowi, revoke the so- TV station critical of the Prayuth Chan-O-Cha and the overthrown by Prayuth in a 2014
called “omnibus” bill that critics government, which has accused it of powerful monarchy. coup. Both fled Thailand to escape momentum since the government
say harms labour rights and the violating emergency measures corruption cases they branded announced a ban last Thursday and
environment. Yesterday’s protest, aimed at ending three months of Voice TV editor-in-chief political. arrested dozens of protesters.
which was joined by labour protests. Rittikorn Mahakhachabhorn said it
groups, marked one year since Voice TV had also been found to would continue broadcasting until Street protests since mid-July are A lawyer for two of them, Parit
Jokowi was inaugurated for a have breached the Computer Crime the court order arrived. the biggest challenge in decades to “Penguin” Chiwarak and Panusaya
second term in office. – Reuters Act by uploading “false the monarchy under King Maha “Rung” Sithijirawattanakul, said
information,” Digital Ministry “We insist that we have been Vajiralongkorn and to Prayuth, who they would be arrested again as
BRITAIN SCOFFS AT E.U. spokesman Putchapong operating based on journalistic rejects accusations of engineering soon as they had been freed on bail
TRADE TALKS OFFER Nodthaisong told reporters. principles and we will continue our an election last year to keep power. granted by a court over earlier
Thailand has drawn criticism work presently,” he said. charges related to the protests.
LONDON: Britain stood firm from rights groups for banning The demonstrations have been
yesterday in rebutting a demonstrations and the publication Thailand said on Monday that largely led by youths and students in Prayuth has said he will not quit
European Union (EU) offer to of news seen as damaging by the three other media organisations are contrast with a decade of street in the face of the protests. His
discuss draft legal texts of a under investigation. violence between supporters of cabinet agreed yesterday to hold an
potential post-Brexit trade deal Thaksin and conservative royalists emergency session of parliament
unless there were fundamental Voice TV is owned in part by the next week about the crisis. – Reuters
changes as their high-stakes Shinawatra family of former prime
diplomatic poker game risked a
chaotic finale. Failure by the
world’s largest trading bloc and
sixth richest economy to reach a
deal by end of the year to govern
US$900 billion (RM3.7 trillion) in
annual trade would send
shockwaves round Europe, just as
the coronavirus also pummels
jobs and businesses. – Reuters

BRIDGES DIAGNOSED
WITH LYMPHOMA

NEW YORK: Academy-award
winner Jeff Bridges has been
diagnosed with lymphoma, the
actor announced on Monday.
Bridges, 70, said he is starting
treatment and that the
“prognosis is good.” The actor is a
seven-time Oscar nominee,
winning the award in 2010 for his
role as a country musician in
“Crazy Heart”. Bridges is known
for his laid-back personality and
has acted in movies such as
“Starman”, and “Thunderbolt and
Lightfoot”. – Reuters

Bottle-fed babies ingest ‘millions’ of microplastics: Study

PARIS: Bottle-fed babies may ingest made from polypropylene, the most breast-feeding. of the research was “not to worry low breast-feeding rates in richer
more than a million pieces of commonly used plastic for food They estimated that the average parents” about the potential health countries.
microplastics each day, new containers. risks of bottle microplastics.
research showed on Monday, bottle-fed baby could be ingesting They said the levels could easily
highlighting the abundance of They followed official guidelines 1.6 million plastic microparticles “We have communicated, as be lowered by taking a few
plastics in our food products. from the World Health Organisation every day during the first 12 months strongly as we can, that we do not additional steps, including rinsing
on sterilisation and formula of their lives. know the potential health risks of bottles with cold sterilised water and
There is growing evidence that preparation conditions. infant ingestions of microplastics,” preparing formula milk in a non-
humans consume huge numbers of The authors of the research, said the team, from Trinity College plastic container before filling the
the tiny particles, formed when Over a 21-day test period, the published in the Nature Food Dublin. bottle.
larger pieces of plastic break down, team found that the bottles released journal, said sterilisation and
but very little is known about the between 1.3 and 16.2 million plastic exposure to high water temperatures The authors noted that it was in Fay Couceiro, Senior Research
knock-on health consequences. microparticles per litre. had the biggest effect on developed nations that babies were Fellow in Biogeochemistry,
microplastic release, going from 0.6 likely ingesting the most plastic – 2.3 University of Portsmouth, said
Researchers in Ireland looked at They then used this data to model million particles per litre on average million particles daily in North Monday’s research highlighted the
the rate of microplastic release in 10 the potential global infant exposure at 25⁰C to 55 million/litre at 95⁰C. America and 2.6 million in Europe. “urgency for studies on microplastic
types of baby bottles or accessories to microplastics from bottle-feeding, impacts on human health”.
based on national average rates of The authors told AFP that the aim This was attributed to relatively

8 theSUN ON WEDNESDAY | OCTOBER 21, 2020
SPEAK UP

Trudeau brand broken beyond repair

█ BY CHARLIE MITCHELL coalition partners, he needs the support “In no time, spent C$4.5 billion (RM14 billion) on a Andrew Scheer, refused on multiple
of opposition MPs to clear every vote, the breeziness vital oil pipeline, angering his occasions to express support for
WHAT exactly has happened leaving him vulnerable to a vote of no that brought supporters. abortion and same-sex marriage,
to Justin Trudeau (pix)? In confidence, and a potentially Trudeau to leaving many Canadians feeling queasy.
2015, after a decade of career-ending election, at any moment. power collided Roughnecks and executives in the oil
steely Conservative rule, with the sober patch, meanwhile, continued to blame “Better the devil we know,” one
the 43-year-old scion of the powerful You can trace the origins of the realities of Trudeau for their economic woes. half-hearted Trudeau voter sighed
Trudeau family offered Canadians Trudeau brand to the state funeral of his governing. outside a Toronto polling station.
“sunny ways” and was rewarded with a father Pierre, a popular former prime Billions were spent and public anger
handsome majority. minister, in 2000, when millions only rose. Next time around, Trudeau will face
watched the boyish Justin deliver an Erin O’Toole, a former air force officer
Feminist, climate-conscious and emotional eulogy. Weapons sales to Saudi Arabia, and lawyer, who will be harder to beat.
outwardly pro-refugee, he was a hit which underpin thousands of Canadian
among progressives worldwide. Surnames aside, the young jobs but infuriate his liberal base, tell a There is still plenty to like about
Montrealer, whose pre-politics jobs similar story. Trudeau.
Today, Canada’s prime minister is included drama teacher and nightclub
almost unrecognisable. Having lost his bouncer, was shiny and new. With Trudeau bleeding political He has not embraced populism.
majority last year, he sits atop a shaky capital, his first conflict-of-interest His Covid-19 response has been
minority government. In just two years, he led Canada’s scandal hit, in the form of a holiday on impressive and science-based, causing
Liberal party from the brink of extinction the Aga Khan’s private island. cases to fall in Canada just as they
Three ethics scandals, including the into government. soared in the US.
awarding of a massive government Last year, he was again found to have His Covid-19 recovery plan, recently
contract to a charity with close ties to his Legalising marijuana and broken ethics laws, by pressing his announced, is filled with big ideas.
family, have undercut promises of euthanasia, and welcoming 25,000 attorney general to drop a corruption At press conferences and campaign
transparency. Syrian refugees, earned him plaudits. case against SNC-Lavalin, a huge events, I have found him warm, sincere
engineering company that hires and energetic.
And his recent decision to shut down When asked about his decision to thousands in vote-rich Quebec. Like many western democracies,
parliament, torpedoing an ethics name a gender-balanced cabinet, he Canada has become more polarised in
investigation, is illustrative, opponents replied: “Because it’s 2015.” His third such scandal, which is recent years.
say, of a new-found ruthless streak. ongoing, is related to a C$912 million Out west, where oil is king and many
Three years later, he half-jokingly government contract given to WE see Trudeau as elitist, his Liberals do not
Over the course of a year on the instructed an audience member at a Charity, a youth empowerment have a single MP.
Canada beat, I’ve met a lot of Trudeau’s town hall to use “peoplekind” rather organisation that has paid huge Meanwhile, at a raucous Trudeau
countrymen. than “mankind”, drawing the ire of speaking fees to members of his family. rally in Peterborough, Ontario, last year,
opponents of political correctness. one young supporter – himself a
Those who constitute his core base With Conservatives baying, and three minority – told me the blackface affair
still adore him. His critics, particularly in Looking back though, Trudeau was committees investigating, Trudeau reflected nothing more than the prime
the Conservative-minded prairies, are always doomed. prorogued parliament in August. minister’s penchant for fancy dress.
vitriolic. His core support, and virus response,
For in no time, the breeziness that It was a shrewd move, but a political may yet save him but a simple fact
The majority of Canadians, it seems brought him to power collided with the card he had vowed never to play. remains: Canada’s bright young thing
to me, just feel let down. sober realities of governing. overpromised and underdelivered.
But none of these scandals hold a Five years on, the Trudeau brand
Trudeau scraped through a Take the environment. candle to the three times he wore looks broken beyond repair.
confidence vote recently after Trudeau won office in the world’s blackface, most recently when he was a – The Independent
parliament returned, cutting a deal with fourth largest oil producer by preaching 29-year-old schoolteacher.
the New Democrats, a small left-wing environmentalism and promising
party. unprecedented levels of consultation All this nearly cost him re-election
with indigenous groups. last October, when he lost the popular
It is a temporary reprieve: lacking But with the sector in dire straits, he vote. There was an element of luck, since
Trudeau’s Conservative opponent,

CAREERS

EVERY THIRD TUESDAY OF THE MONTH

What do employers look for in workers today? Which organisations are
looking for the right talents? What are the perks and benefits? And what

are the exciting academic programmes out there that would provide
competitive professionals an edge in the corporate world? These and more
are captured in theSun’s Careers section every third Tuesday of the month.

PUBLICATION DATE 17 NOVEMBER, 2020 (Tuesday)

Contact theSun's Sales & Marketing team to book your advertising space. BOOKING & STORY DEADLINE 3 NOVEMBER, 2020 (Tuesday)

03-7784 6688 [email protected] MATERIAL DEADLINE 12 NOVEMBER, 2020 (Thursday)

9theSUN ON WEDNESDAY | OCTOBER 21, 2020
SPEAK UP

Missing weapon in Covid-19 battle
WE are missing one essential
weapon in the battle against Can you pinpoint the exact spots Global Covid-19 cases surpass 40 million
Covid-19, and our failure to where offences took place during the The Covid-19 pandemic has infected more than 40 million people
develop this weapon is Recovery Movement Control Order worldwide and claimed at least 1.1 million lives, according
largely responsible for the second and (RMCO) period? to a tally by Johns Hopkins University
third waves of the virus.
If the nation were organised like a big SHARE OF COVID-19 CASES Brazil
There is a strong frontline in the jigsaw puzzle wherein neighbourhoods WORLDWIDE
hospitals comprising health service are these small pieces fitting together, As of Oct 19 5.2
personnel who are treating casualties of each with its own governing committee, (millions)
this battle and efficiently putting them we then have an early detection system in Americas India
back on their feet. place. 18.9
United 7.6
But who’s guarding the back? Such real-time detailed ground States
Who is watching everyone in every knowledge means you can stop a violater 8.2 Total
location to see that nobody violates the in his tracks, if every neighbourhood is 40
standard operating procedures (SOPs)? “Caring run by a neighbourhood committee Europe Asia
Our missing weapon is the absence of for yourself mandated by law to exercise certain 1.4
a nationwide all-embracing web of and your functions such as maintenance and 7.1 12.4
neighbourhood committees. neighbours upholding public health measures. Russia
Malaysia’s three-tier structure of became the
government is deficient in that there is golden rule Neighbourhood governance is best 1.6
governance at three levels only – federal, of human carried out by people living in the
state, and local (meaning your city hall societies all neighbourhood and not by people up Rest of world
administrators). over the there in the headquarters cloud who only
There is no fourth tier of civilised world come down to the ground like desert rain. CUMULATIVE COVID-19 Oct 19: 40 million. Growing by about
neighbourhood governance. during the CASES AND DEATHS (millions) one million cases every three days
Local government supposedly looks early periods Humanity thrived for 300,000 years as 40
after your neighbourhood. of every primitive hunter-gatherer tribes June 28 Aug 10 Sep 17
But city councillors and officials work religion. governed by tribal committees that were It takes six months Caseload doubles 30 million
in faraway headquarters and they don’t actually neighbourhood committees with 30 for world to reach to 20 million in
know anything about your drains, your every family represented, as populations
rubbish, your uncut grass, your potholed were small. 10 million cases just six weeks
roads and your myriad other problems. 20 after virus first
They can’t supervise the contractors There were no federal, state, or city appeared in China
because it’s an hour or two before they governments in those ancient days. 10 in late 2019 CASES Oct 19: At least
can reach the site. 1.1 million deaths
The three-tier model of governance is For 300,000 years, governance was 0 DEATHS
a proven failure insofar as solely in the hands of neighbourhood
neighbourhoods are concerned, and committees. Jan Feb Mar Apr May Jun Jul Aug Sep Oct
providing bleak testimony of this are the
decades-long recurrent complaints When humanity became civilised Sources: AP, ECDC, Johns Hopkins University Picture: Getty Images © GRAPHIC NEWS
published by newspapers about clogged about 7,000 years ago and started living in
drains, neglected grass patches, cities, the importance of neighbourhood governing committee with budget rushing to shut them temporarily for
unrepaired potholes, piles of litter on connectivity was never forgotten. derived from the property assessment investigations.
walkways, and broken playground tax could deploy scouts to observe likely
equipment. All religions kept the precept of good infection spots. One important selection rule is that
Not to mention the heavy annual toll neighbourliness alive. all neighbourhood committee members
of dengue deaths. Among the worst offenders during must not be members of any political
Three-tier governance is like a Caring for yourself and your RMCO were many restaurants that party to ensure they are immune to
three-wheeled car. neighbours (including strangers) became packed in customers without spacing politics.
Could a vehicle with one missing the golden rule of human societies all out the tables, allowed patrons to walk in
wheel take you far? over the civilised world during the early without doing MySejahtera scanning Neighbourhood committees with
The alarming surge in Covid-19 cases periods of every religion. and temperature reading at the zero political ties would have no
bears further testimony to the entrance, and letting diners socialise hesitation in calling the police to break
shortcomings of driving on just three The universal practice in scriptural unmasked. up any crowd that violates the SOPs.
wheels. times was that the definition of neighbour
The SOPs on social distancing and included strangers so long as they posed Another source of infection were Being close to the ground, they would
mask wearing have been violated. no threat to the community. nightspots where crowds and drinks be equipped for rapid preventive action.
mixed without a care.
Worth quoting is this marvellous verse The writer champions interfaith
from the Bible: “The stranger who dwells Neighbourhood scouts could report harmony. Comments:
among you shall be to you as one born these offences immediately, with police
among you, and you shall love him as [email protected]
yourself” (Leviticus 19:34).

By casting the net of social bonding far
and wide, human societies extended to
embrace a multitude of ethnicities.

In the present day, a neighbourhood

Two mysteries of 1973 Arab-Israeli War LETTERS

█ BY ERIC S. MARGOLIS pushed – from an apartment in London. headquarters to halt the Syrian offensive [email protected]
FORTY-SEVEN years ago, Egypt and Syria Syria’s armoured forces drove into the when the downhill road to Galilee and Jordan
launched a massive surprise attack on Israeli River bridges were wide open. Save our coral reefs
forces dug into fortifications along the Suez Golan Heights from their starting positions Why did the Syrians halt their advance
Canal and Golan Heights. The “limited” Arab on the plains east of Golan and the Mount when victory was in their grasp? WHEN crude oil is released into the sea, the
objective was to recapture both strategic Hermon massif. The answer remains a mystery. lighter compound in the fuel evaporates and
areas that had been seized from the two Arab But the best assumption is that Soviet spy the surrounding air can become toxic.
states in Israel’s victorious 1967 War. The opening Arab assault was a satellites saw Israel move 13 Jericho missiles
remarkable success. out of caves at two airbases and affix their Oil slicks that form on the sea surface are
Re-armed with modern – but by no means 20-kiloton nuclear warheads. then carried away from the spilled site.
top drawer – Soviet weapons, Egypt and Syria I walked much of the Suez Canal soon Moscow immediately warned
sought to drive the Israelis back, then wait for after the war and was awed that Egypt’s Washington and its Arab allies, both of whom As the lighter components of the oil
the great powers to impose a truce. military engineers had managed to get so feared an imminent Israeli nuclear strike evaporate, heavy sludge forms and can be
many tanks and men across the wide canal against targets that included Damascus and carried by the tide to the coastline.
It was a badly flawed strategy, which under enemy fire. Cairo.
assured the heavily armed Israelis would So, both Egypt and Syria halted their This heavy sludge then smothers any
control the military initiative with their Equally amazing was Egyptian infantry, advances. organism it touches: corals, fish, even seabirds.
superiority in air power and armour. using highly effective new Soviet Sagger Israeli forces, bolstered by the arrival of
anti-tank missiles, and air defense units, powerful reserve armoured divisions, seized Aside from clouding the water and reducing
At first, the Arab surprise attack caught employing SAM-6 anti-aircraft missiles, to the initiative and went on to achieve a sunlight, oil pollution also kills the zooplankton,
Israel flat-footed. blunt Israeli counterattacks. brilliant victory that included crossing the while toxic chemicals in crude oil weaken the
Canal and encircling Egypt’s III Corps. ability of corals to photosynthesis.
The armoured vehicles of Israeli reserve Hundreds of Israeli US-supplied M40 and The fighting ended after Israel failed to
forces were still in storage when Egyptian and M60 tanks and 20% of Israel’s formidable air seize Suez and towns on the way to The entire reef ecosystem suffers, affecting
Syrian armour and infantry stormed across force were destroyed. Damascus. the many species of fish, crabs, and other
the 1967 cease-fire lines. Threats of Soviet intervention and marine invertebrates that live in and around
Most of Israel’s 15 Bar Lev forts built to America’s resupply of almost all of Israel’s lost the coral reefs.
Warnings of the impending assault from defend the Suez Canal were stormed. weapons brought the 1973 War to a close.
the most important Israeli spy, Ashraf Egypt regained Sinai but Syria and the Blue Lagoon in Port Dickson, also called
Marwan – amazingly the son-in law of late As a connoisseur of modern fortification, I Palestinians got nothing. Tanjung Tuan, still has thriving coral reefs, but
Egyptian president Gamal Abdel Nasser – was fascinated to explore the fallen Israeli The US sank ever deeper into the the question is can they continue to survive?
were ignored or shrugged off in Israel which forts. turbulent affairs of the Arab world.
was still filled with hubris over its lopsided, After a bad scare, Israel triumphed as the Port Dickson is one of the four sites in the
US-assisted victory in the 1967 War. The second big mystery of the war Mideast’s premier military power. west coast of Peninsular Malaysia which have
concerns the savage fight for Golan. significant coral reefs. The others are Pulau
This was the first big mystery of the 1973 Eric S. Margolis is a syndicated columnist. Langkawi, Pulau Payar and Pulau Pangkor.
War. Syrian armour and mechanised divisions Comments: [email protected]
also inflicted heavy casualties on Israeli Part of Tanjung Tuan has been gazetted as a
Was Marwan really a Mossad spy or a defenders and had managed to claw their Fisheries Prohibited Area. This status could help
double agent, as Egypt later claimed, way to the top of the Golan Heights, from with reef conservation.
disinforming Israel on the time of the Arab where they looked down on Galilee and most
offensive? of northern Israel. We can play our part to save the coral reefs
by refraining from throwing rubbish, stepping
Marwan later fell to his death – or was We don’t know whether Syria intended to on corals or extracting them.
drive into Galilee, formerly a heavily Arab
area, or try to defend the Golan ridgeline. Lionel Perera
Port Dickson
But orders went out from Syrian

10 theSUN ON WEDNESDAY | OCTOBER 21, 2020
MEDIA & MARKETING

U Mobile user wins big

Participants having a good time during last year’s Coway Run event. U MOBILE launched the We Want also took home a Proton Iriz as the
U GIVEAWAY on Oct 1, its biggest first weekly winner of the
For a good cause campaign yet, with RM3 million giveaway.
worth of prizes to be given away.
“I found out about the We Want
It is very simple for customers U GIVEAWAY from the
to participate and get a chance to MyUMobile app. I was very happy
be rewarded with a prize. All they and I couldn’t believe how easy it
need to do is spend to collect was for me to win. All I did was
points! perform various actions to get
more points – I topped up,
U Mobile was delighted to subscribed to data and purchased
reward three early winners in the add-on plans. Besides that, I also
campaign at a ceremony that took logged into the MyUMobile app
place at the Proton Centre of daily!” said Foo.
Excellence, Shah Alam on Oct 7.
Other winners present at the
Foo Shu Chee was the big ceremony were daily winners
winner of the week as she was Cham Sin Yee and Low Yee Kae,
rewarded with not one, but two who won an iPhone 11 Pro and
prizes. As the top daily winner for Huawei Mate 30 Pro 5G,
Oct 2, she was rewarded with a respectively.
Modenas Kriss motorcycle. She

COWAY Malaysia is organising a o Get fit with the virtual Coway Run 2020
month-long Coway Run 2020:
Change The Game event this include the weekly Sunday Boss Fight channelled to Coway’s Happy Water (From left) Cham, Foo and Low are the early winners of the contest.
November. Poised to be one of the rounds from 7am to 11am − offering Project, which funds initiatives to
most exciting virtual runs this year, runners who clock in a minimum of provide clean water and promote
participants from across the country 1km during the allotted time frame good hygiene practices amongst
will be able to join anywhere and the opportunity to vie for attractive Orang Asli communities nationwide.
anytime from Nov 1 to 29. weekly prizes.
So, get fitter and healthier while
Any Malaysian citizen or resident Participants are also required to contributing towards a noble
in the country (aged 16 and above) sync their running or fitness app to mission!
can participate in the non-timed their VRace by Sportheroes account,
40km run, which involves a ‘level-up’ a purpose-built e-platform which Burn the calories with family and
gaming experience where runners allows participants to record the friends by purchasing the special
can collect achievement badges distance covered within the virtual group packages starting from RM35
when they complete significant run. per head. Register online (before Nov
milestones throughout the stipulated 29) at www.eventbrite.sg/e/coway-
run period − Level 1 (first 3km), Level The Coway Run 2020 is also tied to run-2020-change-the-game-virtual-
2 (10km), Level 3 (20km) and Level 4 a notable charitable cause − RM10 run-tickets or for more information,
(40km). from each ticket purchased will be visit www.cowayrun.com.my.

The fun Coway Run 2020 will also

15theSUN ON MONDAY | APRIL 27, 2020
ENTERTAINMENT

Stars who don't CELEB SPEAK tbawewhtefethhflroiioaeerrncvtotlewieIwvssaetnsahllkyIaynwstwsastbedyat’eu.goraenrwSuanoanmtliymlnbmgetihse,tioaemrbdueueetssislettfs,urrevlbaweeinenetddlioetlfteouvohnoerredkotgimwhntiorengel
settle for less saewtbnheso“aeoeSutnnrta“egbbecwDdvhegotelai,aaeeynmunyoutls,“btln.irpuBosotoveaetyecirureuuefatenmeoblrrewsrtseluxoeeom,eokbfcctibxitucatashatineoitttpnrwe“ctrufpmhaeanameuEoieoetetvunrecinesinltvfesemofmitedrceuatti,Iuntsifttasecnnrlioheuhyhureno,oneegnnelipbwotmd?esndnogojt.ueuancsaaouYoiiaumSnynsllsoitoturncedasoniotgfustuvegtoanodotnhsginhirbtaurdbtrldhatahmmtm.ybeeroeesrrgteaiaonpoettanaetssgolwdhoIdIaktnotaiegeisuypwelaeyoneguowoleygitoaoynotilumnoil.hbgowinsulmIsgnt.,leouyawhgigIsmatmoaIdnhtahtetlt’ny’rimiyhiod.tsteifslotsele?
All about
girl power thDae“nfLinjiuvitsinetlghyanavoibnt.egaaubtiefualutliiffeulmapaptteearsramncoer.”e
orbeydBeuemcaepupotyrweqejuurdieniegcnewJaeognmasienCnshteboenaguhtyoppeagsetoants Wp“embBmaedhagetopakteaseiotuautnrthw,npthgiyeaptespanriosthtnehdartydhtmepicasesemoieaw“gmcesamBgisaaoo;screpareeblblcmchmisaeboaloteiovyneloewuobmhoumeettntmotetnieysvhts“aynoiiafAnr?wabesygtsduibfmethgnlrnsetiahart,teaipneoeeeehgcyagrlltiooacawoatglournaemrorf’huopchosgegtmreaugihtttaeaakeeoanaybyhhoigog,vaetmrsrntn.gaeehfhoheelemdnrcsdrdreeptasembtaeekhaooirswnoreralasv.etsoiutegatw.lcoheWihtrblasitsos,tlhIhnymneeatyhilesfeoloatrwanokyseaeamnovnnwsiirrauanbnpeteeedhfsfethoneotovdoihttatnynuaedhuioerorfwevnatcrtolgtne,oedh,er

Celeb Speak J THIISNOBKIINWETEARTNVHUUEWETLRYIIARFYYUO. LNEwtbpsatfrcedatpuborhahheloarneoio█nrmtasaeaegnbahdmmssTddprot,umeBitahoessBemepsenhuelrrtaiteietppaeapsretYhpieansyreehasgeAnseebtecaueprigj.earmatshsrHenpktreeaeJEsuruarwoetCfeeecsessbSeAetcwssaytdlacttNosr,tvaarufsleshotaueeieltrygtSoevtueineanyhwrporsSrtnopsinctnnerianOrptnlnsoemygteaeatlttieaeopa,Cgnpa-rintpaieNgwwfmv,nnottiseboaborcrHtscyoeoebekbtritonagjgertLeeparr,aoeunsiaroeEyesmoietsInswa,atnhCtnIntwsMhna,hkOaahwnilsgtptlehgvtorhwe’euanooestetthetiNcebraneytelehdensosfmthwtabhaeeoattserpeGtarssrohebrfphflnaieatnunaetiiddiatlegnttheeeinyetaaavtitouftlgahhahlshnhnteiimaesaogleertnmvhretttrneaavtctgacuiyaospmedrhpoMsptvahtftra,octmfrleotnieeyneoagsbooohsvvisiwr.aealwctsdmuafsohaiehlhlnlnseiithsetrtroeanmew2meeegktiaenavrnedo0rdc,wilmnoeoelt,dunAge1flspidljfmattooinc9oageseooysbgeisuhbt.lniimrh,awuohcenrthloetynwoaecratdabi.ias,e?ndn–iurhuaeepndgeJgtsntytesysysntscabsqhseonoeueCewmWdt“thpikmthtpjtw“hhteTienhauhhnrpesIhtaronaoilooinieodaeolmkonngltfawtercwet“rggwieebtufcnteItpaneBeareIreaeofeglinuusrgtcadeeinlnmIknahesayse,ktrlt’dignt,myiavtnno.xsbbIngomIijleomropudgnuy’lcrtemevryawhaaeyotass.sabIoeobnttwcttseerabubtTdheinesfueehiiatnmtlbelnoetyheamoieenldpltitiolfwrnwgdrseenjieIoaitaspktuneag’othc,mdrajohlgmcueerpojnamsvewroubsoiyapeuooyigeefxkneugcetdltdg;bpeeugsrtuoicwonapaooereshqgtrIthialoeriourhnrnawitopvhrteeitownunimintencherhmtsetcantrnsr?elaoi,tp,gIaeeer.itieratrii,tagsaInfse.phtensrymryoistwnekknaenetdIdtneko.iefo?eoe’edemsimtshtonnvgi’teIh.dtweitg”felbesratooselfiapitredhfeeutotestuowtayethosTon,r.oyrortr-te,IeenekIohnjwladybotonItfsoutieoahtueynsettIwyu,eldg other’s“Tbhacroksu.ghout
Why did you chose to become a beauty fttTmemotooomhrooeugekbraegrmenatehmrt’seusokde,tsoholeaewaandaatnwnrttthdnhohti,hiislnilaoetiej.gtntorsdouaarIrn’deme.”gyoe, ixencvgietnetodibftieot tphrtaeeththcgaheieiclanlroaytcgnuwiusnrt.am,saIycenshrietyotaIaafngnliightvsscheaeeeeeddsnes
A weekly column, published every Monday, queen? WtMP1ttpo“imdtothtwt5aaIuowriasihc.daw’and,amrgsceamphclpaoinrnioetsaetinhOpnpnogusoeishss“ancunatitheaiaimnketa“srwHnzecennetulnCcprghRsrpittoidsh,nftcogenpaesmetoahpoetetnpaahlgwiwsdtgehisstvrgroIiniIs’enaohtntenmoeatahaeiehbebawnitwnseartnrecvHtioaeet,ftrycdttdateschasfthtinfieieuhohhenilomgoseaae?erlnedbientd,eancahmesrnnvnmlIdsseualeeItgesttadkclsIpsterhwoyIy.ecwinnalqhenKocg.dhrraeRtpanutnetatg.noiolhaheaslasfttlcaaasonwsa2onmh’rt,aHpefeensnblopfhtf0oingrtigrnafeltailroflee2otlo’seaagicesssteetoirwepe0oarnhanetistdqd,homnoetdirtftayeanuionhenehdoTnoafIndoohtF.yiitotne’elawtnlnaVtytbtnvtuuyeoalowrerno’ayIlgseyBberusl aadcwnlooshdmoheenaemvetpowtohgoweemteahrebesonirplt,ihrtyeewdartosoed,
featuring popular and on-trend local celebrities “I didn’t choose ttohebejuadbgeesaudtiydq. uI ejeonin,etod positivity.”
talking about their career, personal life, and what be very honest, that matters.”
drives them, as well as current and future projects.
The celebrities featured come from a wide range WpoashtplboenregdmuonvtiileMay 2021 What do you wish to
of disciplines and include actors and directors, see in future
musicians, chefs, models and comedians. Celebrities wilfalliannwgdstotoidnojttfpcfrussihtthoapjutaatenpwothhshaohbau“pdhrhereohsgtetoBgnlerfieeodi“agmueewewcaf“eyoter“tNettweggmlhIhmrrsttcsraTulahsatdeerdeeieooodaohhneycaguhiasc,rsajmcivtlnn.esloauieyn”tebhtleotetmvnmtesemmylamputldgtylehuebtrrvnvhalwpeatapnsgpstosseareeephespgerln?,ayauaetyveneictosaouseaeyprsts,hgygsbernou,ynheugiteefsesermrahtlvtleevtaatpwiuhasbtroaiacadacuerpynateneepaehnanhitluw,nsrfwlodrtswusxisweanaideotuestseo,ypeluaosers.otrocreipbhnfdfflmoslmbepjtgeoomieioljiuahsncmejnsiorbtrtbativeesvhieh..hemcnolosiaeettnetcneeiapaortneeiahonnelitecsdnvbnrunate,gseseedtg,
previously featured include Tiara Jacquelina, Carmen Oofrrc2tiMeennohR8lserar,IpAWoiaGlllonuslyeI2eenaagNr0vsowdA72iefrei,1sLuIlctlrnPLsaifahYdripfrnroaetaasiovikdrnmncteehgdobtetteoouhydmtneunhwpitliceeonaP.diseittcmptutouoonornlntnaeieglusthonMhtsichnaiahnesgy ttnbohouetnshiwenetoehpsrerlsoldel’wssosniclhglineoredpemiscnulagomss.tuehHraeoitnloblyfomwmxoi-dooo-sfdJftuicoilesyf
Soo, Maya Karin, Shalini Balasundram and Haneesya Wahlberg and 2LaE0der2ieaWc0pH.Mrteiatadntiekcfnrroaocbnmkyz, ,ttIThhaheenef2SeR0ahe0tio9unrrcrneaoarhvnnaeadsltbibJooyenheDinnst.
Hanee. directed by hcPtMasWhheacainegivhaspcryTtehiedhouzhrlruabroasheei.epepreiabesslrshmstgoe.po,r)fefIeasr,onanysnwmratcitrthamleeheeionlvdelraiesCinwenrasoSith.innfobDfloailadsct(iwpcsyFhdunpartohleerwefrdlaoimtfainlteoenCoeyenyanremloeftildmoCindegegenndaogOwhonErooRrtin’jEifmlBkwiuelerovtsropfsvhahifaooibamioeleoaonlnsr,y,rrntfo,,t
Antoine
Celebrity Causes Fuqua. fecaatsutr. e –inAFthPe-

This column comes out every Wednesday, Paramount
and features a local personality Pictures has
speaking about a social cause, either hircteasosdprootopnnlsaceanhvsatinorguetinhse
as an ambassador for a social/charity crisis, which
organisation, or as an activist. The column has led
serves to create awareness of the cause,
and to inspire readers to make a change Relaxnews Wthheenfirysot uththoiungkhtof tbheaat uctyo,mwehsatt’os cr–ECeoCNhfniOnTesoEiUtnaRnRgnTgTtAwEbjIoShNeuYolMireOnwvEeFeNeysRTaotOrhfeCa.gtKrolEifwTeFiniUsgEaLand
themselves. Causes/organisations that have Wahlberg. mind?
been highlighted include a school for refugee CELEBRITYCAUSES – AFP “I truly think everyone is beautiful in 15theSUN ON WEDNESDAY | APRIL 15, 2020
children, teaching people how to live a zero-
waste lifestyle, and helping underprivileged undergoing Sintrtueynssiwveasyoing–sapCitOrreaUdiRntTionEgSoYpineORnFisOJhOhikJaOensaShJT,oRInaUdfYtieaSr. LIFESTYLE
students stay in school.
iTnhneecraplel oafce
wwhoeeitrlJhlonchaejoelslrSisnktagrnnutodoywshhlefeeeadlplltginpeitgeiwnoapsle

Contact theSun's Sales & Marketing team to book your advertising space. S bhCoeodlupyldbimogoaasrgdteey?noiunrgistamsw“optYaadiIdkpeeompmstbslifntu’acnoiashuospoorstCywaoeetcsusatwdDhoeprluaSalhmasowwiat█neaeftern2tnheuTalihcohantonlSlodne4iheelnceilehronroBictdlnnhdsdnaailisen.ttaeahwnlhnYnhyugeuehrhca,sfrsestiaeoeoggoschtItofceiaiwSsosboth’‘tsellsadi,uwtmusHwtrerveelsn’o.s.dfluisneaeeecerrsaesarvocSuIeEotelpasnasrsadNnseamlhptRnpc-ypedlnsybrgsDshnliswereao‘iulteehnteeeaeltoisafoawRheninrkdoley?sHehcdnnnhgseseAsditslpoaobiryfoglsdtosirJeknoniajmulmemoueessaSplodevehrom.iheordndjtieAsousoaaav’pstbmasdthnT’lhlr(mnespiiasaeveattenOec(,HmeosegplenyiaDwreOfen.rwuhIIhdai-wysscAynlhigoebhHrsaeyehJae.feduB.x’aefeanarrdto)eorn(eioSph.aiAn.slyaoaKetwirthlthmwaaJhnarLJ,cinsoyoonoutenaJeAgioiaedljofsnrgnbaeoordnNcoeeopAntkessmceSseSineiduvleiianst.natsytnnneihesioturcacaotienggswuescDmnrrdeidutterioyviai,TgribisintisoenennswdhuoofVeaacypi)icw-snwcstnahr,)ooyre2hoiuicahehdeongvat0pqeiuetsh(narYaiaseegvil1rutrwecwenndn“ne,eoerteaTrnHr7nnhemeIetoyoeysdurhgyd“dAV’HrdiaposaytWmomwrtoaIertgesoAo,soglttochpewoutpuphtcd’ikinvsereo“shuhoirnaseW&waorimt.fyainnmIskmamyh]rle.riepoensstsgtnmniosaedin“ieiohcctdtbhIhexvnprdetsl,nilttgcceteonbdSIdatfrl.uenhutuegwaetreeeoolea’oeoeokidahfunutskoyepduBvttradortlaamiaaburtcswamlih“u’ioyeoandncruedyosacsoncaiutIlnltltlihywIrsiooi.aoieyweelauoaiigotanih,nnlpttnstismoplgsnneiesufnItwogndyhtyrnerlIeunowdgtfeiedptienahtpadoglgtw,yaneryrocsuge’ygbfompgenisearrteehede,hootenpesttmntsgglhohopHlftmadeyeyRtouoRheirhheelotlureemtagbMrhfebeoatdsnodepbrhlorrepasoeeonfaakeaaohtrm’ytlvteateoaggniyiertodwoeieanatheimiulitueslefryhewnnteehkiesnaainebai,kiflieshorlhrnilyvcemboaennvdchennrtIiieoglnieatsilsims,tsnupelfetepsretgyouyeuhsgadyaighewyfrripdnhealekwspretamgsnoloiliwaaneliynteid,octtarwnghnermanalin,nchnpodirdshuirdaeaanitylkornoereacntnmapyamgtesiJitmrSoeotaaaieilnrlennpkrnaaotdsese.ktilenpo.tllbaiadt”tlsaywiybet.nheunndihpoph.leuiiloumn.sriafnetrnnbbcsinitaopnseehhaggslwIa1esienidswetdTatthsoaiegwatdnnuefttoussgl.hhilneao9nesoeteieonawtdeltd,andfegtetwgdosIup,ssottereehmepsueoentultkdtilrhariwtgo.?eablnahhrwisteanynepstoIttfinnricysofeidceesiroeI.pueteniomnhyisesraermioopoeaumt[e,oheoeq’,rspofsltIasp’ntgsrsagteglsusntsltasmtnnnaw.wo.aewuo”miptrleolonirt’yresitstltclngyIssanrngnithdrtaeoshihsoiIhiitho)ooletoilkohntlnhnowheeeebydsaeeu.evvhiarehceausrdemvsisafrtuggsetwroiAboedsnntailaivnttraegcsesacsthhlhawulrtlutaYos.odseddytpoeig?hrynyfd,?dghhhoseoaesognliettucoto.eoeauasorteett,eheeevceawaah.tpiIohuepedrthulnIelliohdlteIatiawfdrklncddoseeeemne’tsno’tp’l.arr”trste,reieaaadofah,hehwgentedtlrsoryrlypipovaieleeigoaibarnsinvltlnevfaIenitenihsercme“gekrhDnlewksuyioladerIrnentyewgseoyaoeptanhuhhcattehbmgyiudlhpeeoormohetyparcrempsrmeareunwev“ucoenhoaxrosfefeyrbbrWxe“eaaoounwlaincgouppee““erleiteoypWnTtielssvtnonouuitlShteTlesnparoavh“uchleepiponddperroctedea.durdsrtomhIyhoeubunniyresbesariecoawWnnfmfnsts.fensriereealontteeocfaulsssfiwfeatattdmogy,ssaimnSnetiarriihuhietetdirlsasnwydlxvstangmeesnontngmtasirlantihitaoslmis.elrvoidlyaslirthsleyoevsnyoedtsltleistRiion.i”bogtoytynortotseeeiwtnfstayrsshlotewvyneehelhwmeeburimshoIrzpsigcienarep.bigpa”stgnveinen“bsdarptnariamAaelhynodfginhadmenooae.rceeWisyeil”tkanrglorgeneeadnaeentongetmnwthoyafnisegletamoieebtliuwnrsarsnwinmxottrohwpahswwhttmasywtxtfianouedr.sa,aptse“rna’.oeertsaehotgdweontotehsetepepipfeimnrBrnntILoaehosenht?hr,ihgsrodvtei.ttaihrnenSnirein.enteqhyceeweaptidntromihfai.honipmainlaeItofnheesdrencsibnclcsuantttrrptweginotgnthmi.ewnayiueWemaohg’oehctetaeeeeinghgnreesgit.aefailhasoeLlrgdartsouobs,sinieelces,vngniepfyItasotheeucnanaiaeltabsegwyeyeahnietucretntwithtwdtlraecsaaseboliindtcthtgosswnseawshhcitai,ntsbeopstoin!ecedtaahlhfnnruohh,ihiuttkwvhhucsitaeotbcgeenaoearrysasnt.eyaiipuciyogoeesvaehrnsosnaoifcyfpotirlsogopratowfomT.utrimtteo,are”,taoaunaesgautonieeeideedhuhfnopeufpoyhqvpnsarihsruoqeebgwountrc.veeiybtoaflogoesryeytyueerutssgxscuheusir’aeostvpj’hioleosreynuuommrepsraebiohhaehreaefnbmcrwrhtsieemanroeyuelvivapurtsasnecmyeesaestohdinlarnnaoupty,uniaaiersntececommIgilnpmwhtaatniaeshavhbboncedwcgbanpraethuhe?ecaudronalnliiliinyoihowuirfitigpecunveloxasreoedvnnnsehnosltnitthiiadouem.h.andelonht”sweotnhitumrowfwgtdeoutyen.drue?nsaotisdaoigirrhonataestefneheioitrlkatailaibrnanolhlyceirlsceygerneoltonsnttoweo,ggeeihoptnhhdghfnhdgluauoeugaefewaeontueleorfrer,bfrhupeosesPepirsbhatnniisbrlpimnnuebtpooelo“phcbiscaragoogPdeetnnswtfreespmehnelf“heaheoapt.sfynlEpeuvnMtairoeoieebfAipseranaseolmicatoecsfgieunladdemnTdsnsurtohiinoystpopleyleiInttvgennmroKntitchhlmNifneoipruToeismedpnrpen,rhnhotsaelv,vatbtppiricen.ieenhhewfwTsEhnfseiyoelorggaogiespesratiiogRLarelSpprfciye-rmahcdegtonWrogsiidwnerifetnouhriegnwoaegfcniaeretrbcuoeastm.oeaertetwvd,bdgoodingfhdidsaprtrnisnaeanssmorsctitaahwvnacidoreuo,iefvnepmohbr,aeohniiloelpsihttepdmeblttaotidaliwfafeeidwmqaile,lgldhtaaonauiineiirnssooyodhutyvoyroetnvycelnmacrytrurneieyiihchtgsaohgingtcey,.ncaetacfnnnotnsnhmniiAhcbhaemiina“ihelnihmcishrehpyhnn,sngctasnocbecdhiilTbreasenionoodosg,nnaetgene,ch,aattciesdhsertotohioashsr.posddgftmbswrtassrhnair,htcssfbbneiiankoighioehlsiesidaffannltpylotneePoestbimfeonaaiesetehhpanuoecnsen.hrraphyagffunrrmaguiprcwanoecdiutosottioieaonwrimetenccoocysnibruhlpRtiiaiatpmsesnbtnhirercmtcfpaahohtahaebrieduaerlaeeluoeoetaofynraevdboldawibisereuthsitdoseebcrrdiisssghsashfptetletustsharnteueeerhb8icsesehcknitwthymghsaaseaealiitnrote.atsghnoomcetscn4eiilrveiieeholnso.esat–niitamnvnnledutlasppagreotdcmhiloorodo.tefagdecnsroeofslttwAftVtahriUfaobolielfaastthdstviaoaiahoeaerintynbcitrmnipibFypsnapyfybuonomeinnvtnrmorhndnervistakyisPeqghtsdhoaeaeirnmtonmdeidttwesbeaeecthtiesvaehnnfeceehulycedanypurddyeittnewosnedeeltnnmveebasnonhielydttersaLhSygshpattnreraii,otnltiiheewegnpeetcasdsocrigwttlhaej,aiergeethnanpo,fletomhchiair“tria-sehuotnitasrtelassfrfanaadsgagnaraaUplhuhderyiimsnscmetratdltihtlcarnsdmdcun.allfadeoselmereoendidil-tya(yrogiaftenrsaeraysidanAisneoinbmrimd,seiildmbrnneeetwnnlnboallw,t’bmReroyesnleibn,lybepegmoegiwearUudoihntaotsarnnoldg1tsetns)hoeddgtdh,itye2tmdreaytyee’aymsrshnl.nd8eaee1jonytal
aofbomoalflenrordaeytahyeom“alEedlnhvencaidaecinlsttialulppithaztroepebtisndlonlelioecgsrartiv,teesntowi.dh”scd–eoauathsstlucAlu.aeolpOFdstpttePnehabpo-neiReeonpsewrleltuoetlhdauarnreixynsocgn,aiotu-tetoctimhgeewcaehsremsmcrsftehosuhficronteeoogrivtpesaeynt,rroavtdbhtvieutuiianssrrdl,ieionaenngnd
03-7784 6688 [email protected] thheeraaSplhinyegatnuedasicnohgtehsyeorpgeeaxo,epsrloceiussenesdl.f

S E C U R I T I E S S D N. B H D. SunBIZ WEDNESDAY
OCTOBER 21, 2020
197201001092 (12738-U)
Editorial: Tel.: 03-7784 6688
A Participating Organisation of Bursa Malaysia Securities Berhad Fax: 03-7785 2624/5

A Trading Participant of Bursa Malaysia Derivatives Berhad Email : [email protected]
Advertising: Tel: 03-7784 8888
Participation Bought Sold Net Fax: 03-7784 4424
%
RM m RM m RM m Email: [email protected]

45.7 Institutions 2642.8 2688.9 -46.1

43.0 Retail 2597.7 2416.8 180.9

11.3 Foreign 588.0 722.8 -134.8 7.14 14.93 104.09 45.97 44.80
KLCI STI NIKKEI TSEC S&P/ASX200
100.0 5828.5 5828.5 0.0 1,510.97 2,528.64 27.28 15.44 23,567.04 12,862.37 11.67
HANG SENG SCI KOSPI 6,184.58
Preliminary stats (excluding trade amendments). For final data, please refer to www.bursamalaysia.com 3,328.10 2,358.41
Source: Burs Malaysia 24,569.54

KL MARKET SUMMARY Interoperability the
OCTOBER 20, 2020 way forward for e-wallets

INDICES 10,985.60 CHANGE -52.30
FBMEMAS
FBMKLCI 1,510.97 -7.14
CONSUMER PRODUCTS 549.45 -6.33
INDUSTRIAL PRODUCTS 146.58 +0.07
CONSTRUCTION 160.02 -0.37
FINANCIAL SERVICES 12,412.10 -33.10
ENERGY 691.92 -5.95 Khairil lauded the efforts made by Bank
TELECOMMUNICATIONS 574.51 -2.39 o Boost CEO says the industry in Malaysia will follow Negara Malaysia to establish the
HEALTH CARE 4,235.26 -67.70 path of telcos, with three to five big players and a interoperable credit transfer framework and
TRANSPORTATION 643.78 -4.63 number of niche operators the payment network facilitator, Paynet,
PROPERTY 619.31 -3.40
PLANTATION 6,894.66 -22.80 “Paynet being an extended part of the
FBMSHA 13,216.50 -73.00 regulatory arm, I think there are a lot of
FBMACE 10,992.70 -179.00 things that the regulators are doing to
TECHNOLOGY 60.58 +0.56 █ BY AMIR IMRAN HUSAIN SAFRI “Towards a certain end, the support interoperability,” he said.
[email protected] consolidation is happening, not by virtue of
TURNOVER VALUE PETALING JAYA: Interoperability between mergers and acquisitions per se but the Looking ahead,
11.040 BIL RM5.828 BIL e-wallets is the future of the industry, with smaller players struggling to overcome the Khairil hopes to see
three to five major players – similar to the spend barriers of the big players have done,”
5 MOST ACTIVES development of the telecommunications said Khairil. a future where
OCTOBER 20, 2020 sector, according to Boost CEO, Mohd niche players
Khairil Abdullah (pix). In June 2020, Axiata Digital managed to interoperate with
STOCK VOL CLSG (sen) +/– (sen) raise US$70 million (RM300 million) in the bigger
LAMBO 959,789,499 3.5 UNCH He projected the e-wallet industry to financing from Great Eastern which will players as well
LUSTER 816,216,400 22.5 UNCH follow the path of the telcos, which has its big translate into support for the e-wallet.
MAHSING 514,310,800 118 three or four players and a number of niche as among the
KTB 264,085,100 15.5 -6 mobile virtual network operators (MVNOs) Given the high spend among the wallet bigger
LUSTER-WA 248,326,000 12.5 +4 such as XOX and Tune Talk, which bring a operators, he noted that the smaller players themselves
-0.5 certain value to their consumers which the will struggle to catch up to such big ticket particularly with
other players cannot replicate. plays and will subsequently drop off. the establishment
of a platform like
Khairil opined that the smaller players in Moving forward, the Boost CEO Paynet.
the industry have amazing use cases, which highlighted the need for e-wallet players to
5 TOP GAINERS he prefers to work with, rather than see shift their stance from killing each
OCTOBER 20, 2020 them fold. other to working with each other
for e-wallets to gain a greater
STOCK VOL CLSG (RM) RM “I want to find out how we can share of transactions.
VITROX 451,000 13.80 0.32 interoperate and collaborate so that their
MPI 260,600 20.70 0.30 niche use cases can still be relevant to their Despite the efforts and
GETS 41,659,100 1.12 0.295 user base but work with a larger platform accomplishments of e-wallet
PMETAL 8,904,100 5.57 0.25 like us to continue to thrive together,” he told operators, he cited that last
NSOP 2.90 0.16 the media at a virtual briefing yesterday. year data indicated that cash
5,000 and other forms of non-cash
In essence, the integration of Petronas’ payment are still dominant
5 TOP LOSERS payment solution, Setel, with Boost that was relative to e-wallets, which
OCTOBER 20, 2020 launched this month will serve as an account for less than 5% of
example of interoperability between e- all transactions.
STOCK VOL CLSG (RM) RM wallet operators.
NESTLE 46,700 139.40 2.60 “The players themselves
PETDAG 347,700 17.90 0.98 Overall, he acknowledged that the have to do a fair bit to ensure
F&N 43,400 31.10 0.46 industry has started to defragment, as the top interoperability is a reality and
SPERMX 21,641,200 10.36 0.34 four e-wallet players account for an estimated not just a big banner
FANG-2XL 7,000 0.26 90% of all e-wallet transactions in Malaysia. statement.”
9.69
On the regulatory side,

EXCHANGE RATES OCTOBER 20, 2020 Cathay Pacific to cut 6,000 jobs: Report

Foreign currency Bank sell Bank buy Bank buy HONG KONG: Hong Kong’s Cathay Pacific A Cathay Pacific employee walking past a ticketing counter at Hong Kong International Airport
Airways Ltd will cut around 6,000 jobs, or yesterday. The airline will sacrifice Cathay Dragon but staff and resources of the two airlines will
1 US DOLLAR TT/OD TT OD 18% of its workforce, and axe regional brand be merged, the South China Morning Post reported. – REUTERSPIX
1 AUSTRALIAN DOLLAR 4.2060 4.0780 4.0680 Cathay Dragon to help it weather the
1 BRUNEI DOLLAR 2.9830 2.8620 2.8460 coronavirus pandemic, the South China carrier HK Express. outside Hong Kong for storage. On Monday,
1 CANADIAN DOLLAR 3.0950 3.0030 2.9950 Morning Post reported yesterday, citing Cathay had refrained from major job cuts the airline said it expected to operate less
1 EURO 3.1870 3.0990 3.0870 sources. than 50% of its pre-pandemic passenger
1 NEWZEALAND DOLLAR 4.9580 4.7940 4.7740 but Singapore Airlines Ltd has announced flight capacity in 2021.
1 SINGAPORE DOLLAR 2.7830 2.6780 2.6620 The airline said in June it was reviewing plans to cut around 20% of positions, while
1 STERLING POUND 3.0950 3.0030 2.9950 its strategy in light of the travel downturn, Australia’s Qantas Airways Ltd has said it Passenger numbers in September fell
1 SWISS FRANC 5.4530 5.2770 5.2570 with “tough decisions” to be announced will cut nearly 30% of its pre-pandemic staff. 98.1% compared with a year earlier due to
100 UAE DIRHAM 4.6070 4.4990 4.4840 during the fourth quarter and analysts border closures, though cargo carriage was
100 BANGLADESHTAKA 115.8500 109.7800 109.5800 expected it would announce major job cuts. Cathay has sent around 40% of its down by only 36.6%. – Reuters
100 CHINESE RENMINBI 5.0520 4.7140 4.5140 passenger fleet to less humid locations
100 HONGKONG DOLLAR That month the Hong Kong government
100 INDIAN RUPEE N/A N/A N/A also led a US$5 billion (RM20.97 billion)
100 INDONESIAN RUPIAH 54.8500 52.0900 51.8900 rescue package for the airline, which has
100 JAPANESE YEN 5.8300 5.2700 been burning through around HK$1.5
100 NEWTAIWAN DOLLAR 5.4700 billion to HK$2 billion (RM803 million to
100 PAKISTAN RUPEE 0.0297 0.0267 0.0217 RM1.07 billion) of cash a month.
100 PHILIPPINE PESO 3.9890 3.8610 3.8510
100 QATAR RIYAL The South China Morning Post said the
100 SAUDI RIYAL N/A N/A N/A airline was expected to announce the job
100THAI BAHT 2.6400 2.4600 2.2600 cuts today, adding the figure had been
8.7900 8.2700 8.0700 reduced from 8,000 layoffs after government
116.7400 110.8200 110.6200 intervention.
113.3500 107.6100 107.4100
14.0800 12.4800 12.0800 The newspaper, citing unidentified sources,
said the airline will sacrifice Cathay Dragon but
Source: Malayan Banking Berhad/Bernama staff and resources of the two airlines would be
merged. Cathay declined to comment.

The airline last month said it would not
apply for further government employment
subsidies for its main business units,
allowing it to make job cuts at Cathay Pacific
and Cathay Dragon, though not at budget

12 theSUN ON WEDNESDAY | OCTOBER 21, 2020 What’s next for the finance
SUNBIZ function in the new normal?

Komarkcorp unit gets o Deloitte: Shift towards digitalisation an opportunity for CFOs Impairment testing for financial assets using
ISO certification to rethink ways on how to pair humans and emerging technologies the expected credit loss model, in particular,
for face masks, PPE emerged as one particular area of concern
PETALING JAYA: Five imperatives that CFOs make informed decisions as they look to unlock among CFOs.
KUALA LUMPUR: Komarkcorp Bhd’s should look at in the new normal are to value and growth in the new normal.
subsidiary Komark Mask (M) Sdn Bhd reimagine and adapt business models, invest in Liquidity and credit risks are perennial top-
has received its ISO accreditation from digital transformation, rethink the future of “Reporting activities have increased, as C- of mind issues for CFOs especially when taking
the regulators, confirming its premises, work, increase risk and cyber resilience as well suites, boards, and even regulators demand into consideration the impact of BNM’s loan
facilities, and manufacturing standards as restructure to stay relevant and seize merger more frequent updates and projections. To moratorium.
are in accordance with the requirements and acquisition (M&A) opportunities, provide more informed forward-looking
of the international quality management according to Deloitte Malaysia. estimates, CFOs will need to take into account “CFOs also need to consider optimisation of
system for medical devices. the impact of the stimulus package and the risk-weighted assets, setting up early warning
Its consulting executive directors Timothy uncertainty associated with the pandemic systems as well as reviewing the current capital
In a statement yesterday, Ho and Cheng Yen Chu, and audit & assurance trajectory, especially in areas such as capital, and liquidity contingency menu of options and
Komarkcorp said it will now be a fully partner Joshua Yan said, first, with consumers liquidity, and asset quality.” refining the available recovery indicators,” they
accredited manufacturer of disposable forced to use web or mobile banking said.
surgical face masks and plans to alternatives, there is no better time to shift focus Third, while banking services are regarded
accelerate its plan to increase to digital banking. CFOs recognise that the as essential service, more than 70% of banking With most CFO’s recognition that cyber
production and launch its own brand. ability to respond quickly to market needs with staffs worked from home during the MCO. This security risks are magnified during a crisis and
new business models is key to enabling them to arrangement was deemed impossible only few its aftermath, they will need to review their
The group is looking to double its gain a competitive edge. months back but is now being considered as a business continuity programmes, pandemic
current capacity of 3.5 million pieces of permanent option for certain staffs or function. scenarios, and management practices and
masks per month by the end of “Consumer buying patterns have radically ensure that they are defensible and aligned
November, with the installation of shifted as a result of social distancing measures. “The marked shift towards digitalisation is with the applicable cyber security and privacy
additional machine lines. The most nimble financial institutions have an opportunity for CFOs to rethink the ways requirements, fiduciary duties, and industry
innovated and scaled alternative digital models their finance team and the rest of the expectations – even in a remote setting.
Komarkcorp, which announced its to stay engaged with their customers during organisation pair humans and emerging
diversification into face masks months this period. However, the real challenge is to technologies, such as artificial intelligence, and Lastly, on restructuring and grabbing M&A
ago, is planning an accelerated push of analyse customer behaviour and find the right approach them not as a substitute for human opportunities, given the emergence of new
its own brand of masks into local and offerings, as well as marketing and promotion skills, but as a means to augment them. This consumer behaviours and increased e-
regional markets, utilising its operations channels to fulfil customer needs,“ the trio said view can enable organisations to streamline commerce uptake during the pandemic, the
in Thailand, Singapore, and Indonesia to in a statement. costs while enhancing value creation by the consumer sector is one industry that is
capture the current rising demand. workforce.” expected to witness increased M&A activity.
Second, Covid-19 has accelerated the focus This, in turn, could also have spill-over effects
With the ISO accreditation, Komarkcorp on digital. CFOs also recognise the importance Fourth, with Covid-19, certain key on other financial service players such as
will also explore the extension of its of having digital finance systems in place to accounting and disclosure considerations may payment platforms and other fintech players.
diversification to include personnel arise both in the short and long-term.
protective equipment (PPE) production to “CFOs should consider strategies to
take advantage of the current surge in collaborate or acquire nimble fintech players to
demand due to the third wave of the Covid- safeguard existing markets, accelerate recovery,
19 pandemic in Malaysia. and position themselves as market leaders.”

“With the Covid-19 pandemic Group’s Q1’20 PBT was bogged down by the one-off expenses of RM3.5 million incurred in relation to QuicKash in deal to
expected to reach new levels during the the acquisition of Aeon Mall Kinta City. – KIP REIT WEBSITE provide financing
coming winter months, demand is to used-car dealers
expected to pick up drastically,” it said. KIP Reit earnings halve in Q1
PETALING JAYA: QuicKash Malaysia Sdn.
Komarkcorp has announced plans to PETALING JAYA: KIP Real Estate Investment for Q1’21, which includes a non-taxable portion Bhd, a licensed P2P financing platform
install up to 30 face mask production Trust’s (KIP Reit) net profit for its first quarter of 0.85 sen per unit derived from capital wholly owned by ManagePay Systems Bhd,
lines within the next 24 months, ended Sept 30, 2020 (Q1’21) fell 52.3% to RM8.85 allowances and tax-exempt income. Based on will be providing floor stocking financing to
particularly the three-ply surgical face million from RM18.55 million a year ago mainly the closing price of 80 sen on Oct 20, the 365 Resources Sdn Bhd-recruited used-car
masks and KN95 masks, with targeted on lower net investment income. annualised DPU gives a yield of 7.95%. dealers secured by vehicle(s) as collateral
annual production capacity of up to 522 and guarantee.
million three-ply surgical face masks It noted that the realised profit before tax Commenting on the financial results, KIP Reit
and 120 million KN95 face masks. (PBT) was 65.2% higher at RM8.8 million versus Management Sdn Bhd managing director Datuk As part of the deal, participating used-car
Q1’20’s RM5.3 million, despite the amortisation Chew Lak Seong said amid the current economic dealers will be able to access financing of up to
Group CEO Koh Chie Jooi said with of rental rebates of RM700,000 during the quarter. climate’s uncertainties and softer consumer 70% of the transaction value of the used cars.
the ongoing trade war between US and In addition, Q1’20 PBT then was bogged down by sentiments, KIP Reit recorded a higher (realised)
China, there is a concerted push to obtain the one-off expenses of RM3.5 million incurred in PBT despite amortising the (RM700,000) rental 365 Resources CEO Soh Chee Kang said
supply of non-China manufactured face relation to the acquisition of Aeon Mall Kinta City. rebates during the quarter under review. traditional financing avenues do not usually
masks. – Bernama cater to used-car dealers, often forcing them
Its revenue dropped 1.4% to RM18.23 million He said shopper traffic has gradually to raise money from lenders that charge
Astral Asia to expand from RM18.49 million in the same quarter last year. normalised albeit at a muted rate at all its malls hefty interest rates, which are then passed
into e-commerce since the implementation of the recovery MCO on to used car buyers, who sometimes fail to
Net property income rose 3.7% to RM14 back in June 2020. find much value in purchasing used cars,
PETALING JAYA: Astral Asia Bhd intends million from RM13.5 million recorded in the instead of a brand new car.
to diversify into e-commerce and related preceding year’s corresponding quarter mainly Operationally, he added that proactive
activities going forward, in addition to its attributed to a 15.2% decline in property measures will continue to be taken. “After extensive market research and
plantation, investment, property operating expenses. advice from our associate company Semangat
development and construction segments. “However, as the government has reimposed Anggun Auto Sdn Bhd (SAG Group) with their
For the quarter under review, income the conditional MCO to curb the rising Covid-19 deep experience in the industry, we decided
According to its Bursa disclosure, the available for distribution was RM9.8 million, up cases in Selangor and Sabah, we remain vigilant to set up the business and go into bed with
group aims to launch a new e-commerce by 62% year-on-year, mainly due to the higher given the uncertainties and the impact on QuicKash to close the gap,” he said.
business in December this year via its realised PBT. consumer sentiments which may cause the
wholly owned unit Clean Link Sdn Bhd. portfolio’s performance to be flattish for the QuicKash will provide seamless process
The manager of KIP REIT has declared a first remainder of the (financial) year,” said Chew. and, through automation and technology,
It revealed that the venture will entail interim distribution per unit (DPU) of 1.55 sen speed up and lower the cost to serve the
a fully online webstore which will financing needs of these SMEs in an efficient
initially specialise in cleaning products and effective manner while 365 Resources,
catering to a female and internet-savvy as the appointed programme manager for
market. the collaboration will actively offer the
product to SMEs in the used car business.
Astral Asia’s board explained it chose
cleaning products for the initial offering, The project will start with an initial target
due to the heightened attention given to of RM30 million and will offer investors a
cleanliness to curb the spread of Covid- guaranteed return.
19 pandemic.
“The collateralised floor stocking
It also stated that it will have financing will be offered to 100 car dealers
competitive pricing to conventional brought to us by 365 Resources and SAG.
retail stores, as well as more specialised Each car dealer may put up to 10 cars as
cleaning products not typically found in collateral with maximum sum per car capped
such outlets. at RM30,000. We will expand the offering
thereafter to reach out to more SMEs” said
With that, the group seeks to obtain ManagePay managing director and QuicKash
approval for the proposed diversification acting CEO Datuk Chew Chee Seng.
from its shareholders at an extraordinary
general meeting (EGM) to be held in the
fourth quarter of 2020.

It estimated an initial investment cost
of RM500,000 for the venture, which
includes website setup cost, storage
equipment, inventory cost and
marketing cost.

Clean Link intends to also venture
into commercial/industrial cleaning
products and services in the future.

13theSUN ON WEDNESDAY | OCTOBER 21, 2020
SUNBIZ

Aneka Jaringan closes at
29 sen in ACE Market debut

PETALING JAYA: Piling and Speaking at the virtual listing From left: Aneka Jaringan executive director Loke Kien Tuck, Tan, managing director Pang Tse Fui and executive director Chong Ngit
foundation specialist Aneka ceremony aired yesterday, Aneka Sooi marking the company’s listing.
Jaringan Holdings Bhd made its Jaringan chairman Datuk Tan
debut on the ACE Market of Bursa Gim Foo said this IPO was the
Malaysia Securities Bhd (Bursa outcome of the efforts and
Securities) yesterday, closing at 29 commitment by the company’s
sen with a turnover of 123.71 team over the years to realise its
million shares. vision.

Aneka Jaringan’s initial public “Just as how our expertise in
offering (IPO) price was 33 sen a foundation gives our clients a
share, translating to a listing solid start, the IPO gave us the
market capitalisation of RM177.57 platform to realise our aspirations
million. It opened at 35 sen with a and accelerate our expansion
volume of 14.44 million shares. plans. I have every confidence
that our team will scale greater
Aneka Jaringan’s IPO attracted heights as we move further into
strong interest, with the portion regional opportunities. This is just
for the Malaysian public the beginning of a new journey for
oversubscribed by 12.68 times. Aneka Jaringan and we look
forward to building more
About RM46.16 million was successes in years to come.”
raised from the IPO of which
RM17.3 million will be used to Alliance Investment Bank Bhd
purchase rotary drilling rigs and was the principal adviser, sponsor,
crawler crane, RM24.26 million to sole underwriter and placement
repay borrowings and RM4.6 agent for Aneka Jaringan’s IPO.
million to defray listing expenses.

FGV: Payments due to AREA partners PNB,
KWAP to develop
industrial & logistics hub
Felda under LLA fully met
PETALING JAYA: AREA Group’s special vehicle,
AREA Industrial Development Holdings Sdn
Bhd, has entered into a joint venture agreement
with Permodalan Nasional Bhd’s (PNB) indirect
wholly owned subsidiary, MIDF Property Bhd
are considered old trees (more than 21 years). and Retirement Fund Inc (KWAP)’s wholly
o Plantation giant says agreement states sum payable is In addition, 15,000ha of land a year was owned subsidiary, KWEST Sdn Bhd, for the
allocated for replanting, contributing to the development of a 220-acre industrial and
RM248m a year plus 15% of operating profit from the land reduction of FGV’s income. logistics hub in Kota Seri Langat, Selangor.
FGV revealed that replanting expenses for The gated project, dubbed Compass@KSL
the 15,000ha were in the range of RM300 will have a gross development value of RM1.4
PETALING JAYA: FGV Holdings Bhd has LLA is allowed. FGV said it will follow the million a year. In addition to this, the cost of billion with an integrated suite of services for
refuted the Federal Land Development procedures outlined in the LLA if Felda issues fertilisation and rehabilitation is RM300 logistics & e-commerce operators,
Authority’s (Felda) statement that it should a notice on this matter, million a year. manufacturers as well as light and medium SME
receive RM800 million a year from the land “The assets involved in the LLA are estates “FGV chooses to replant and upgrade the industries.
lease agreement (LLA) between Felda and and do not include FGV’s oil palm mills. If estates in order to achieve long-term It will offer ‘built-to-suit’ warehouses and
FGV. Felda wishes to purchase FGV’s oil palm mills sustainability. As a result, FGV has been able manufacturing facilities for sale or lease from
FGV said the agreement stated that the it should be based on ‘willing buyer, willing to reduce the percentage of old trees by about 100,000 sq ft to 1 million sq ft, while smaller
amount payable to Felda is RM248 million a seller’ and current market value. It also needs 30%. The LLA land is better and much detached factories of 8,000 sq ft to 50,000 sq ft
year plus 15% of the operating profit from LLA the approval of other shareholders through an improved compared to those given to FGV will be ‘built for sale.
land. EGM,“ FGV said. during the IPO.” In a joint statement, AREA highlighted that
“To date, FGV’s responsibility towards It further clarified that when the LLA was On the FGV IPO which is often said to be the industrial and logistics hub has been
Felda (according to LLA) amounting to signed in 2011, the price of crude palm oil the cause of Felda’s failure and downfall, FGV conceptualised to leverage on the demand for a
RM248 million a year has been fully met. FGV (CPO) was at around RM3,000 a tonne and the responded that the real issue is the use of new breed of warehouses that are emerging
has paid more than RM2.5 billion to Felda projected income of Felda (through LLA) used revenue from the IPO, and not the IPO itself. due to the disruption arising from the arrival of
from 2012 to 2019,“ FGV said in a statement the price of RM2,800 a tonne. CPO pricing “Felda has earned RM5.7 billion from this the 4th Industrial Revolution and the impact of
yesterday following news that Felda intends to plays the most important role in determining IPO while FGV has earned RM4.5 billion. FGV the Covid 19 pandemic.
reclaim some 350,000ha of land that it leased the company’s profit or loss. After the initial cannot comment on how Felda use the The development is expected to contribute to
to FGV as a means to shore up its financial public offering (IPO) in 2012, the payment to proceeds from the IPO. Unfortunately for the growth of high-impact industries and provide
position. Felda from FGV did not meet Felda’s FGV, part of the proceeds was not well the catalyst for Selangor’s industrial parks.
It added that Felda has yet to contact FGV projections due to the decline in CPO prices. invested. Up until end 2018, FGV has made PNB president and group chief executive,
to negotiate matters regarding the LLA. Under The yield on FFB was lower than expected substantial impairments amounting to Ahmad Zulqarnain Onn commented that the
the terms of agreement, termination of the as 50% of the trees inherited by FGV in 2012 RM780 million for those new investments.” partnership is in line with the institution’s real
estate investment strategy.
“In addition, this collaboration with AREA
Maybank says more than 99% repayment and KWEST will positively contribute to the
development of Kota Seri Langat, the township
established by PNB Development Sdn Bhd,” he
assistance applications approved said in a statement.

KWEST’s CEO, Sufian Abdullah, said the
property development investment arm looks
PETALING JAYA: Malayan Banking Bhd “We are still in the midst of processing finance centre nationwide. forward to realising the opportunities in the
(Maybank) said more than 99% of additional applications given that there has However, for those who need to visit project.
applications for repayment assistance that been the last minute rush from those who Maybank branches for specific purposes, they Meanwhile, AREA executive chairman Datuk
have been processed as at Oct 15, 2020 have have come in after Oct 1. now have the added convenience of using the Stewart LaBrooy revealed that the group has
been approved. The applications comprise “Maybank is ever ready to continue recently launched Maybank EzyQ online worked on the opportunity for over four years
applications by both individuals and small supporting our customers and those who appointment management system to since identifying the site and it is delighted to
and medium enterprises (SMEs) who are need assistance can still contact us to discuss schedule their visits. have PNB and KWEST as its partners.
seeking additional financial support following repayment packages to suit their current
the end of the six-month blanket loan financial needs,” he said.
moratorium on Sept 30, 2020. Chong also said that over 85% of the China still top foreign investor in manufacturing
Of these approved applications, some 38% Maybank’s retail customer base have
have been granted a further moratorium on continued to service their loans/financing as
the repayment of their loans/financing. usual from Oct 1. KUALA LUMPUR: China remains Malaysia’s two-way trade hit US$123.96 billion.
The repayment assistance packages He added that apart from repayment largest foreign investor in the manufacturing “Despite the current Covid-19 pandemic,
include additional months’ deferment of loan assistance, the bank continued to offer sector – for four consecutive years since 2016 – Malaysia and China continued to show sincere
or financing repayments for those recently financing solutions to its various customer with 32 foreign direct investments (FDIs) friendship to support each other and overcome
unemployed as a result of the Covid-19 segments, including SMEs and micro-SMEs amounting US$452.43 million (RM1.88 billion) difficulties together in these trying times.
pandemic, as well as reduction of loan or seeking to sustain and grow their businesses. approved in the first six months of 2020. “And I hope the corporate elites from both
financing repayments for those with reduced In view of the current CMCO restrictions Deputy International Trade and Industry countries would continue to collaborate in
income. in certain regions within the country, the Minister Datuk Lim Ban Hong said Malaysia sectors such as digital economy big data,
Maybank group CEO of community bank is encouraging customers who wish to approved 79 FDIs worth US$3.74 billion from innovative economy, as well as industrial
financial services Datuk John Chong said apply for repayment assistance to do so China last year. innovation and modern agriculture,” he said
Maybank has already processed some 81,000 through the following channels: online via In terms of total trade, trade between when delivering his keynote address at the 10th
applications from these two categories of Maybank2u, applying via email, or calling Malaysia and China stood at US$80.06 billion Malaysia-China Entrepreneurs Conference 2020
customers. any Maybank branch, SME centre or auto from January to August 2020, while in 2019, the held virtually here yesterday. – Bernama

14 theSUN ON WEDNESDAY | OCTOBER 21, 2020
SUNBIZ

Didi lines up 2021 IPO in Hong Kong

HONG KONG: China’s top ride- o China’stopride-hailingfirmtargetsmore The plan also comes after Didi Didi said it had not engaged in any
hailing firm Didi Chuxing is than US$60b valuation walked away from talks on merging merger discussion with Meituan.
considering Hong Kong for a with domestic rival Meituan,
multibillion-dollar initial public the private fundraising round ahead “definitive” IPO plan or timeline. The according to four separate sources, Didi had for years aimed for a US
offering next year, dropping previous of it have not been reported before. people familiar with the matter amid disagreement on the valuation IPO because of the prestige of a New
aims to list in New York amid rising cautioned the IPO plan could change of the merged business and York listing, the presence of
Sino-US tension, people with Asked by Reuters to comment, due to market conditions. management lines. These four people comparable peers like Uber and Lyft
knowledge of the matter said. Didi said it doesn’t have any declined to be identified because the and a deeper capital pool, according
information was private. to two of the people.
Didi, backed by technology
investment giants SoftBank , Alibaba Meituan declined to comment. Uber and Didi have long-standing
and Tencent, has started initial talks links: Uber in 2016 sold its operation to
with investment banks for the long- IPO plan comes after Didi walked away from talks on merging with domestic rival Meituan amid disagreement on the Didi in exchange for a 17.5% stake in
awaited IPO, according to three valuation of the merged business and management lines. – REUTERSPIX the Chinese firm, which in turn made
people. It’s looking to formally a US$1 billion investment in Uber.
appoint lead banks for the float in the
coming months, two of them said. All three people familiar with the
matter said Didi has now opted to
The people spoke on condition of consider Hong Kong for the listing
anonymity as the information, amid deteriorating US-China
including the identity of the banks, relations that have left tech firms like
was private. TikTok owner ByteDance in the
crosshairs.
The people said Didi is targeting a
valuation of more than US$60 billion US-listed Chinese companies now
(RM248 billon) by the time of IPO also face tightened scrutiny and
launch, expected as soon as in the stricter audit requirements there.
first half of 2021. Founded eight years
ago, Didi began generating healthy Uninspiring stock performances
profit in the second quarter this year by Uber and Lyft have also
and some investors are now keen to discouraged Didi from seeking a US
cash in, said one of the people. IPO, said two of the people. Uber and
Lyft are both trading below their IPO
Didi is also considering a new price, with Lyft shares down more
fundraising round ahead of the IPO in than two-thirds since listing.
a bid to boost its valuation, two of the
people said. In the private secondary If completed, Didi’s IPO would
market, some of its shares are trading further burnish Hong Kong’s status as
well below a valuation of US$56 a capital markets hub, with US$28.8
billion it reached in 2017. billion worth of IPOs and secondary
listings carried out in the city between
The new timetable for the IPO and the start of this year and mid-October,
Refinitiv data showed.

SK Hynix in US$9b deal for Intel’s NAND chip business Thailand’s economy
faces severe shocks,
SEOUL: The world’s second-largest said it will acquire Intel’s “entire in DRAM”. Their combination will see SK slow recovery
chipmaker South Korea’s SK Hynix, NAND business division excluding Analysts said it would also boost Hynix leapfrog Japan’s Kioxia –
announced a record US$9 billion the Optane division” for 10.3 trillion formerly Toshiba – and Western BANGKOK: Thailand’s economy
(RM37 billion) deal yesterday to buy won (RM37 billion), with Intel’s its ability to compete with Samsung Digital of the United States into faces severe shocks from the
Intel’s flash memory chip operation as factory in Dalian, China, included in Electronics, the market leader in second place with a NAND market coronavirus pandemic and a
it seeks to bolster its position against the deal. both the NAND and DRAM sectors. share of more than 23%. recovery is expected to take at least
rival behemoth Samsung Electronics. two years to get back to pre-
It is the largest-ever acquisition The pair are engaged in ferocious “With the deal, the company has pandemic levels, the country’s new
SK Hynix is already the world by a South Korean company, ahead competition around the world, firmly cemented its second-largest central bank governor said
number two maker of DRAM chips, of Samsung Electronics’ US$8 billion supplying chips to customers from position in the global semiconductor yesterday.
used in computers and servers, but purchase of US audio and car parts American giants such as Apple and industry,“ said Ahn Ki-hyun, vice-
has lagged in the market for flash maker Harman International in Dell to Chinese companies, and president of the Korea Southeast Asia’s second-largest
memory NAND chips in everyday 2016. demand has boosted their profits in Semiconductor Industry Association. economy, which is heavily reliant on
devices such as smartphones and recent years. trade and tourism, could shrink a
USB storage drives, as well as SK Hynix CEO Seok-Hee Lee said “In the long run, the deal paves a record 7.8% this year, with tourism
industrial and medical equipment. in a statement it would give his firm SK Hynix ranked fourth by global way for it to become more badly hit, the Bank of Thailand
a NAND flash market position NAND sales in the second quarter this competitive against Samsung,“ he (BOT) has predicted.
In a regulatory filing, SK Hynix “comparable with what we achieved year, according to market researcher added. – AFP
Trendforce. Intel was sixth. Economic problems can be
solved but it will take time as there
Bank of Japan tipped to cut growth, inflation forecasts are “no magic bullets”, governor
Sethaput Suthiwartnarueput told
TOKYO: Japan’s central bank is of this fiscal year’s growth economy to contract 4.7% in the The BOJ’s current projection is for his first briefing.
expected to cut its growth and price projections, a view echoed by two current fiscal year ending March core consumer prices to fall 0.5% this
forecasts for the current fiscal year at other sources. 2021. That is less pessimistic than a fiscal year. “The shocks are very severe, most
next week’s rate review, sources 6.0% fall projected in this month’s notably on tourism,“ he said, adding
familiar with its thinking said, as the The main reason for the Reuters poll. The central bank is widely the sector could lose 1.6 trillion baht
coronavirus pandemic weighs on downward revision in growth is the expected to keep monetary policy (RM211 billion), or 10% of gross
the economic recovery. bigger-than-expected economic The BOJ’s July forecasts were steady at the rate review on Oct 28- domestic product, with foreign
slump in April-June and soft compiled before the release of data 29, when it will also release the fresh arrivals expected at 6.7 million this
But any such downgrade is consumption during the summer, that showed Japan’s economy quarterly growth and inflation year, compared to nearly 40 million
unlikely to trigger an immediate the source said. shrank an annualised 28.1% in April- projections. in 2019.
expansion of monetary stimulus, June, its worst postwar slump.
with the Bank of Japan (BOJ) “Risks are skewed to the The board is unlikely to make But the country had a strong
expected to maintain its assumption downside,“ a second source said, The nine-member board is also major changes to its growth and external position to withstand any
that the world’s third-largest adding that weak service-sector seen slightly trimming its inflation price forecasts for fiscal years ending shocks, said Sethaput.
economy will post a moderate pick- spending and prospects of deeper forecast for the current fiscal year, March 2022 and 2023, the sources
up, the sources said. cuts in capital expenditure cloud the due largely to the impact of a said. The economy, which suffered its
outlook. government campaign offering worst contraction in 22 years in the
“It’s somewhat weaker than three discounts for domestic travel, the The sources spoke on condition June quarter, is expected to post
months ago,“ one of the sources said In the most recent projection sources said. of anonymity due to the sensitivity of some growth in the second quarter
made in July, the BOJ expects the the matter. – Reuters of next year, he said.

Sweden bans Huawei, ZTE gear ahead of 5G spectrum auction Sethaput said BOT would ensure
that monetary policy and liquidity
STOCKHOLM: Swedish regulators Security Service. ordered Huawei equipment to be functions by Jan. 1 2025. would not hinder the recovery.
yesterday banned the use of telecom European governments have purged completely from Britain’s 5G The regulator defined central
equipment from China’s Huawei network by 2027, becoming one of “Our policy rate is the lowest in
and ZTE in its 5G network ahead of been reviewing the role of Chinese the first European countries to do so. functions as equipment used to this region and a record low with
the spectrum auction scheduled for companies in building their build the radio access network, the limited room, so other measures,
next month. networks following pressure from the Huawei and ZTE did not transmission network, the core including fiscal ones, will have to
United States, which says they pose a immediately respond to requests for network and the service and play a major role,“ he said.
The Swedish Post and Telecom security threat because, among other comment on the decision by maintenance of the network.
Authority (PTS) said the setting of concerns, Chinese companies and Sweden. BOT has cut the key rate three
the licence conditions followed citizens must by law aid the state in PTS said the licence conditions times this year to an all-time low of
assessments by the Swedish intelligence gathering. PTS said companies taking part were decided to address the 0.5% to support the economy. It will
Armed Forces and the Swedish in the auction must remove Huawei assessments made by the armed next review policy on Nov. 18, when
The United Kingdom in July and ZTE gear from existing central forces and security service. – Reuters analysts expect no change.

BOT would encourage capital
outflows to help ease the baht
strength, Sethaput said. – Reuters

CELEBRITY CAUSES 15theSUN ON WEDNESDAY | OCTOBER 21, 2020
LIFESTYLE

(far left) Fong
joined Klima
Action Malaysia
in Sept 2019 for
the global
climate strike.

█ BY JASON LIM Standing in solidarity Fong (left) at
EVERY day seems to bring the Women’s
another social crisis, but the March Malaysia
solidarity at the heart of many 2020 in
collective liberation conjunction
movements happening across the o Environmental and human rights activist Nicole Fong speaks about with
globe – from #Brexit in Europe, to climate justice and the collective consciousness International
#BlackLivesMatter in the United Women’s Day. –
States and #MigranJugaManusia in COURTESY OF
Malaysia – offers a glimmer of light at NICOLE FONG
the end of the tunnel. Fong wants to inspire young people
Nicole Fong explains: “The very highlighting, so that it’s always for the political participation. nothing in a system that will always to get involved in activism and
act of being in solidarity with others is community, led by the community.” “The courage of young people prioritise the rich and powerful. advocate for causes important to
the ultimate act of radical love, as it is Climate justice transcends beyond them. – COURTESY OF NICOLE FONG
a way for us to dream and manifest the physical nature of global during the rallies organised by Klima “So the very act of being in
the kind of society and country we warming, it also explores Action Malaysia last year not only solidarity breaks this cycle of
want to work towards.” humanity’s collective rights as an inspired me to work towards fighting oppression which by default is meant
The 26-year-old data analyst, ethical and political issue. Who are for climate justice, but to also hold to make you feel powerless, isolated
researcher and activist who works the most susceptible to the effects of myself to higher standards of and divided.
full-time at an education NGO, also the climate crisis in the country? accountability in using my privilege
divides her attention between “Climate justice is an intersectional and resources for this movement. “And this is threatening to
grassroots organisations such as movement advocating for the those in power who
Queer Lapis, Klima Action Malaysia protection of both people and the “Having witnessed the success of benefit from things
and Zero Waste Malaysia. planet. It acknowledges that the ‘Parlimen Digital,’ I envision a future staying the same,
During her time abroad studying injustices faced by marginalised where we have a movement of young because suddenly
for her undergraduate and communities and the planet are leaders championing for climate when we’re united,
postgraduate degree in Economics, interconnected and that we cannot justice and calling for swift action our voices are
Fong experienced the downside of fight for one without the other. through protests.” amplified and they
being a minority in a Western country. Where does solidarity come from? are forced to listen
“I faced sexual harassment and “It amplifies voices of “Solidarity is grounded in a love ethic to what we have to
marginalised communities (Orang where everyone stands together as say as a collective.”
Asli and Asal communities) who are one and acknowledges the collective
assault as a woman, and had to most affected by it, and puts them at humanity in others, regardless of All the activism on
navigate racist and xenophobic the forefront of the movement. It gender identity, sexual orientation, top of your recent
abuse,” she revealed. means moving away from a ethnicity, body size, and class. dispute with the
“That led to developing my own neoliberal, colonial, extractive way of authorities over
awareness of the discrimination that operating that allows for the “To me, solidarity is about LGBT+ rights
marginalised communities face, economically wealthy to sustain their embodying this element of ‘I see you, seems like a lot on
along with the systemic and societal high consumption levels and shift the I hear you, and I will stand with you your plate. Where does
factors that contribute and shape this ecological burden onto developing no matter what’. It’s about being self-care start within
oppression. These experiences made countries in the Global South.” critical and speaking out against yourself?
me confront my own privilege, and How do you view protest: is the injustices, even when it’s disruptive to “It starts by breaking away
increased my understanding of demonstration an expression of do so. This can look like listening to from what I’ve learnt growing
oppressed people back home in political solidarity amongst youths different perspectives, speaking out up, such as tying my self-worth to
Malaysia.” and civil society? on your social media, signing a my productivity. And having a
By working directly with “Young people are the driving force of petition, writing to your MPs, narrow view of success strictly
marginalised communities, Fong the climate justice movement, as attending a protest, or even as simple defined by achievements and goals
hopes to build a just and equitable evidenced by the emergence of a as starting a conversation with your has set an extremely high,
Malaysia, where oppressed diverse group of young climate friends or family about an issue.” unrealistic expectations for myself.
communities are liberated from activists all around the world leading But oftentimes, solidarity is banned “I want to work towards a mindset
systems of oppression and can live protests and calling for climate action or even silenced by the authorities. that treats rest as a form of healing,
with dignity, free from discrimination, in their own countries. Why is it seen as a threat? liberation and resistance, by learning
abuse, and violence. “Many of us have been conditioned how to set boundaries with my work
She shares: “Community is one of “However, young people are still to believe that we don’t have the right so that I have time to rest and recover.
my core values, along with love, underrepresented in most civic to demand for change and question Self-care also means aligning myself
justice and equity. I always aim to engagement spaces, particularly in the laws that govern us as citizens, in my locus of control so that I know
make my activism as relevant and that our voices and stories mean how I am able to help to the best of
reflective of the community I’m my capability.”

Japanese theme park becomes new office for teleworkers

Yamamoto THE coronavirus pandemic has Employees at his company are per person on weekdays, and 2,000
works on a pool turned one Japanese theme park into also working remotely, Yamamoto yen (RM78.50) for weekends and
deck chair at a new workplace for teleworkers, with said. holidays, including a workspace
Amusement a haunted house for the bargain. rental on the pool side, and a ride on
Workation; and A third of Japanese firms are the giant ferris wheel, as well as after-
(inset) Last week, Yomiuriland, an reassessing using offices as 65% of work free golf balls at a driving range
Yamamoto and amusement park in Tokyo, firms allowed or encouraged inside the park.
his business employees to work from home due to
partner use launched an “amusement the pandemic, a Reuters poll showed About ten customers including
laptops while workation” package to in August. Yamamoto used the park with roller
they have a include a working booth coasters and a haunted house as their
meeting on a next to its pool, and a ride Many workers in Japan, and alternative office at the launch.
Ferris wheel. on its observation ferris globally, began telecommuting as the
wheel with a portable coronavirus spread and governments On the slowly moving ferris wheel,
WiFi router. imposed strict restrictions to contain Yamamoto dialled into an online
“I love working it. conference call and showed off the
outside. This is a good height to his co-workers through a
plan, and it feels great,” Several tourists attractions in camera on his laptop.
said Tatsuki Yamamoto, 47, Japan have been hit by the pandemic,
president of a IT solutions and some amusement parks have However, it was hard to focus in
explored other ways to lure visitors. the air, he said.
firm FLEQ, sitting on a white
pool chair with his laptop. The Yomiuriland theme park sells “I don’t know whether to enjoy the
day passes for 1,900 yen (RM74.60) view or do the work.” – Reuters

16 theSUN ON WEDNESDAY | OCTOBER 21, 2020 Mind over matter
FASHION
o Tan Veen Dee, founder of Hanya, vibe checks mental wellbeing with
Embiid wears the UA Embiid One. thebrand’slatestcollectionTINY WINS

Enhance your █ BY JASON LIM moment, but to others struggling with (left, and
performance mental health, this little win is monumental below)
AS AN advocate for women’s issues and I want to celebrate every achievement, Hanya Tiny
UNDER ARMOUR introduces the all new UA and mental health, Hanya founder even the tiniest accomplishments.” Wins
Embiid One, a sneaker that works to enhance a Tan Veen Dee hopes to normalise Why do you think mental health is still collection. –
player’s performance on the court regardless of the conversation around mental such an unspoken social-cultural COURTESY
limits or position, much like its namesake’s illness and break deep-seated stereotype rarely discussed in society? OF HANYA
playing style. Philadelphia 76ers basketball stereotypes with its latest “Our parents, their parents, as well as the
player Joel Embiid’s strength and size collection, Tiny Wins, in ones before them, didn’t have access to the made it substantially worse.
are a threat to his opponents. conjunction with Mental right information about mental health. They “I finally broke down one day, and my
However, his diverse methods Health Awareness Day didn’t know what postpartum anxiety nor
tended to cause stress on the outer earlier this month. depression was; they may have had it but dad asked me: ‘Why are you stressing
side of the foot. Hanya collaborated with they didn’t know what to do about it, thus it everyone out? Why are you causing so much
two artists who wanted to bring their was easier to sweep under the carpet so as to drama?’
This is where the Embiid individual mental health battles to light – not be seen as mentally deranged.
One comes in. For a man Malaysian mixed media artist Nadia “In fact, it was my parents who signed me
with Embiid’s build, the Nizamudin, who suffers from postpartum “Such was my parents’ perception of up for therapy. Ever since then, my parents
potential weight distribution anxiety, and Bangkok-based painter- mental illness when I became sensitive and have been incredibly accepting and
and traction of the shoe ceramist Worama Umpairat (better known overwhelmed by a rollercoaster of emotions understanding, and I’m glad to be able to
provided the support needed by her pseudonym Mamolism) who for months after giving birth to my first child. educate them and erase their negative
for powerful movement while struggles with depression. I’ve always dealt with small bouts of anxiety perception on mental health. It’s not easy for
being light enough to allow throughout my life but postpartum anxiety children to change their parents’ mindsets
much needed stability and Tan believes that self care is how a person because parents have always believed that
mobility. gets his or her power back, whether through they are in the right.”
making art or surrounding oneself with What does mental clarity mean to you?
The Embiid One has an outsole tread house plants (as Tan herself does). “Mental clarity means moments of solitary
pattern that offers grip and traction while the fitted, time where you’re able to have peace of
lightweight mesh in the sneaker’s upper half allows “As human beings, as mothers, as mind.
plenty of air in. women, we selflessly give without a second
thought, we empty our vessel and pour love “For me, it’s when I take care of my
Under Armour’s HOVR and Micro G out as if we have an unlimited supply. With plants. It becomes almost like a temporal
cushioning technologies allow functionality and this collection, Hanya is reminding our escapade, a self-care ritual that allows me to
comfort while the HOVR technology returns women tribe that we must fulfil our soul first, take my mind off things.”
energy to the body, so you stay fresh. we must love ourselves first, and we must
celebrate our own little wins first.”
The Swatch limited edition ²Q watch.
Who is the Hanya girl?
Secret mission “I’ve always envisioned the Hanya girl
as an It-Girl, who’s neither humble nor
THE international success of the SWATCH X 007 arrogant. For this collection, I picture
collaboration has led to a second Swatch release her living in a fancy apartment in the
exclusively for No Time To Die. With extra time on city, having a quiet moment as she soaks
his hands Swatch’s favourite character Q tinkered herself in the bathtub after a long day while
away in his laboratory, making surreptitious overlooking the skyline and city lights; but
additions to his favourite watch. she is crying, which is perfectly fine.
“I love the idea that a woman is able to
The brains behind Q Branch can add Q pick herself up and go about her day and do
(price: RM915) to his list of glorious what she needs to do. She allows herself
gadgets. Turning his first eponymous moments of vulnerability, but still is able to
watch on its head, the Q has a dazzling wipe away her tears and carry on with her
red reverse on the strap with life, ready to face another day.
complementary blue hands and reel. “For some, it’s an inconsequential

The limited edition Q watch is the Fashion is exhilarating and free for all, but
result of a collaboration with Suttirat it also projects some level of anxiety and
Anne Larlarb, the Costume Designer paranoia. Can you speculate how fashion
for No Time To Die. The sheer intensity may affect our mental health?
of Larlarb’s design is evident in this “It’s a lot to do with the unrealistic body
stainless steel SKIN Irony featuring a image and beauty standards. This might be a
tartan plaid brown leather strap, sharp red bit controversial, but because the archetypal
edges and a sun-brushed dial showing off beauty standards have been so heavily
the complex mechanism, joining Swatch ingrained in our minds, that even when we
and Q at 6 o’clock. say all sizes are beautiful, in reality, all
women are still trying to fit into those more
desirable standards.

“If women of certain sizes are presented
with the choice of becoming fit and thin, I’m
confident of saying the majority wouldn’t
even think twice.

“It’s really years and decades of so-called
brainwashing we’ve all been through,
including myself, thinking of fitting into the
normative ideals which shouldn’t be the
case at all. This is also what I’ve been trying
to achieve at Hanya – to be all-inclusive
regardless of shape and size so that everyone
feels comfortable with themselves; that is
the normative ideal we strive for.”

You spoke highly of building a community
in Hanya.
“Community lies at the heart of Hanya, it
really is our driving force from both the
customer and business perspective. It’s not
just about the clothes, but also about
creating content that is relatable to every
woman, by providing support to help build
and grow a wholesome community in the
local scene.

“It gives tremendous satisfaction and
brings such great meaning to me.”

17theSUN ON WEDNESDAY | OCTOBER 21, 2020
BEAUTY

From makeup
to mascne

oHow mask-wearing is changing
beauty habits

FACE masks have now been out by Ifop for the Slow Cosmétique It’s all about eyes for women who are still wearing makeup, even if going makeup-free has been gaining ground since the
made mandatory in enclosed label back in June revealed that 21% end of lockdown.
spaces in many countries of French women surveyed reported
worldwide. They must even wearing makeup every day at the end on lipstick and facial products, others of “mascne” or “maskne” – acne from mask several times a day.
be worn outdoors in cities that are of lockdown, compared to 42% in are favouring more specific products, wearing face masks – which has When it comes to beauty routines,
particularly affected by coronavirus 2017. making way for a new trend – the become a problem since mask-
infections. boom in transfer-proof formulations. wearing was made mandatory. the usual techniques should be
This drop suggests that major reinforced: removing makeup and
Mask-wearing has shaken up changes are afoot in women’s beauty Brands have been offering such These blemishes, or even acne, cleansing skin are now non-
many aspects of our daily lives, right habits. products for several weeks, are caused by the rubbing of the negotiable at the end of a day in a
down to our beauty regimes. From New boom: mascaras and transfer- responding to growing demand from mask and the elastic straps, as well as mask.
makeup to facial care and product resistant products makeup fans who don’t want to give by the fact that facial coverings stop
textures, not to mention acne- And even those who aren’t (yet) fully in to the mask. the skin from breathing. Next, treat skin with a suitable
zapping products, here’s a look at onboard the ‘no makeup’ movement skincare product, and hydrate skin
some of the changes face masks are have seen their habits change. This is Originally developed to stop It’s a problem that can affect every morning before putting your
bringing to your bathroom and your again reflected in the Ifop survey for lipstick transferring during a meal, anyone, at any age – even if people mask back on.
makeup bag, all in spite of the latest Slow Cosmétique, which shows that when sipping a drink or giving a kiss, with blemish-prone skin are more
trends. women who regularly wear makeup these products now seem like the susceptible to the problem – and can It’s a good idea to use more
No makeup: from dream to reality are now paying more attention to ideal solution for mask-wearing require a few tweaks to beauty lightweight textures than usual and to
While plenty of celebrities, such as their eyes, rather than skin and, in times. Note that lightweight regimes. look for non-comedogenic products
Alicia Keys, embraced the ‘no particular, lips. formulations and setting products to reduce the risk of spots, redness
makeup’ face well before the global like powders are also prime choices Before reaching for any kind of and other blemishes.
pandemic, lockdown has changed And the reason, as mentioned to overcome the inconvenience of product to treat mascne, start by
the game profoundly, offering people above, is not only that it isn’t seen, mask-wearing. setting – and sticking to – a few day- Note that foundation can
a real opportunity to accept but also that it simply doesn’t stay on Mascne and other skin blemishes to-day ground rules. contribute to preventing skin from
themselves without makeup. due to the rubbing of the mask You’ve no doubt already have heard breathing too. It’s therefore better to
causing transfer. For example, favour fabric masks, reduce the use of this product if you
This analysis is reinforced by which are more breathable than don’t want to end up dealing with
mask-wearing, which isn’t This observation is supported by surgical varieties, and change your acne. – AFP-Relaxnews
particularly compatible with wearing sales and searches for these products
makeup. As well as hiding carefully online, which confirm the current
made-up faces, masks cause appetite for mascaras, eyeliners and
foundation and lipstick rub-off in a eyebrow products to the detriment of
few minutes, and can increase the lipsticks and facial products.
risk of blemishes.
Interestingly, these products were
Those are three good reasons that all the rage before the public health
have led many women to banish crisis hit, notably driven by trends for
makeup from their beauty routines. contouring, highlighting and baking,
In fact, a poll of 3,018 people carried and the generally sculpted look.

While many women have given up

Are digital facials the future of beauty?

Virtue Labs hair care range. ARE you tempted to turn your Some brands
bathroom into a beauty salon and do are offering
your own facial care, advised by a virtual
trained beautician? beauty
treatments
Lockdown measures have that can be
generated a great deal of frustration done at
in terms of beauty routines. home.

Virtue Labs has landed Both men and women have tempting, a few questions arise. Is it compatible with the French art of
scoured the internet for ideas, tips or really possible to reproduce the – living, the famous “French touch” –
advice to refresh their haircut, do a often highly technical – gestures of which is often inseparable from
THE world didn’t need another kind. The hydrolysed keratin hair colour, or treat themselves to a beauty professionals? notions of conviviality and pleasure?
hair care company. found in most hair care is a moment of well-being through Nothing is less certain.
So they created a biotech fragmented protein sourced from treatments to be performed from And what about the relaxation “In France, people are rather
company to repair animal by- their bathroom. aspect, inherently implied by an attached to beauty treatments in
hair. products like appointment in an institute? salons. I don’t think that this concept
Introducing wool, hooves, While many beauty professionals would function here, unless people
Virtue, a new, and feathers. have reopened the doors of their “Due to Covid-19, many concepts can’t leave their homes. However, in
prestige hair Alpha Keratin salons, some brands are anticipating such as this one are bound to emerge, 10 years, I may say the exact opposite,
care brand born 60ku is extracted a potential second wave lockdown – but they take it from being a moment who knows? But not at the present,”
from a from ethically- or simply looking ahead to the future of advice and relaxation to something stressed Rousseaux, who
remarkable sourced human of the beauty sector – by digitising virtual, devoid of any pleasure. It nevertheless believes that this type of
scientific hair, so it is their skincare offer. ends up being something quite digital concept could be developed in
discovery: recognised by different,” said Dr Isabelle Rousseaux, the future.
Alpha Keratin the body and is That’s the case of Optiphi, a brand aesthetic dermatologist and board Periods of lockdown have helped
60ku. able to fill in from South Africa, which has member of the French Union of shake things up quite a bit all around.
launched digital facials. Dermatologists.
How does it work?
Thanks to areas of To take advantage of these new- When beauty goes digital While beauty professionals have not
this first of its Virtue Labs Restorative Treatment Mask. damage and generation facials, all you have to do Lockdown measures have shown that had time to develop these types of at-
kind repair hair is order one of the three kits offered men and women are ready to switch home products and care, many have
technology, Virtue products can unlike anything else. on the brand’s website, which will be to the digital realm for many services begun to offer online diagnostics,
change the health and quality of This extraordinary delivered to your home, and wait for a in many areas. whether for skin or hair, so that
your hair for good. technological breakthrough is beautician to contact you to set up a However, patterns of everyone can buy the most suitable
Alpha Keratin 60ku is a whole, exclusive to Virtue and is featured virtual appointment. consumption remain very different products or carry out hair colouring
human protein born from in every Virtue product. from one country to another with at home.
regenerative medicine, and it is Virtue Labs is now available During the session, the specificities for each one. Can Solutions that should sooner or
the first and only ingredient of its online exclusively at sephora.my. professional will guide you step by digitising a sector like beauty be later become more widely available.
step to perform the treatment with
the appropriate gestures and mix the
products if necessary, advise you in
relation to your skin type, and
monitor whether your skin reacts well
to the application of the different
products.

While this new approach to
skincare treatments sounds

18 theSUN ON WEDNESDAY | OCTOBER 21, 2020
THE RIGHT READ

French writer IN A CAPSULE █ BY S. INDRA SATHIABALAN
Simone de Beauvoir.
The Ordinary Chaos of Being Human

Unrequited passion 0 Edited by: Marguerite Richards more than they bargained for; the
0 Publisher: Penguin Books hopeful Islam and the End of the World;
THIS is a four year quest by
book editor Richards to find a soldier now coping with
a diverse collection of being a refugee in All for a
shorts stories that capture Worthless Man; a young
the diversity of the modern Bangladeshi-American trying
Muslim world in hopes of to convince her father of her
bridging the divide that choice of a boyfriend in The
exist between them and Unbeliever; and Siren Songs
the non Muslim world. explores a sexual awakening
in a conservative world.
Most of the writers are
new and hence there is a A good collection of
certain degree of freshness stories and highly
in this collection. recommended.

There is the supernatural Caged While these stories may be
Angel where two Yemenis discover an eye-opener for certain people, it
actually reminds us that we are all
somewhat the same.

Well Behaved Indian Women

o Simone de Beauvoir’s tragic love story is finally published 0 Author: Saumya Dave Nandini has done everything she
0 Publisher: Berkley can to ensure her family has a good
A TRAGIC love story that Beauvoir’s personal battle against Catholic family. DEBUT author Saumya’s
Simone de Beauvoir the conventional expectations”. He appears as a charismatic story spans three life in America and that
thought “too intimate” de Beauvoir completed the novel generations, each carrying includes dealing with
to publish during her in 1954, five years after her student in the story, and one of the burden that society and demanding in-laws and
lifetime will finally see the light of feminist masterpiece was his classmates was none other family has inflicted upon putting up with causal
day, 34 years after her death. published. than Sartre. them. racism at work. She only now
realises that there is no such
The great feminist writer It’s theme of “the friendship The pair quarrelled and then Simran Mehta feels thing as the perfect Indian
recounts her teenage crush for between two young women permanently fell out over Soviet judged by her mother woman, and in striving to be
another girl in Les Inseparables, struggling against conventional communism around the time the Nandini who doesn’t think one, she has lost herself.
the story of a “passionate and ideas of what a woman should be novel was written. highly of her desire to be a
tragic friendship between two in early 20th-century Paris” writer. But when a Mimi Kadakia carries her
rebellious young girls.” echoed The Second Sex. By then the object of de charismatic seasoned journalist enters own burden and feels like
Beauvoir’s unrequited love was her life, Simran begins to question her she failed her daughter
But de Beauvoir put the deeply The book’s English publishers, long dead. future as a psychologist and her Nandini. Now she needs to be the
autobiographical novel into a Vintage, said the two girls were engagement to a man the family bridge that brings her daughter and
bottom drawer after her partner expected to be “devout, obedient Some have questioned approves of. granddaughter together. This is an
Jean-Paul Sartre “held his nose” and obliged from a young age to whether Sartre’s rift with interesting story on how we often
when he read it. set aside her own interests and Merleau-Ponty may have also forget to live for ourselves.
passions” for the men in their played a part in de Beauvoir
The author of The Second Sex lives. putting the book to one side. Riverrun
wrote how she became “instantly
charmed by her new classmate”, The writer went on to have “It is said that it was Jean-Paul 0 Author: Danton Remoto the door in his face, or when his father
Elisabeth “Zaza” Lacoin, who several other relationships with Sartre himself who advised De 0 Publisher: Penguin Books tries to teach him to walk like a man.
died of encephalitis at the age of women, some of whom were also Beauvoir not to publish the novel, THIS coming of age story is
21. Sartre’s lovers. considering it of little interest,” set during a tumultous But as he grows older and
the philosopher Paul B. Preciado period in the Philippines other incidences take place,
“From the day I met you,” she De Beauvoir first evoked her wrote in the French daily when President Ferdinand Danilo soon realises that he
wrote, “you were everything for relationship with Zaza in her Liberation. Marcos placed the country is “different”, that he is
me.” Memoirs of a Dutiful Daughter. under martial law in the attracted to men, and that
But Sylvie Le Bon de Beauvoir, 1970s. people like him are not
In the novel, the de Beauvoir The two were so close during the writer’s adopted daughter, welcome in a conservative
character does “her all in order to World War I and the 1920s that thinks that it was she herself who Danilo Cruz, is raised near Catholic society.
make Andree (a thinly-disguised fellow students and teachers at finally renounced it despite an American army base and
Zaza) love her back,” said the their school called them the several rewrites. is deemed different by those This book combines a
2Seas literary agency, who “inseparables”. living in his village. world that is shifting and is
handled the foreign rights for the In the preface to the book – not only about the political
book. Zaza’s relationship with the which will be published in A young Danilo is clueless upheaval brought upon
communist philosopher Maurice English next year – she argued as to why some people seem wary of them by a dictator, but how
The book is described as a Merleau-Ponty, whom she had that de Beauvoir found “the final him like his friend’s mother who slams society forces a person to conform to
“moving, gripping coming-of-age met through de Beauvoir, fictional transcription of [her love a certain set of ideals.
novel” that “outlines Simone de scandalised her traditionalist for Zaza] unsatisfying”. – AFP-
Relaxnews

19theSUN ON WEDNESDAY | OCTOBER 21, 2020
FEATURE

SOAKING up the sun in their Not your
garden, Sergei Abramov and best friend yet
his wife Tatiana are playing
with their furry pet, Plombir, o Siberian scientists breeding
who is wagging his tail and winning foxes for pets eye human link
treats for obeying his owners’
commands. This artificial selection “changes change,” Gerbek explained. over a lack of funding during the fall US geneticist Adam Wilkins told
everything in their body”, said Yuri He added that the team keeps of the Soviet Union in 1991 and the AFP.
But Plombir, whose white fur Gerbek, one of around 15 scientists economic crisis that followed.
matches the colour of the beloved working at the centre that is home to wild as well as tamed foxes “for That is particularly true since the
Soviet ice cream he was named after, almost 1,000 foxes. comparison”. Yet due to a lack of It survived however and has even team is studying the effects of
is not Abramov’s canine best friend. funding, the animals are kept in old won international attention since domestication on foxes’ brains and
In particular, this rigid selection and rusting cages. the emergence of DNA sequencing in particular their levels of oxytocin,
He is actually a fox, bred by has altered foxes’ pigment and Discoveries yet to be made techniques that made it possible to known as the love hormone.
Russian scientists as part of a shortened their muzzles. Belyaev died in 1985 and the study the foxes’ genetic code.
decades-long experiment in Siberia experiment was nearly shuttered Studies have shown that oxytocin
to study how wild animals are “We are trying to understand “The interest of the scientific nurtures protective behaviour,
domesticated. which genes change and how they community remains very strong,” empathy and feelings of love, and it
could play a key role in rendering
Plombir is happy to be led foxes as better pets.
around by his owners on a leash,
but, as he pulls towards chickens But the experiment might also
safe in their cage, it’s clear he hasn’t offer a window into human
lost all his animal instincts. evolution – in particular an existing
theory that our human ancestors
“Yes, he already tried to eat our domesticated themselves, Wilkins
chickens and run away,” says says.
Abramov, 32, who lives in the
suburbs of Russia’s third largest city It is an apt comparison “because
Novosibirsk. many of the changes that
domesticated foxes have undergone
His wife, biologist Tatiana look like possible related changes in
Abramova, 33, admits she always human evolution,” says Wilkins.
wanted to live with a fox.
“Important discoveries are yet to
She concedes that Plombir is be made,” he added. – AFP-
“friendly and kind” but not very Relaxnews
obedient.

“He jumps on tables, or jumps
inside the fridge. He steals things
and hides them,” she says.

Such an energetic animal is
better suited to living outdoors, the
couple have decided, and they set
aside a spacious nook in their
garden as Plombir’s home.
Soviet-era experiment
He enjoys being stroked, he can do
tricks and is always eager to play –
unlikely characteristics for most
foxes, but not surprising given that
he and his ancestors were bred by
scientists to be friendly pets.

In 1959, Soviet geneticists Dmitry
Belyaev and Ludmila Trut launched
the experiment on a farm in the
Akademgorodok scientific research
centre near Novosibirsk.

Their goal was to tame foxes and
understand how these ancestors of
wolves evolved into the loyal and
loving dogs we know now.

For decades, researchers at the
farm have selected the most friendly
animals for breeding. Others were
put down and a small number were
sold as pets.

Are you ready to turn freegan? School absences due to poor air

THE idea of rummaging around To combat consumer waste, freegans salvage unsold goods and food WHAT if the air quality in schools particulate matter in the school
in a dumpster may gross you out, products from supermarket dumpsters. could cause an increase in pupil neighbourhoods, from 2015 to 2018.
but freegans – or dumpster divers absences?
– are only too keen to roll up their alternative lifestyle as a way of the all-powerful chains of the Although the study covered
sleeves and get stuck in. They saying “stop” to food waste, while food industry … by salvaging According to Daniel Mendoza, a elementary, middle and high schools,
have become masters in the art of for others it’s about saving money what they consider fit for the research assistant professor in the the scientists who worked on the
getting food by salvaging it rather – sometimes both. Once you get trash! Department of Atmospheric Sciences study consider that elementary pupils
than buying it, a militant act that into it, the freegan lifestyle has got at the University of Utah and lead may be most vulnerable to the effects
seeks to combat food waste. plenty going for it. It’s also Far from being little more than author of the study, published in of pollution on health.
proving particularly popular an extravagant trend, the freegan Environmental Research Letters,
In a bid to cut food waste, among students. movement above all decries a research is still ongoing, and the “It is possible that health effects,
some people have decided to An anti-capitalist stance global problem, representing evidence isn’t yet conclusive enough such as respiratory tract infections or
delve into the dumpsters left Certain freegans take things even around 1.3 billion tonnes of lost to draw a cause-and-effect asthma exacerbations, may lead to
outside major supermarkets in further, claiming it as an anti- or wasted food each year. relationship between air quality and them missing more school, which can
order to fish out any unsold capitalist movement and children’s absences from school, but have long-term consequences for
foodstuffs. advocating a lifestyle based on While it started with unsold the correlation merits further them,“ says study co-author Cheryl
self-sufficiency. It’s about taking food products, freeganism can be exploration. Pirozzi.
This ecological movement is action to protect the environment extended to other day-to-day
known as “freeganism” – a and the desire to break away from products that can be found in the The study authors analysed data The study reveals that, over the
portmanteau of the terms “free” street, such as clothes, furniture, relating to the presence and absence whole school district, increases in
and “veganism” – which involves electricals and more. – AFP- of pupils in 36 schools in the Salt Lake school absences occurred on days
recovering waste items discarded Relaxnews City School District. following exposure to high levels of
in the evening from the garbage air pollution.
cans and dumpsters left outside Thanks to a network of air quality
supermarkets, grocery stores, sensors installed in the city, the “So what that really leads us to
bakeries, fast-food outlets and researchers were able to compare this think is that even low levels of poor
other businesses selling food. data to levels of ozone and air quality can, in a cumulative
manner lead to negative health
These freegan militants – also outcomes – in this case increased
known as dumpster divers – seem school absences. Even on green air
to have no problem filling up their quality days, when the pollution was
fridges for free. just slightly elevated, if we had
several of those days, then kids would
You might think it sounds still be absent,“ the scientists say.
revolting, but the fact is that
supermarket dumpsters are often However, the study authors
full of foodstuffs still sealed in concede that other factors could be
their packaging and only just past at play in these absences, notably
their use-by dates. In other words, socio-economic criteria.
they’re still intact and still
perfectly edible. For example, they noticed a lower
rate of absences in the district’s
Certain people opt for this comparatively more affluent eastside
schools. – AFP-Relaxnews

20 theSUN ON WEDNESDAY | OCTOBER 21, 2020 S E C U R I T I E S S D N. B H D.
FEATURE
197201001092 (12738-U)
Beads of the heart
A Participating Organisation of Bursa Malaysia Securities Berhad

A Trading Participant of Bursa Malaysia Derivatives Berhad

o Sharmila Kaur crafts earrings using
Japanese glass seed beads

█ BY S. TAMARAI CHELVI average of three to five hours to
create. It also depends on the
AFTER working as an internal intricacy of the design.
auditor for more than 10 Sharmila only produces custom-
years, Sharmila Kaur left her made jewellery for each client as per
career to journey into the their request.
world of tiny little beads. “I began to sell my jewellery online
in November last year. At the
“I left my job to do something beginning of my bead journey, I
different which makes me happy. And was having difficulty in getting
I did. I found my passion,” admits 42- recognition and exposure,” said
year-old Sharmila, whose fascination Sharmila, who gained loyal
with beads led her to create stunning customers, within a short time.
earrings. Her handmade items can be
viewed at her Instagram page
Sharmila uses types of seed beads @allthingshandmade.my, or her
from Japan called Toho and Miyuki to Facebook account at
create colourful, one-of-a-kind AllThingsHandmadeMY.
jewellery, especially earrings. Her Apart from managing her online
unique designs are inspired by business, she hopes to expand her
flowers, nature, landscapes and skills into making rings, bracelets,
festivals in Malaysia. anklets and necklaces, in the future.
“I will go wherever
Her earrings have included a the beads lead me,”
songket design for Hari Raya, a teddy she said.
bear design for Valentine’s Day and a
sakura flower design for Chinese New Sharmila hopes to make rings, bracelets, anklets and necklaces in the future. – COURTESY OF SHARMILA KAUR
Year.

“Seed beads gives me the luxury to
come up with beautiful designs and
colours,” she said, adding that the
beads are made of glass.

“My personal favourite designs are
of flowers. I love them because they
are beautiful and women love them
too,” she said.

She is known for making dangly
fringe earrings, the longest of which
measures about 15cm.

“The first pair that I made was a
Jamaican-inspired fringe earring. It
was a simple one. It took me a long
time to complete it because I was still
honing my skills,” said Sharmila.

Each pair of earrings takes an

Comfortable homeworking Soap gets an update

WITH working from home incredible comeback in the THE move towards more standard solid format is, by
increasingly becoming the pandemic. responsible and environmentally definition, portable. That can help
norm for many people due to respectful consumer habits can cut unnecessary consumption,
the Covid-19 pandemic, it’s His ergonomic chair, sometimes – in fact, often – mean because there’s no need to buy
time to ensure you can be just created in 1983 for Varier taking a step backwards. And special travel formats.
as productive at home as in Furniture, offers everything cosmetics are no exception, with
the office. And for that, there’s most homeworkers could the solid bars of soap used by our Moreover, they’re generally
nothing like a comfortable want, from relaxation to parents, grandparents and great- suitable for facial use with gentler
chair! productivity. Its four angles grandparents slowly creeping back formulations than body-specific
allow users to find all kinds into bathrooms in recent years. versions.
For working cross-legged of comfortable positions by
Are you someone who has to shifting their weight to find These soaps – suitable for face Some of the oldest and best-
fight the desire to sit cross- different balancing points. and body – don’t need any plastic known soaps are Aleppo soap and
legged on your office chair? An intelligent backrest packaging and are kind to skin, so Marseille soap, which are mostly
Now, with teleworking, you Do you fidget while you long as you stick to natural made from vegetable oils. Today,
can hold meetings in your work: grabbing the backrest varieties. however, there’s a slew of solid
favourite position – and behind you, leaning forward soaps to choose from, that are
without getting a backache – to pick up your cell phone, Solid soaps contain virtually no each more fun and original than
thanks to the Soul Seat, a new stretching out for a moment water – unlike liquid shower gels – the next.
kind of chair designed by to find inspiration? which is good news for the
Ikaria Design Company in the environment and which also While there are plenty of
US. Then you need an office means that there’s no need for options from specialist or niche
The chair is available in a chair that follows your every preservatives or chemical brands (Lano, Seaweed Bath Co,
variety of colours and move. That would be the additives. Nubian Heritage etc.), recent
materials. A smaller “perch” TNK Flex, designed by months have also seen a growing
seat in the middle of the chair Marcelo Alegre for the With soap, the endless lists of number of launches from
helps open your hips and tilt Spanish brand Actiu. ingredients typically found in mainstream brands like Garnier
the pelvis forward, allowing standard shower gel labels are (solid shampoos), and Love Beauty
the spine to align naturally. Winner of the 2018 largely simplified , with a majority and Planet (soaps and shampoos).
That means you shouldn’t German Design Award, the of raw and natural ingredients that There’s now enough choice out
chair is entirely are less likely to damage your there to ensure everyone can find
customizable, from the health. their own accessible solid beauty
position of the headrest to routine. – AFP-Relaxnews
the backrest tilt. Another plus point is that the

have backache at the end of And, above all, the
the day! According to the backrest closely fits the
chair’s makers, sitting in a shape of your back,
cross-legged position can accompanying the slightest
help aid digestion and movement, supporting and
maintain better posture. And The Soul Seat. interacting with the user.
The seat section is also
that’s just as well, since there’s ergonomic, adapting to the
no backrest. Don’t say you haven’t elevated and neck resting movement of the pelvis when you
been warned! comfortably, almost as if floating, the lean forward or move left to right, all
Gravity Balans is an ergonomic and thanks to air chambers in the
The ergonomic option adaptable chair. cushion. – AFP-Relaxnews
Whether working at your computer The Norwegian designer, Peter
in an almost kneeling position or Opsvik, must be quite surprised to
stretching out with your legs see his invention make such an

21theSUN ON WEDNESDAY | OCTOBER 21, 2020
* SPORTS

Dhoni admits Super Kings’ failure after Royals thumping

110 Home Repairs 252 Distributors MAHENDRA SINGH DHONI admitted yesterday “Also there were few chances to the Royals surpassed with 2.3 overs to spare and
Maintainance Agents Wanted that Chennai Super Kings have not lived up to youngsters and maybe we didn’t see the kind of move to fifth spot in 10 matches.
their billing this Indian Premier League season spark that they could have given us to say okay,
Home Repair after the three-time winners were outclassed by to push (out) the experienced guys, and maybe Buttler, who came to bat at No. 5 rather than
Rajasthan Royals. make space for them (youngsters).” his usual opening slot, put on an unbeaten 98-
Expert Plumbing, run stand with skipper Steve Smith, who made
Tiling, Wiring and Chennai skipper Dhoni’s 200th match in the Dhoni, 39, said his team, dubbed as the 26, after Royals lost three early wickets.
Twenty20 tournament turned out to be a damp “Dad’s Army” by the media, will give the
A/Cond squib as his team lost by seven wickets in Abu youngsters a go in the remaining games of the “I thought we bowled pretty well in the
Dhabi to slip to the bottom of the eight-team league as Chennai still have an outside chance powerplay and the spinners did a good job in
From RM60 table. to progress to the playoffs. the middle with their leggies and googlies and
squeezing,” said Smith.
onward Jos Buttler’s unbeaten 70 and disciplined “Today the result what it really does is give
bowling helped the Steve Smith-led Royals those guys (youngsters), whatever is left in our Leg-spinners Shreyas Gopal and Rahul
Call : dominate the game after being put into field league stage, a chance and they play without Tewatia were miserly in their eight overs, giving
first. pressure,” said the veteran wicketkeeper- away just 32 runs between them and took a
017-320 8888 batsman. wicket each.
“It’s fair enough, this season we weren’t
322 Notices there,” a disappointed Dhoni said after Chennai’s Jofra Archer led Royals’ bowling with figures Chennai’s top-order failed to fire and Dhoni’s
seventh loss from 10 matches. of 1-20 to restrict Chennai to 125 for five, a total run-a-ball 28 and an unbeaten 35 from Ravindra
DALAM MAHKAMAH MAJISTRET Jadeja gave the team total some respect. – AFP
DI SHAH ALAM
DALAM NEGERI IINN TTHHEE MMAATTTTEERR OOFF Tiger pitching for No. 83
TTHHEE CCOOMMPPAANNIIEESS AACCTT,,22001166 Sherwood location perfect match for Woods
SELANGOR DARUL EHSAN, █ CAMERON MORFIT
MALAYSIA AANNDD most career PGA Tour wins. the unofficial Hero, which has long since
GUAMAN IINN TTHHEE MMAATTTTEERR OOFF TIGER WOODS would normally be a But these are not normal circumstances; moved to Albany in the Bahamas.
EESSAADDSSAA SSCCUULLPPTTIINNGG SSDDNN..BBHHDD.. good bet to successfully defend at this because of the pandemic, the
NO. BA-A72NCC-920-09/2020 [[220000990011000011557700 ((884444449977--UU))]] week’s Zozo Championship. He has a tournament has been “I think if I’ve learned anything over the
ANTARA ((IInn MMeemmbbeerrss’’ VVoolluunnttaarryy LLiiqquuiiddaattiioonn)) knack for dominating at tournaments temporarily moved years from Tiger, it’s how visual he is and how
AAtt aann EExxttrraaoorrddiinnaarryy GGeenneerraall MMeeeettiinngg dduullyy he likes, and he’ll be highly motivated. from Japan and is now he likes to shape shots,” said Rory McIlroy, who
3SYA SYNERGY SDN BHD ccoonnvveenneedd aanndd hheelldd aatt SSuuiittee ##88--1133--66,,MMuuttiiaarraa the Zozo played his first competitive round with Woods
(No. Syarikat: 1217992-A) BBaannggssaarr,, 88 JJaallaann lliikkuu,, 5599110000 KKuuaallaa LLuummppuurr Another Zozo win would be No. 83, Championship at at Sherwood.
oonn TThhuurrssddaayy tthhee 1155tthh ddaayy ooff OOccttoobbeerr,, 22002200 breaking him out of a tie Sherwood, in
…PLAINTIF tthhee ffoolllloowwiinngg SSppeecciiaall RReessoolluuttiioonnss wweerree dduullyy with Sam Thousand Oaks, “I think Sherwood, all the holes are framed
DAN ppaasssseedd ::-- Snead for so nicely and you can see shots there so easily. I
AZIDA BINTI CHE ZAKARIA ii)) IItt wwaass rreessoollvveedd tthhaatt tthhee CCoommppaannyy bbee can see how Tiger’s done so well there.”
(No. K/P: 710714-03-5704 / A1918892) wwoouunndd uupp vvoolluunnttaarriillyy ppuurrssuuaanntt ttoo SSeeccttiioonn California.
BERNIAGA SEBAGAI PEMILIK TUNGGAL 443399((11))((bb)) ooff tthhee CCoommppaanniieess AAcctt,, 22001166 As in the Jack Indeed, Sherwood, set in a valley
DI BAWAH GAYA DAN NAMA aanndd tthhaatt CChheeoonngg MMuunn KKhhaann ((NNRRIICC NNoo.. Nicklaus- surrounded by jagged mountains and hillsides,
ARRAMIL RESOURCES 663300111144--1100--77224411)) ooff NNoo..22,, JJaallaann DDeessaa is easy on the eyes. It was the setting for the
(No. Pendaftaran Perniagaan: AAnngggguunn 66,, AAmmeelliiaa,, DDeessaa PPaarrkkcciittyy,, 5522220000 designed opening helicopter scene in every episode of
002561615-D) KKuuaallaa LLuummppuurr,, WW.. PPeerrsseekkuuttuuaann ((KKLL)) bbee Sherwood
aappppooiinntteedd lliiqquuiiddaattoorr ffoorr tthhee ppuurrppoossee ooff Country Club, M*A*S*H, and the Dukes of Hazzard
…DEFENDAN ssuucchh wwiinnddiinngg uupp.. where was shot there before it
Kepada: iiii)) IItt wwaass rreessoollvveedd tthhaatt tthhee LLiiqquuiiddaattoorr bbee Woods was a
Azida binti Che Zakaria aanndd iiss hheerreebbyy aauutthhoorriisseedd ttoo ddiissttrriibbuuttee finished
Berniaga sebagai Pemilik Tunggal eeiitthheerr iinn ccaasshh,, ssppeecciiee oorr iinn kkiinndd tthhee first (five golf course.
Di bawah gaya dan nama wwhhoollee oorr aannyy ppaarrtt ooff tthhee aasssseettss ooff tthhee times) or There are elevated tees
Arramil Resources CCoommppaannyy aammoonnggsstt tthhee ccoonnttrriibbuuttoorriieess ooff second (five
No. 9-1, Jalan PJU 1A/20A tthhee CCoommppaannyy iinn aaccccoorrddaannccee wwiitthh tthheeiirr times) in 10 and greens, and at 7,098 yards, the course is not
Ara Damansara rreessppeeccttiivvee rriigghhttss aanndd iinntteerreessttss tthheerreeiinn.. of 12 starts at what you would call overly long.
47301 Petaling Jaya CCHHEEOONNGG MMUUNN KKHHAANN the Hero
Selangor. DDiirreeccttoorr World “Sherwood’s the perfect example of get the
DAN/ATAU KKuuaallaa LLuummppuurr Challenge from ball in play and go play your game from there,”
Unit NW-03-37, Cova Square DDaatteedd tthhiiss 2211sstt ddaayy ooff OOccttoobbeerr,,22002200 2000 to 2013. said Rickie Fowler, himself a former Hero
Jalan Teknologi, Kota Damansara JU 5 P IINN TTHHEE MMAATTTTEERR OOFF So, yes – now winner, at Albany in 2017.
47810 Petaling Jaya TTHHEE CCOOMMPPAANNIIEESS AACCTT,,22001166
Selangor. he’s an even better “And he’s been one of the best iron players of
AANNDD bet to defend, even if all time, so get the ball in play and then go score
NOTIS IINN TTHHEE MMAATTTTEERR OOFF the field will be 78 from there.”
AMBIL PERHATIAN bahawa suatu EESSAADDSSAA SSCCUULLPPTTIINNGG SSDDNN..BBHHDD.. players as opposed to
tindakan telah dimulakan terhadap [[220000990011000011557700 ((884444449977--UU))]] the 18 who show up for As legend has it, Robin Hood and The
kamu di Mahkamah Majistret di ((IInn MMeemmbbeerrss’’ VVoolluunnttaarryy LLiiqquuiiddaattiioonn)) Adventures of Robin Hood were both shot there,
Shah Alam dalam Guaman No: BA- NNOOTTIICCEE IISS HHEERREEBBYY GGIIVVEENN tthhaatt tthhee ccrreeddiittoorrss featuring screen stars like Errol Flynn and
A72NCC-920-09/2020 oleh 3SYA ooff tthhee CCoommppaannyy wwhhiicchh iiss bbeeiinngg vvoolluunnttaarriillyy Olivia de Havilland.
Synergy Sdn Bhd yang beralamat wwoouunndd uupp,, aarree rreeqquuiirreedd oonn oorr bbeeffoorree 2200tthh ddaayy
di No. 17, Jalan PJU 1A/12, Taman ooff NNoovveemmbbeerr,, 22002200 ttoo sseenndd iinn tthheeiirr nnaammeess The legend of Tiger and Sherwood, already
Perindustrian Jaya, Ara Damansara, aanndd aaddddrreesssseess wwiitthh ppaarrttiiccuullaarrss ooff tthheeiirr ddeebbttss chock full of victories and thrills, may be about
47301 Petaling Jaya, Selangor yang oorr ccllaaiimmss,, aanndd tthhee nnaammeess aanndd aaddddrreesssseess ooff to get its own Hollywood ending this weekend.
mana tuntutan Plaintif adalah untuk tthheeiirr ssoolliicciittoorr ((iiff aannyy)) ttoo tthhee uunnddeerrssiiggnneedd,, – pgatour.com
satu penghakiman untuk:- tthhee lliiqquuiiddaattoorr ooff tthhee CCoommppaannyy,, aanndd,, iiff ssoo
(a) jumlah wang RM32,972.80 setakat rreeqquuiirreedd iinn wwrriittiinngg ffrroomm tthhee lliiqquuiiddaattoorr,, aarree,, 322 Notices SHORTS through donations to historically Black “I do think we will see people pull
bbyy tthheeiirr ssoolliicciittoorrss oorr ppeerrssoonnaallllyy ttoo ccoommee aanndd Lefty two for two heading colleges and universities. out of tours. That’s just going to be the
29/08/2018; pprroovvee tthheeiirr ddeebbttss oorr ccllaaiimmss aatt tthhee lliiqquuiiddaattoorr’’ss FULHAM ENTERPRISE into Zozo reality of things.”
(b) faedah ke atas jumlah RM32,972.80 ooffffiiccee ooff SSuuiittee ## 88--1133--66,, MMuuttiiaarraa BBaannggssaarr,, SDN. BHD. Mickelson said he was looking
88 JJaallaann LLiikkuu,, 5599110000 KKuuaallaa LLuummppuurr oorr iinn PHIL MICKELSON heads to California forward to pairing with Barkley, despite Morgan said it was important to
tersebut pada kadar 5% setahun ddeeffaauulltt tthheerreeooff tthheeyy wwiillll bbee eexxcclluuddeedd ffrroomm 200301006390 (608810-D) to start his Masters build-up at the his notoriously poor golf swing. create an environment for players to
mulai 30/08/2018 sehingga tarikh tthhee bbeenneeffiittss ooff aannyy ddiissttrriibbuuttiioonn mmaaddee bbeeffoorree (Incorporated in Malaysia) Zozo Championship having completed be comfortable with making that
penyelesaian sepenuhnya; ssuucchh ddeebbttss aanndd ccllaaiimmss aarree pprroovveedd.. (Under Members’ Voluntary a second dominant win in two starts “While we may need a handicap for decision.
(c) kos tindakan ini; dan CCHHEEOONNGG MMUUNN KKHHAANN on the seniors tour. Chuck,” said Mickelson. “I’m looking
(d) lain-lain relif dan perintah yang LLiiqquuiiddaattoorr Winding Up) forward to playing with Peyton and “I don’t think people should look
dianggap suai-manfaat diberi oleh KKuuaallaa LLuummppuurr NOTICE OF FINAL MEETING Mickelson is a rookie on the PGA Stephen and to help raise money for down on it and they shouldn’t feel like
Mahkamah yang Mulia ini. DDaatteedd tthhiiss 2211sstt ddaayy ooff OOccttoobbeerr,,22002200 UNDER SECTION 459(1) OF Tour Champions circuit this year but is another important cause.” people aren’t doing their job or not
DAN BAHAWA TELAH DIPERINTAHKAN THE COMPANIES ACT, 2016 now two-for-two after beating another committing to their country,” the 34-
penyampaian Writ dan Pernyataan IN THE MATTER OF THE NOTICE IS HEREBY GIVEN that left-hander and former major Morgan concerned about year-old added.
Tuntutan kepada kamu dalam tindakan COMPANIES ACT, 2016 a final meeting of the Company champion, Mike Weir, by three strokes ‘bubble burnout’
tersebut hendaklah dilaksanakan will be held at No. 57, 2nd Floor, to win the Dominion Energy Charity Johnson pulls out
melalui penampalan satu salinan AND Persiaran TBC, Taiping Business Classic on Sunday. ENGLAND’S players can withdraw
bermeterai Writ dan Pernyataan IN THE MATTER OF Centre, 34000 Taiping, Perak on from tours if they feel playing in bio- WORLD NO. 1 Dustin Johnson has
Tuntutan tersebut berserta satu salinan SWANMETALSDN. BHD. 23rd November 2020 at 10.00 He may be 50 now, but Mickelson is secure bubbles during the Covid-19 pulled out of this week’s ZoZo
bermeterai Perintah Penyampaian a.m. averaging well over 310 yards off the pandemic will take a toll on their Championship, the second straight
Ganti tersebut pada papan notis (341741-H) Agenda tee – not quite in the Bryson mental health, limited overs captain event he has withdrawn from after
Mahkamah Majistret di Shah Alam dan (In Members’ Voluntary 1. To receive and consider DeChambeau class but up there with Eoin Morgan has said. testing positive for the new
mengiklankan penyampaian dalam the Liquidator’s account many of the PGA Tour's best – which coronavirus.
bentuk notis di dalam surat khabar “The Winding-Up) of receipts and payments has many thinking he could become England hosted West Indies,
Sun” untuk satu terbitan sahaja dan NOTICE IS HEREBY GIVEN pursuant and statements showing the oldest ever major champion at Pakistan and Australia after cricket’s The 36-year-old Johnson is
penyampaian ini dianggap sempurna to Section 439 of the Companies Act, how the liquidation has Augusta. restart in July, with the teams restricted recovering after experiencing some
keatas kamu selepas tujuh (7) hari dari 2016 that the Special Resolutions been conducted and to playing in Manchester and Covid-19 symptoms but is still not well
tarikh pengiklanan dan penampalan set out below was duly passed by any explanations arising Meanwhile the busy “Lefty” Southampton where the ECB had set enough to resume playing
tersebut dan bahawa kos permohonan the members of the Company on 14 therefrom. announced his latest charity challenge up bubbles. competitive golf, his agent David
penyampaian ganti itu ditanggung oleh October 2020: - 2. To resolve that the affairs of will see him team up with NBA legend Winkle said.
kamu. 1. THAT the Company be wound up the company were fully wound Charles Barkley in made-for-TV match The Indian Premier League has set
Jika kamu berhasrat membela tindakan up. against two-time NBA MVP and up a bubble for players in the United “While he is feeling much better, he
ini, kamu mesti masukkan kehadiran voluntarily pursuant to Section 439 3. To resolve that upon the accomplished golfer Steph Curry and Arab Emirates and similar curbs on is still a bit low on energy and feels it
dalam tempoh tujuh (7) hari selepas of the Companies Act, 2016 AND dissolution of the Company, five-time NFL MVP-winning movement will be in place with would be best to wait and resume his
tarikh penyempurnaan penyampaian THAT Mr Yeoh Beng Sang of YBS the Liquidator be released and quarterback Peyton Manning. England expected to tour South Africa schedule in Houston,”Winkle told
ganti itu. Jika kamu ingkar dan/atau Corporate Services Sdn Bhd, 47-02 discharged from all liabilities next month. Golfweek.
gagal untuk memasukkan kehadiran Jalan Tun Abdul Razak, Susur 1/1, in respect of any act done or “The Match: Champions for
dalam tempoh yang ditetapkan, 80000 Johor Bahru be and is hereby default made by them on the Change” will take place on Friday, Nov “We’ve spoken about this as a team American Johnson also withdrew
penghakiman boleh dirakamkan appointed as the Liquidator for the administration of the affairs of 27. and we’ve accepted that guys will from last week’s CJ Cup tournament in
terhadap kamu. purpose of such winding up at a fee the Company. come in and out of the bubble as they Las Vegas. If he continues to get
Sila ambil perhatian bahawa Mahkamah to be agreed upon. 4. To resolve that under Section Proceeds from the event will help feel it is affecting their mental health,” better, his next event will be the
telah menetapkan 9/11/2020 pada 2. THAT the said Liquidator be and 518(3)(b) of the Companies promote diversity and inclusion, Morgan said during an online charity Houston Open at Memorial Park Golf
pukul 9.00 pagi, di Mahkamah is hereby authorised to distribute Act, 2016, all books and event. Course on Nov 5-8.
Majistret di Shah Alam sebagai tarikh either in cash, specie or in kind papers of the company and
pengurusan kes (e-review atas talian). amongst the contributories of the liquidator that are
the assets of the Company in relevant to the affairs of the
Bertarikh pada 09/10/2020 accordance with their respective company at or subsequent
………t.t……… rights and interest therein. to the commencement of the
3. THAT the said Liquidator be winding up of the company
Penolong Kanan Pendaftar indemnified by the Company shall be destroyed after
Mahkamah Majistret against all costs, charges, losses, the expiration of three(3)
Shah Alam expenses and liabilities incurred or months from the date of the
sustained by him in the execution dissolution of the company.
Notis ini disediakan oleh Tetuan K H and discharge of his duties in Dated this 21st October, 2020
CHONG & ASSOCIATES, peguamcara relation thereto. TAN KUAN MIN
bagi pihak Plaintif, yang beralamat di LIM KIN SING Liquidator
E-11-14, Plaza Mont’ Kiara, No. 2, Jalan Director
Kiara, Mont’ Kiara, 50480 Kuala Lumpur. Dated: 21 October 2020
[Ruj Kami: KH-L/1002/19/3SYA-AR(MC)]
IN THE MATTER OF THE
COMPANIES ACT, 2016

AND
IN THE MATTER OF
SWANMETALSDN. BHD.

(341741-H)
(In Members’ Voluntary

Winding-Up)
NOTICE IS HEREBY GIVEN that the
Creditors of the abovenamed Company,
which is being wound-up voluntarily,
are required on or before 22 November
2020 to send in their names and
addresses with particulars of their
debts and claims, and the names and
addresses of their solicitors (if any) to
the Liquidator, Mr Yeoh Beng Sang, at
47-02 Jalan Tun Abdul Razak, Susur
1/1, 80000 Johor Bahru and, if so
required by notice in writing from the
said Liquidator, are, by their solicitors
or personally, to come in and prove
their debts or claims at such time and
place as shall be specified in such
notice, or in default thereof, they will
be excluded from the benefit of any
distribution made before such debts
and claims are proved.
YEOH BENG SANG
Liquidator
Dated: 21 October 2020

22 theSUN ON WEDNESDAY | OCTOBER 21, 2020
SPORTS

█ MIGUEL DELANEY Champions League promises surprises and tactical shift
IN THEIR attempt to start rectifying
the many problems of last season, now, and represent a rare Italian champions have made a They got managerial jobs because to win out.
and begin placating Lionel Messi, opportunity. curious managerial choice in a totally of their playing connections to the The temptation at this point is to
Barcelona quickly came across a untried Andrea Pirlo. clubs as much as any coaching ability.
pretty big issue. The group of super-clubs that say that this could be the most open
dominate it are in a weaker position He is part of another trend, that One argument is that the nature Champions League in years, or
It was one that came up in almost than at any point in memory, far includes Frank Lampard, Ole Gunnar of modern super clubs means you something that seems to get uttered
every step. It was also encountered more fragmented than we’re used to. Solskaer and Zinedine Zidane. need such figures to navigate their every season like “Atletico
by almost every super club in the squads. Another is that it feels an Madrid/Borussia Dortmund will never
Champions League this season. Many are now actually enduring unnecessary risk to appoint coaches have a better chance”.
problems because of the very wealth so unproven.
Barcelona knew they had to that has made them so dominant, Recent realities just make that
refresh the squad, but the Covid crisis reflected by the inability to sell. It is as if some of the most cutting- temptation easy to resist. It is also
greatly impacted their already edge coaches are in a tier below the why this Champions League season
constrained finances, meaning they It is really only the defending super-clubs, like Julian Nagelsmann could be instructive from a wider
had to sell to buy. The huge problem champions, Bayern Munich, who at Leipzig and Marco Rose at Borussia historical and economic perspective.
was selling. currently seem sharp in the way you Monchengladbach.
think the elite sides should be. It will be a test of the super club
No player wanted to go unless the Liverpool might be, except for the What’s more, as Atalanta dominance, as much as anything, and
buying club was capable of matching manner they have now been illustrated last season, the more how resistant it is.
their wages, leaving them at a undercut by Virgil van Dijk’s injury. efficient squads they have allow a
stalemate in so many deals, and with sharper and more intense idea of It is hard not to think it would be
a stale squad. This inefficiency, that comes from football. depressing if they achieve the usual
immense financial insulation, appears level of results in these circumstances.
There were similar cases right to have manifested itself in other This has been one of the growing What would it say about the effect of
across Europe, outside of the Premier ways, too. Look at Juventus. lessons over the last few seasons. It’s money in the game?
League. It is why this Champions just that a critical mass of individual
League season could feel as strange As if almost complacent and quality – like, say, having Neymar and The fair expectation, and hope,
as everything else in football right bored from a decade of titles that Kylian Mbappe in one team – tends should be for more surprises. – The
increasingly have less meaning, the Independent

Right Arena for mega clash TOUCHLINES
THOMAS MULLER can further fuel Bayern host Atletico as hot Muller fuels Germany recall
appeals for him to be recalled by REAL MADRID or Liverpool could sign
Germany when Bayern Munich launch between last season’s Champions League final Kylian Mbappe next summer with the 21-
their Champions League defence at and the first Bundesliga weekend, Bayern’s year-old France striker unwilling to extend
home to Atletico Madrid tomorrow (3am relentless schedule has continued apace. his contract at Paris St-Germain.
Malaysian time) behind closed doors. BORUSSIA DORTMUND’S Norway striker
Tomorrow morning’s game will be their third Erling Braut Haaland, 20, is viewed as an
Having managed a record 21 assists in the in six days, while further Champions League alternative if Real Madrid fail to agree a deal
Bundesliga last season, Muller has continued fixtures against Salzburg and Lokomotiv with PSG for Mbappe.
his sparkling form by scoring five goals and TOTTENHAM are preparing to increase Son
creating four more so far in 2020/21. Moscow mean Bayern have midweek and Heung-min’s weekly wages to £150,000
weekend games in each of the next three (RM806,000) a week in a bid to persuade
The 31-year-old netted twice in a 4-1 win at weeks. the South Korea forward, 28, to sign a
Arminia Bielefeld last Saturday when Robert contract extension.
Lewandowski also grabbed two goals for The physical strain and the need to SOUTHAMPTON and England striker Danny
Bayern. rotate has led to a few early-season Ings, 28, is close to signing a contract
hiccups. extension to keep him at St Mary’s amid
His latest eye-catching club performance interest from Tottenham.
has prompted fresh hopes of a Germany Bayern suffered a shock 4-1 defeat to LIVERPOOL are interested in Brighton’s
recall for Muller, who was dropped by Hoffenheim last month, and needed a late English defender Ben White after Leeds
Joachim Loew from the national set-up in Robert Lewandowski penalty to seak a 4-3 United failed to sign him despite lodging
2019 alongside Jerome Boateng and Mats win over Hertha Berlin before the three bids for the 23-year-old in the
Hummels. international break. summer.
UEFA is considering expanding the
Now Bastian Schweinsteiger has joined On Saturday, Flick criticised his team for Champions League to 36 teams from the
fellow former Bayern and Germany players a poor second half performance, after 2024-25 season.
Didi Hamann and Lothar Matthaeus in calling EUROPEAN football’s governing body is
for Mueller to be reinstated. individual errors led to a goal for also set to cut prize money in European
Bielefeld and a red card for Bayern’s club competitions for the next five years
“If I was national coach, Muller as well as Corentin Tolisso. because of the losses caused by the Covid-
Boateng would be in the national side,” They can ill-afford a repeat 19 pandemic.
Schweinsteiger, 36, told Monday’s edition of against Atletico. MANCHESTER CITY had a £54m (RM290m)
German magazine Kicker. bid for Senegal defender Kalidou Koulibaly, 29,
Goalkeeper Muller rejected by Napoli over the summer.
Schweinsteiger helped win the 2014 World Manuel Neuer ARSENAL made a bid to sign Sporting
Cup in Brazil alongside Mueller, who knows he warned that Lisbon’s 17-year-old Portuguese winger
still has plenty to offer Germany after 100 Atletico are a Joelson Fernandes during the summer
internationals and 38 goals for ‘die Mannschaft.’ “strong team” who were transfer window.
“uncomfortable” to play FORMER Chelsea manager Maurizio Sarri is in
“Everyone can see that I am in good form. against. pole position to take the Fiorentina job should
Let’s just see what happens,” Muller told they decide to sack Giuseppe Iachini.
broadcaster ZDF on Saturday, yet Loew has so “The good thing is that
far showed no signs of reversing his decision. the game is on
Wednesday, so we have an
After an early season plagued by tired legs extra day to prepare,” said
and defensive wobbles, Bayern will need the Bayern captain.
Muller’s creativity against an Atletico side who
have conceded just one goal in four games so far After having
this season. less than a
month
The Bavarians have a perfect record at home
against Diego Simeone’s side, having twice
beaten them in Munich in 2016.

Yet Atletico knocked Bayern out of the
semifinals in 2015/16 and the German side
remain wary of their Spanish opponents.

Shakhtar fancy chances against out-of-sorts Madrid

THERE’S never a good time to lose a to struggle through a Champions both competitions. The Ukrainians have been of all, but I will not get frustrated.
football match, but there is a danger League group stage. Losing to one Beforehand, the Real Madrid boss boosted by the fact that 10 of their “I think you have to enjoy it and
that a slip may snowball into an of the weaker teams in the group at players who have been absent in
extended malaise ahead of a crucial home in your first game puts your has rotated his players between the the last two weeks due to Covid-19 face each game as great battles.
run of fixtures. chances of progression at risk. two competitions, but this season’s have come back with negative “We are motivated by this
squad isn’t as strong as previous results.
Real Madrid’s defeat to Cadiz Los Blancos will then travel to the ones. difficult group. But yes, it is a very
came ahead of a week where they Nou Camp for the first Clasico of this “They (Madrid) are stronger and tough group.
begin their Champions League year’s campaign. Now, after the slip-up on Sunday, they are the favourites, but of
campaign and face Barcelona in a Real Madrid have to stand up and course we are going to try to “Madrid, Inter and
Clasico. Dropping points against be counted because they can’t surprise. We can do it, but they are Monchengladbach. People don’t
Shakhtar would be disappointing afford a slump in form, especially better,” Castro told Spanish sports talk about the Germans and they are
Between the final whistle against but losing to Barcelona would crank now. daily Marca yesterday. a great team.
Cadiz on Sunday and kick off against the pressure on Zidane.
Shakhtar Donetsk tomorrow Shakhtar are never an easy test Refering to their group that also “I laugh at those who do not
(12.55am), Zinedine Zidane and his If anything became clear to for any side and Spanish coach Luis consists of Borussia value Monchengladbach, they are
players will be filled with doubt. Zidane after the Cadiz game, it was Castro is hopeful of springing a Monchengladbach and Inter Milan, the same people who said last year
that he can no longer entrust his surprise against the 13-time Castro said: “For me it is the hardest that Atalanta were a simple team. So
Real Madrid know what it is like squad to pick up results in European champions. watch out for the Germans.” –
Agencies

23theSUN ON WEDNESDAY | OCTOBER 21, 2020
* SPORTS

Wolves DNA has Heavyweight bout
Nuno howling excites Klopp Europeanfootballpedigree
after victory on show as Ajax host Liverpool
over Leeds LIVERPOOL manager
Jurgen Klopp is looking
WOLVES boss Nuno Espirito Santo felt his forward to tomorrow’s boss told Liverpoolfc.com. swept aside Heerenveen 5-1. Erik can find their top level.
players were rewarded for showing their (3am Malaysian time) “If you think in the past about ten Hag’s side now sit second in Manager Erik Ten Hag’s side
true character in a 1-0 win at Leeds. Champions League clash against the table, and one point off PSV.
European heavyweight Ajax of European football, Liverpool was will sense an opportunity to get at
Raul Jimenez’s deflected second-half Amsterdam. 100% involved and Ajax as well, so Liverpool, have stumbled so far Liverpool’s defence, which is
shot clinched Wolves their third Premier that’s how it is. in their defence of the Premier missing the leadership of Van
League win of the season and catapulted The Reds begin their 2020-21 League title, with a 7-2 loss to Dijk.
them up to sixth in the table yesterday. Champions League campaign at “One of the highlights of my Aston Villa followed up with a 2-2
the Johan Cruyff Arena in a clash time at Dortmund was for sure the draw in the Merseyside derby However, Ajax’s defence will
Santo’s side were outplayed in the first that boast a combined total of 10 two games against Ajax. against Everton. also need to be at its best to keep
period but showed more aggression after European Cup triumphs. out the dynamic attack of Sadio
the break and had a goal ruled out for “Two years, or one-and-a-half Klopp’s side has also been Mane, Roberto Firmino and
offside by the video assistant referee before Klopp has fond memories of years, ago they played an rocked by the loss of Dutch Mohamed Salah which is full of
Jimenez’s 70th-minute effort. meeting the Dutch giants during exceptional Champions League captain Virgil van Dijk, who is out pace.
his time with Borussia Dortmund campaign, absolutely exceptional. for months with a knee issue.
“We were better with the ball and and is looking forward to doing so Liverpool play with high
created more chances (in the second half ),“ again eight years later. “The way they played, wow. All The Reds will also be without intensity and Ajax will need to
Santo said. “It’s about the identity. good but we didn’t play them that goalkeeper Alisson Becker and match that, while also containing
“(Our) proper analysis didn’t year, it would have been only midfielder Alex Oxlade- their fullbacks, who play like
“We know we have to have organisation start yet, not with me. After the possible in the final and that didn’t Chamberlain. Thiago is also a wingers for most games.
to stay in the game and the character of match I will know much more happen because of Tottenham. So, major doubt along with Joel
the team was evident. about it, but in general yes (it feels now we meet and I’m excited.” Matip. It could be another memorable
like a big European game),” the Ajax European night if they can
“Especially the effort of the players. Like Ajax have had an indifferent While Liverpool go into the build on the performance over
I said, the answer in terms of fitness, our start to their Eredivisie campaign, game as big favourites, Ajax are a Heerenveen at the weekend. –
energy was much better. We had chances. but put in their best performance match for anyone at home if they Agencies
We had good situations before and after so far at the weekend as they
the goal.”
Four free agents Reds could sign as cover for Virgil
Romain Saiss’ superb finish into the
bottom corner in the 54th minute was LIVERPOOL centreback Virgil van Dijk faces a be missed and in his absence Liverpool only pace, with Liverpool needing a fair level of speed in
chalked off by VAR, which deemed Daniel fight to play again this season as he gets set to have two natural centrehalves in Joel Matip and their central defenders to be able to operate with
Podence had been offside. undergo surgery on an anterior cruciate Joe Gomez. their risky high line.
ligament rupture. The Dutchman is thought to JOZO SIMUNOVIC: Formerly of Celtic, Simunovic
Leeds dominated the first 45 minutes. have suffered a grade three tear – the worst Fabinho is another option for Jurgen Klopp has been a free agent since the end of last season
Patrick Bamford’s header was ruled out for possible level. at the back but behind the Brazilian, Gomez and and has recently been targeted by AC Milan, per
offside, Rodrigo was wayward with two Matip, the German coach only has the reports. Only 26 years old, Simunovic made 129
headers and they had a penalty appeal And that means Liverpool are unlikely to inexperienced likes of Nat Phillips, Billy appearances for Celtic and was mainly a back-up
turned down when Helder Costa went have Van Dijk’s talents to call upon until the Koumetio, Rhys Williams and Sepp van den option – so would accept being fourth choice at
down under Joao Moutinho’s challenge. 2021-21 campaign – dealing a sizable dent in Berg. Anfield. An international teammate of Dejan
Lovren’s, Simunovic has similar pace to Matip and
“Leeds started very strong and caused their aspirations of winning The domestic transfer window closed on Fabinho but isn’t as effective on the ball as the pair.
us enormous problems, their breakers, they back-to-back Premier Friday meaning Liverpool cannot sign any more The Croatian did however suffer regular injury issues
were able to create situations,” Santo said. League titles. players until the January market – but they can at Celtic Park and so may not be durable enough for
The Reds have had still add free agents to their squad and register consideration.
“We adjusted better as the game went. I the best defensive them in their 25-man Premier League squad. KEVIN STEWART: A familiar name for Liverpool
think we kept on growing during the game. record in both of
It’s very difficult to play against Leeds, very those years, Non-contract players can be signed at any fans, Stewart made 20 first-team appear-
difficult. It’s an amazing team. conceding 55 goals point in the season but can only be registered ances in Jurgen Klopp’s first two seasons
in 76 games, but after windows and while Liverpool have little before joining Hull City for £8m (RM42m) in
“The energy of the players, the manager, have already space in their squad for non-homegrown 2017. He was released by the Tigers however
the ideas. It’s very difficult and in the leaked 13 in just players, Van Dijk’s injury means his spot may be after their relegation to League One last
second half we did better.” five games this available for the rest of the campaign. season and is still available. The 27-year-
season – and that
Leeds boss Marcelo Bielsa was left to rue has been with Van So which free agents could Liverpool look at old is naturally a defensive midfielder but
a goalless first half in which his side failed Dijk. to offer greater senior depth at the back? can drop into a centreback role and is a
to turn dominance into goals. The Netherlands EZEQUIEL GARAY: Garay was most recently on player Klopp already knows.
international’s the books of Valencia but has yet to find a new DANIEL SCHWAAB: A player with
“Given how the game went we thought commanding club since leaving the Mestalla. Like Van Dijk, Bundesliga experience, Schwaab was formerly
we did enough to create a lead,” Bielsa said. leadership the former Argentina international suffered on the books of Freiburg, Bayer Leverkusen and
“When an offensive team does not take from the an ACL injury in February and asked to be Stuttgart. The 32-year-old was most recently at
their chances, the opposing team senses back released so that Valencia could sign a PSV Eindhoven but departed in the summer after
this and starts to grow in confidence. will replacement. He cost Valencia £18m four years and over 100 appearances for the Dutch
(RM95m) four years ago and the 34- giants. A player with 24 Germany U-21 caps,
“The game was very physical, there were Jozo year-old has also played at the top Schwaab will be a player Klopp is aware of – though
many interruptions and it was difficult to Simunovic level for Real Madrid, Benfica and he has never earned a senior cap for Germany. A
find any continuity in the game. We lost Zenit Saint Petersburg. One generally solid defender, Schwaab would surely
some offensive capacity.” relish the chance to work under his compatriot
issue would be that Klopp. – Express Newspapers
Bielsa said he was still waiting to learn Garay is notably
the severity of skipper Liam Cooper’s groin short of
injury, which forced him to withdraw from
the warm-up before kickoff.

Leeds dropped one place to 10th in the
table after taking seven points from their
first five matches. – The Independent

RESULTS & STANDINGS

ENGLISH PREMIER LEAGUE Firmino drought weighs heavy on Salah, Mane
Leeds 0 Wolves 1 (Jimenez 70), West Brom 0
Burnley 0.

Everton P W D L F A Pts
5 4 1 0 14 7 13
Aston Villa 4 4 0 0 12 2 12
Liverpool 5 3 1 1 13 13 10 LIVERPOOL striker Roberto Firmino is becoming of goal,” the former Chelsea player told The Times. couple of days, I spoke to him yesterday. And
Leicester 5 3 0 2 12 8 9 a “huge burden” on Mohamed Salah and Sadio “There was nothing particularly wrong with yeah, it’s a difficult moment, but that’s when you
Arsenal 530286 9 Mane, according to Tony Cascarino. need to be there for each other.
Wolves 530257 9 his all-round game against Everton – he linked
Tottenham 5 2 2 1 15 8 8 The Brazilian has netted just once in 20 the play well and was involved in the move for “I’ll be there as much as I possibly can for
Chelsea 5 2 2 1 13 9 8 Premier League matches for the Reds, something Liverpool’s opener – but his lack of productivity him, I’m sure the lads will do the same and his
West Ham 5 2 1 2 11 7 7 Jurgen Klopp may need to think about. in front of goal is placing a huge burden on Salah family certainly will, to help him through the
Leeds 521299 7 and Mane. journey he’ll go on. But I’m sure he’ll be back
Man City 4 2 1 1 7 7 7 Firmino impressed in the 2-2 Merseyside stronger.”
Southampton 5 2 1 2 8 9 7 derby draw at the weekend but ultimately was “Should this goal drought continue, Firmino
Newcastle 5 2 1 2 7 9 7 unable to score once again. cannot afford the creative side of his game to The skipper said it was up to the team to “win
Crystal Palace 5 2 1 2 6 8 7 slip.” as many games as we can for him”.
Man United 4 2 0 2 9 12 6 Cascarino thinks if the run continues for much
Brighton 5 1 1 3 9 11 4 longer the pressure on Mane and Salah could Meanwhile, Liverpool captain Jordan “That’s down to us as players to make sure
West Brom 5 0 2 3 5 13 2 become too much. Henderson has leant his support to Van Dijk and that when he is back and he is fit that we’re still
Burnley 401338 1 his long recovery ahead. fighting to be successful and fighting for
Sheffield Utd 5 0 1 4 2 7 1 Liverpool are also facing a fresh challenge trophies,” said Henderson.
Fulham 5 0 1 4 4 12 1 with Virgil van Dijk unlikely to feature until the “Yeah, it’s a tough one. It’s a big blow for us.
back end of the season. For him personally, obviously. But for us as a “You’ve got to use times like this to be
team, a massive blow,” the captain told stronger and to be even more together than we
“It is only one goal in 20 Premier League Liverpool’s official website yesterday. already are. And use it as a positive in some way.”
matches now for Roberto Firmino as the – Express Newspapers/Reuters
Liverpool forward continues to struggle in front “I’m just gutted for him. So, it’s been a tough

WEDNESDAY • OCTOBER 21, 2020 QUOTE OF THE DAY

If you think in the past about European
football, Liverpool was 100% involved and Ajax as
well, so that’s how it is. One of the highlights of my
time at Dortmund was for sure the two games against
Ajax… So, now we meet and I’m excited.”

Liverpool manager Jurgen Klopp

Clock ticking on Pep and City’s Champions League dream

UEFA Champions League 2020-21 PEP GUARDIOLA starts his latest bid to competitions for Financial Fairplay
lead Manchester City to Champions breaches.
MATCHDAY 1: OCT 22 Head-to-head W D L League glory with the shadows of past
failures casting doubt on his ability to City’s legal dream team won that
GROUP A Form 2019-20 secure that elusive title. battle and the suspension was
eventually thrown out on appeal.
Salzburg AUT First Bayern Winner City host Porto in their opening
Lokomotiv RUS meeting Atletico Q-final Champions League group match Whether Guardiola can be as
Bayern GER 312 Salzburg Group tomorrow (3am Malaysian time) with successful in Europe as City’s Abu
Atletico ESP Lokomotiv Group Guardiola’s failing in the tournament Dhabi-based owners were in the court
weighing heavily on both the Spanish room remains far from certain.
GROUP B 200 Real Last 16 boss and his club.
Real Madrid ESP 121 Adding to the unease around City
Shakhtar UKR Shakhtar Group Despite all their domestic success in ahead of their European campaign is
Inter ITA recent years, City have never gone the unresolved issue of Guardiola’s
M’gladbach GER Inter Group beyond the semifinals of the future.
Champions League and Guardiola has
M’gladbach – found the competition equally vexing Guardiola is out of contract at the
for much of the last decade. end of the season and has yet to agree
GROUP C 200 Porto – a new deal amid speculation that he
Man City ENG 103 Since he won the Champions may decide to leave the Etihad
Porto POR Man City Q-final League as Barcelona boss for the Stadium in 2021.
Olympiacos GRE second time in 2011, Guardiola has
Marseille FRA Olympiacos Group failed to return to the final of Europe’s For now, Guardiola will focus on
elite club competition. Porto’s visit to Manchester rather than
Marseille – entertaining questions about his long-
That nine-year drought includes term plans.
GROUP D 110 Liverpool Last 16 four years of frustration since he took
Ajax NED First Ajax Group charge at City in 2016. The 49-year-old insists he has to
Liverpool ENG Atalanta Q-final earn a prolonged stay at City by
Midtjylland DEN meeting Midtjylland Debut In that time, Guardiola has seen City improving on last season’s
Atalanta ITA beaten by Monaco in the last 16 and disappointment, which saw them
Liverpool, Tottenham and Lyon in the surrender the Premier League to
Serge Gnabry Picture: quarterfinals. Liverpool and win only the League Cup.
Getty Images
Scored 23 goals and provided He also lost in three semifinals There have been some worrying
14 assists for Bayern last season RIVAL NATIONS: Bayern, during his time as Bayern Munich signs already as Leicester thrashed City
who start campaign against manager before moving to City. 5-2, while Saturday’s 1-0 win against
BUOYANT BAYERN: Defending champions Atletico, beat Sevilla in Arsenal was far from convincing.
Bayern Munich became first team to notch 2020 UEFA Super Cup final Last season’s shock 3-1 defeat
up perfect record of victories last season and triumphed 8-2 over against Lyon in Lisbon was especially Significantly, Guardiola was able to
Bayern’s European titles: Barcelona in Champions galling as City were heavy favourites welcome back Sergio Aguero last
League last against the French side. weekend as City’s record goalscorer
Sources: UEFA, Gracenote © GRAPHIC NEWS season made his first appearance for four
Guardiola deserved a large portion months after knee surgery.
of the blame for that letdown after his
tactical tinkering appeared to unsettle City have lacked a cutting edge in
his players and did nothing to tilt the Aguero’s absence and Guardiola’s
tie in City’s favour. hopes of a serious Champions League
challenge hinge on the Argentine
Interpreted by Guardiola’s critics as striker staying fit.
further proof that his Champions
League success at Barcelona was due to “The important thing is that Sergio
the presence of the great Lionel Messi’s comes back in good physical condition,
presence, the only bright side of the starts to get his rhythm, doesn’t get
Lyon loss was that it was not their more injuries and plays good,”
farewell to Europe for a while. Guardiola said.

For several months last season, it “We know what he means for us, we
appeared City would not even be know how we appreciate him, but now
competing in the Champions League he has to show like every one of us, me
this term after UEFA gave them a first, that we deserve to continue here
two-year ban from European and playing good and winning games.”
– AFP

‘History says no’
Liverpool legend Carragher suggests Reds will not retain title without injured Van Dijk
JAMIE CARRAGHER admits
history suggests Virgil Van Dijk’s Dijk, not just any player, players you “I think if Van Dijk is fit for the “Upamecano, at Leipzig, there’s talk Liverpoolfc.com.
injury will cost Liverpool the think you cannot be without. whole season, Liverpool win the of him. He’s not the profile of Van Dijk. The club have refused to put a
Premier League title. League, but it’s massively opened it up But that’s the one Liverpool wanted
The Dutch centreback sustained an “Everton in 1986 lost Neville now.” next summer. timeframe on Van Dijk’s return, but
ACL knee injury following a heavy Southall to a broken ankle, Liverpool Klopp acknowledged he was facing up
challenge from Jordan Pickford in the won the double in 1986. One of Carragher also insisted Liverpool “Bring it forward, pay the extra to a prolonged period without one of
Merseyside derby on Saturday. Liverpool’s greatest teams was in 1988, should sign Dayot Upamecano in money and do it on Jan 1. That means his most important players.
Alan Hansen, the Van Dijk of that team, January to replace Van Dijk following Liverpool have to get through the next
And without Van Dijk for the got injured in pre-season, didn’t play his serious knee injury. 11 League games without Van Dijk. “He now will be out for a while,
majority of the rest of the season, until the FA Cup semifinal in April, They have to go big in terms of a that’s clear. We don’t want to set any
Carragher believes Jurgen Klopp’s side Arsenal won the League. The Kop legend believes the Reds signing.” timeframe, to be honest, because each
face an uphill battle to retain their title. must react with urgency and bring player is different and each individual
“I went back to Cantona, not an forward next summer’s priority in the Liverpool boss Klopp said is different,” he added.
“History says no,” Carragher said on injury, missed half a season, Blackburn transfer market of a new centreback, supporting Van Dijk is his priority after
Sky Sport’s Monday Night Football win the title. Roy Keane does his and ensure he is ready to join Klopp’s the injury ended the Dutchman’s run “So we feel now in this moment
show when asked if the Reds could cruciate at Leeds, Arsenal win the title. squad as soon as the January transfer of starting the last 94 Premier League extremely, extremely for him because
defend the title without Van Dijk. window opens. games. most of us were in a similar situation
“Even last season? Laporte missing and we know that these situations are
“When I started watching football for half the season, Man City were “Liverpool’s next signing had to be a “We are there for him, he knows absolutely rubbish.
in the mid-80s, I went through teams, champions and lose the League. centreback next summer anyway,” that and we will wait for him like a
champions, who tried to retain the title Carragher said . good wife is waiting when the husband “You don’t need it. You don’t need it
the next season, we know it’s difficult. “Who knows what would have is in jail and will do, meanwhile, all but you have to get over it and Virgil
happened. A lot of those players, I “That was the next one, that has to what we can do to make it as easy for will get over it, 100%, and today is
“But in the 80s, huge figures like Van think if they stay fit, I think they win the be brought forward to Jan 1 – not the him as possible,” Klopp told already the first day, if you want, of the
League. end of the month. recovery.” – The Independent/AFP

theSun is published and printed by Sun Media Corporation Sdn Bhd (221220-K) of Lot 6, Jalan 51/217, 46050 Petaling Jaya, Selangor. Tel: 03-7784 6688 Fax: 03-7783 7435 • Tel (Editorial): 03-7784 6688 Fax: 03-7785 2624/5 Email: [email protected] • Tel (Advertising): 03-7784 8888 Fax: 03-7784 4424 Email: [email protected]


Click to View FlipBook Version