INSIDE
TELLING IT AS IT IS Current job page Wedding planners page
market tough for irked by minister’s
3 6
senior citizens comment
ON MONDAY NOVEMBER 23, 2020
No. 7665 PP 2644/12/2012 (031195) www.thesundaily.my
SURREAL SIGHT ...
Motorists were in
disbelief yesterday
after a light plane
made an emergency
landing on the
North-South
Highway
near Kulai in Turn to
Johor due
to engine —
page 6
problems.
– BERNAMAPIX
Grave crisis at hand?
█ BY SHIVANI SUPRAMANI oOfficial figures show one suicide per day involved men.
[email protected] since start of MCO until Oct 30 “Police statistics show 53% of the 266
reported case were mostly aged between 19 and
PETALING JAYA: Mental health experts 40. Those aged above 41 accounted for 24% and
fear that the 266 people reported to those between 15 and 18 accounted for 23%.”
have committed suicide from March 18 Universiti Sains Malaysia lecturer Dr Chooi
to Oct 30 could be just the tip of the Weng Tink said the numbers that make up
iceberg. Malay daily Kosmos! quoted Bukit Aman accounted for 15% while work pressure, suicide rates were under-reported
management director Datuk Ramli Din as hallucinations, mental problems, mass media since suicide is considered a
This translates to 30 suicides per month, or saying 25% of the suicide cases was caused by and drugs contributed 13%. crime. Turn to
one every day since the movement control debt, followed by family problems (24%) and “Most families may report the
order (MCO) was imposed on March 18. Debt marriage problems (23%). Ramli said Johor had the most cases at 47, —
caused by job losses and family problems were followed by Selangor with 39 and Kuala cause of death as something other
cited as the main factors for the suicides. He added that relationship breakups Lumpur with 28, adding that 78% of suicides page 3
than suicide. A study carried out by
2 theSUN ON MONDAY | NOVEMBER 23, 2020
NEWS WITHOUT BORDERS
Govt urged to downsize Cabinet
o Need for governance body government machinery. administration. Japan has 20 ministries Political analyst Lim Teck Ghee called for
that is well supported by “A good number will be 28 ministers,” she including one which has six portfolios, while all positions in the Cabinet to be reviewed.
efficient civil service, says MP the United Kingdom has 21. Closer to home,
told theSun yesterday. “We need to have a Indonesia, with a population of 273 million is “There are countries with efficient and
█ BY NICOLAS ANIL governance body well supported by an governed by 34 ministers. effective governments with much smaller
[email protected] efficient civil service. Cabinet sizes that can provide models for
PETALING JAYA: The Cabinet can be Chin reiterated the need for ministers to downsizing. Germany has over 80 million
trimmed to function as a leaner “There are overlaps and these need to be work hand-in-hand with civil departments people and is one of the largest economies in
administration with greater involvement of looked into rather than creating a number (of rather than create more Cabinet posts. the world. It has only 14 ministries.”
civil servants. Downsizing its 70 posts to positions) to absorb more people.”
ensure no overlaps of duties is vital in a period “Ministers do not have to be on the ground Economist Prof Dr Barjoyai Bardai said
of fiscal austerity, political analysts said. Pejuang listed 12 proposed amendments all the time to ensure things are implemented. having an inflated Cabinet could also be seen
last week to be included in Budget 2021, the They need to set policies and let staff as a tradition to reward those who are loyal.
Petaling Jaya MP Maria Chin urged the main one being the need for the Cabinet to be implement them. It’s about putting the right
current Perikatan Nasional coalition ministers trimmed. people to run and govern the country.” “It can be seen as a form of corruption.
and their deputies to do more with the help of Downsizing the Cabinet is a way for the
The administration helmed by Prime The former Bersih 2.0 chairman also government to show it is thrifty and this is
Minister Tan Sri Muhyiddin Yassin has 70 expressed hope Malaysia would initiate a something positive.”
posts, including 38 ministers and 32 deputies. development fund, raised by political parties,
to be allocated to MPs to carry out services for Barjoyai added while the government
In comparison, the previous Pakatan the people. cannot make any drastic decisions to reduce
Harapan government had 55 posts with 28 the Cabinet right away, it can give a
ministers and 27 deputies. “Countries like Sweden have done this and commitment to do so when it (Cabinet) is
it cuts down corruption.” reviewed.
Other countries with bigger populations
have functioned well with a leaner
Extend loans to hawkers, petty traders: Association BRIEFS ‘REVIEW AMOUNT PAID
TO GLC PENSIONERS’
PETALING JAYA: The Hawkers and Petty RM10,000. It will help them a lot.” “They want to sell things that don’t spoil too KUALA LUMPUR: The Union Network
Traders Association Malaysia will appeal to the Some state governments came to the aid of easily. Food is different, because it needs to be International-Malaysia Labour Center
Finance as well as Domestic Trade and fresh and you have to possess sufficient (UNI-MLC) wants the government to
Consumer Affairs ministries to help small-time traders and hawkers when the movement knowledge to sell. Even for fruits, you have to review the pension payment rate for
traders secure loans to keep their businesses control order was implemented. know the difference between local and 100,000 pensioners from
afloat during these challenging times imported fruits.” government-linked companies (GLC).
There was a one-off RM500 cash assistance Its president Datuk Mohamed Shafie
Association president Datuk Yow Boon given to them, while the Prihatin Special Grant The association, with over 100,000 BP Mammal said the government
Choon said members will discuss a proposal to gave out RM3,000 for small-medium business members nationwide, is also working with should think of the best way to help
be put forth to the ministries at its year-end owners last month. e-commerce platform Grab. the pensioners of Telekom Malaysia
annual general meeting. Berhad, Tenaga Nasional Berhad,
Yow added times are getting tougher for Everything is online now, and things are Keretapi Tanah Melayu, Pos Malaysia
“What is urgent is to help small businesses people intending to start small food made easier through Grab deliveries, which Berhad, North Port, PLUS, Malaysia
stay afloat during the pandemic. Many of them businesses, especially in Johor where he is some hawkers use, he added. Airports and other agencies
are in deep trouble financially because they based. privatised in the early 1980s and
have not worked for over three months and He said the association has also helped 1990s, by providing for them under
incurred operation costs such as rental and “The application for new licences is frozen small businesses without licences to operate, Budget 2021. “The low pension
salaries,“ Yow told theSun yesterday. for the time being. There are already a lot of with the goodwill of the authorities who have payment is one of the social and
existing hawkers and traders, and it will be given some leeway. economic problems. There are
“What they need from the government is to harder to control if there are too many.”
get accessible loans. At least loans up to “They understand the plight of these
There are more people trying to get licences businesses and try to help if they can.”
to sell face masks and other dry items, he said.
Covid-19 communication challenges to be addressed pensioners with service of less than
25 years receiving pension as low as
RM180 a month,” he said in a
KUALA LUMPUR: The Communications and having to co-exist with the virus, trust deficit and with addressing the pandemic has emerged as
Multimedia Ministry is stepping up its Covid-19 disinformation, as well as ways to tackle these one of the challenges in the implementation of statement yesterday. – Bernama
communication initiatives, with greater challenges. effective communication, leading to some
emphasis on quality and effectiveness. people defying SOP and government PASIR GUDANG GETS
“(Another initiative is) expanding the instructions. CITY STATUS
Its minister, Datuk Saifuddin Abdullah, said distribution of the booklet titled Embracing New
the initiatives include sharing data from the Norms in the Community to Prevent Covid-19 Saifuddin said another strategy is to change ISKANDAR PUTERI: The Sultan of
Health Ministry on the virus and conducting Transmission in e-book form and amplifying it the narrative from peddling “fear”to promoting Johor Sultan Ibrahim Almarhum
surveys to better understand the challenges on social media,”he told Bernama yesterday. “hope”and “progress”, shifting the emphasis of Sultan Iskandar has consented to the
faced by every segment of society impacted by the message from “punishment”to “positive Pasir Gudang Municipal Council
the pandemic. Saifuddin had earlier said although the reinforcement”and providing more creative being given city status, declaring it
communication initiatives carried out so far content. the Pasir Gudang City Council,
He said his ministry would identify factors have proven to be good, they will be stepped effective yesterday, said Mentri Besar
giving rise to issues such as stress, lack of or up with more systematic planning and Apart from this, the success stories of unsung Datuk Hasni Mohammad. He also
non-compliance with standard operating implementation. heroes will be shared via a story-telling handed the instrument on the
procedures (SOP), failure to grasp the fact of approach. proclamation to its mayor, Asman
He said trust deficit towards agencies tasked Shah Abdul Rahman. Present were
Johor state secretary Datuk Azmi
Rohani and the state Housing and
Local Government Committee
chairman Ayub Jamil. Hasni said the
Pasir Gudang Municial Council is the
third local government authority in
the state to be upgraded after the
Johor Baru City Council in 1994 and
the Iskandar Puteri City Council in
2017. – Bernama
MALL IN LABUAN
TEMPORARILY CLOSED
LABUAN: The Labuan Financial Park
Complex mall has been temporarily
closed beginning yesterday, after
several workers tested positive for
Covid-19. Labuan Health Department
director Dr Ismuni Bohari said the
closure, for a minimum of three days,
is to allow complete sanitisation
works to be done on all premises on
levels one and two of the mall. “We
have given a directive for the closure
IRRESPONSIBLE ... as several individuals working in the
complex tested positive a couple of
Indiscriminate dumping days ago,” he told Bernama yesterday.
of garbage has been Ismuni said the closure order was
cited as among the issued in consultation with the
causes of flash floods in Labuan Natural Disaster
several parts of Kuala Management Committee after
Lumpur during heavy considering the possible risk of
rain. – BERNAMAPIX infection to customers and other
workers. Financial Park (Labuan) Sdn
Bhd, the company managing the
complex, said in a statement that the
closure also involved all the
commercial banks located on the
ground floor. – Bernama
3theSUN ON MONDAY | NOVEMBER 23, 2020
NEWS WITHOUT BORDERS
Four bestowed ‘Datuk’ titles by Johor Sultan
JOHOR BARU: The Sultan of Johor, Sultan Rabu, Iskandar Puteri City Council mayor Sultan Ibrahim in September to carry out his Pasir Pelangi in conjunction with Sultan
Ibrahim Almarhum Sultan Iskandar, yesterday Salehuddin Hassan, Mejar Cina David Wong duties and collaborated with YSIJ in Ibrahim’s 62nd birthday.
conferred the Darjah Sultan Ibrahim Johor Yang Khoong Soon and Sultan Ibrahim Johor coordinating, organising and implementing the
Amat Disanjungi Pangkat Yang Kedua, Dato’ Foundation (YSIJ) trustee Avinderjit Singh distribution of foodstuff and aid to Johoreans. The ceremony was also attended by Tunku
Mulia Sultan Ibrahim Johor (DMIJ), which Harjit Singh. Mahkota Johor, Tunku Ismail Sultan Ibrahim.
carries the title “Datuk” on four individuals. According to a post uploaded on the Sultan
Wong, a descendant of Wong Ah Fook, was of Johor’s official Facebook page, the investiture Others present included Mentri Besar
They are Johor Health director Dr Aman appointed a “Mejar Cina” with the consent of ceremony was held at Balai Mengadap, Istana Datuk Ir Hasni Mohammad and state secretary
Datuk Azmi Rohani. – Bernama
‘Focus on welfare Tough times for seniors
of healthcare
workers’ oCurrent jobmarketnot‘friendly’forworkers contracts that may be terminated or to fill are usually not meant for
nearing or past retirement age have to be renewed after only three seniors.
KOTA KINABALU: The Sabah months. Shamsuddin said this is
Medical Services Union (SMSU) possible only when the job market is According to the US Bureau of
wants the Health Ministry to still vibrant. Labour Statistics, about 40% of
streamline measures to maintain the “Things have changed and those aged 55 and above were
mental health of health workers who █ BY NICOLAS ANIL Malaysian Council of Employers’ seniors are now overlooked because working as of 2014 and that figure is
have been working around the clock [email protected] Organisations – the seniors could of their age and (presumably lower) expected to increase until 2024,
due to the Covid-19 pandemic. PETALING JAYA: Senior citizens end up being the biggest losers in a productivity level.” while a recent research by American
who have yet to build a big enough tight job market. This is especially so He expressed hope that the think-thank Pew Research Centre
SMSU said it lauds counseling nest egg are in for trouble. under prevailing conditions caused government would emulate indicates that people aged 65 and
services for health workers in Sabah, by the economic fallout from the Singapore’s re-employment policy, above are least likely to lose their
including those from the peninsula, Short of a sprinkling of Covid-19 pandemic. where the retirement age is 62 but jobs compared with those in the
but wanted the government to also exceptions, the demand for retirees citizens can work up to age 67, younger age groups.
look into their welfare. in the workforce is extremely low “If a company wants to reduce its depending on their health and work
despite their years of experience and workforce, the seniors, particularly performance. Another factor is the wage
Its president Ajulahin Japin said knowledge. those who are past retirement age, Managing director of structure. Senior citizens are paid
the union had received a report that will be the first to go,” he said. recruitment agency Asia Recruit, much higher elsewhere compared
health workers in the state had to Industry experts attribute the fact Damien Lim, said job opportunities with Malaysia.
work 12-hour shifts since the to the prevailing job market culture The code states that age is one of are better for senior citizens in
outbreak, hence the need to properly and cultural differences. the main criteria for selection of Western countries, a sign of the Lim pointed out that in
manage the stress they face. employees for retrenchment. cultural difference between the Singapore, seniors take up menial
Malaysian Employers Federation West and the East. jobs such as toilet cleaners at
“With the shortage of workers, executive director Datuk Many companies were adding “There are positions such as airports because they are paid
there is more work to be done and Shamsuddin Bardan pointed out seniors into their workforce as bookkeepers and office managers reasonably well. But in Malaysia,
this will put pressure on the that the demand for senior citizens employer contributions to the that are usually occupied by senior these jobs are taken up mostly by
remaining staff. Therefore, there must “is weak and not encouraging”. Employees Provident Fund drop people. But in Malaysia, those foreigners because of the low
be a more effective way to balance the from 11% to 4% for those past positions are not readily available.” remuneration.
shortage of staff and situations He said under the Code of retirement age. The positions Lim’s clients want
causing stress on the workers,” he told Conduct for Industrial Harmony – “The future is bleak for a senior
Bernama. an agreement between the Human These employees were usually citizen who still needs a job, unless
Resources Ministry and the hired under contract, perhaps for a his expertise is essential and
He said poor mental health could year or two, although there are some difficult to come by,” Lim said.
affect the quality of work of health
workers.
Meanwhile, SMSU assistant
secretary-general Melvin Ebin Bondi
said there are three important
components affecting mental health,
namely pressure, anxiety and
depression, which has to be detected
early.
“If it is not detected early and
managed well, or not taken care of, it
can cause more serious mental
problems.”
Monsoon woes CAREER
for farmers CHANGE ...
Mohamad
KUALA LUMPUR: Farmers are Syukur Mohd
seeing a 40% to 50% drop in vegetable Patti, who
production due to the monsoon recently lost his
season. job, now
assumes the
The steep decline has put farmers persona of
in a fix as their operating costs such as Ironman to sell
manpower, electricity, water and corn flavoured
fertilisers remained the same. drinks from the
back of his van
Cameron Highlands Agriculture in Penang.
Chairman Association Ng Tien Hua – MASRY CHE
told theSun said farmers were ANI/THESUN
producing about 70 metric tonnes of
vegetables daily before the current Actual figures may be higher due to unreported cases
wet spell, but harvest has dropped to
about 50 metric tonnes now. my students found that although “There are cases that go community struggles. culture, silences us on pressing
hospitals were aware of the real unreported, so saying the When something such as the matters and we should learn to
“The unpredictable weather has cause of death, it was usually numbers are absolute isn’t come out of it by educating people
impacted farmers who are reaping ruled as something unrelated From exactly accurate.” current pandemic exacerbates their that it is okay to speak about your
lower yield and this is expected to as requested by the family front issues, it tips them over to issues,” he said.
continue for some time,“ he said, members of the victim,” she page Rajbans said society hopelessness due to a lack of
adding that farmers would not want forgets that mental control on finances and emotions. “Signs are not always easy to
to risk planting too much during the said. illnesses are just like any This causes their anxiety and stress spot and you would need a close
rainy season. Internal medicine specialist other disease and people to spike, he said. relationship with the person to spot
Datuk Dr Rajbans Singh said: should stop overlooking these them.”
“The yield is lower due to lack of “Asian culture, unlike Western
sunlight and warmth needed.”
Ng added that large-scale farms
are more affected due to their high
overhead costs.
OA Organik managing director
Kon Onn Sein said leafy vegetables
such as spinach and kailan are low in
yield.
“This is because of the heavy rain
that causes shock on the plants,” he
said.
“We expect a loss in yield of 50%,
and this translates to their income
being reduced too . We expect the loss
to carry on until January.”
4 theSUN ON MONDAY | NOVEMBER 23, 2020
NEWS WITHOUT BORDERS
‘Review SOP Students unprepared
before conducting for new academic year
screening on
migrant workers’ o Teachers unable to cover syllabus due to shortened student’s achievements. The syllabus also
schooling days and limited access to gadgets and internet, needs to be adjusted according to the actual
KUALA LUMPUR: Compulsory Covid-19 says principal school hours,” she added.
screening of foreign workers is a good move
by the government, but issues faced by █ BY HAKEM HASSAN Ministry come up with a solution to this. Meanwhile, former chairman of a Parent-
general practitioners (GP) in the standard [email protected] “Currently, my school is doing both online Teacher Association, Halim Mad Lazim, told
operating procedures (SOP) for the Rapid PETALING JAYA: The shortened academic year theSun yesterday that although schools have
Test Kit (RTK) antigen swab test need to be needs to be looked into as students are and offline classrooms as not all our students introduced online classes, many students were
ironed out by the Health Ministry. ill-prepared to advance to the next level. have unlimited data and access to gadgets all unable to attend such classes effectively.
the time,” she said.
Malaysian Medical Association (MMA) Teachers have not been able to cover the “Most parents cannot afford to provide the
president Prof Datuk Dr M Subramaniam whole year’s syllabus due to the reduced “At the same time, we have a class portal necessary tools and gadgets for their children
said the SOP, where Covid-19 positive number of schooling days, a principal of a where all the materials are available so students and there is also the issue of limited internet
samples have to be sent to admitting secondary school in Selangor said. can access it at their convenience. connectivity in certain areas as well as cost
hospitals, also caused delays and an issues,” he said. “The government must also
increase in red tape. “The syllabus also needs to be adjusted “For areas with no internet coverage, schools address the financial issues faced by struggling
according to the actual school hours the are supposed to hand out hard copies of school families as children and schools in rural areas
“As the RTK antigen-tested positive students have had (this academic year),” said materials. Even that is not sufficient enough.” will suffer the most.
patient will eventually need to undergo an the principal, who requested anonymity.
RT-PCR swab test at the admission The principal said not all schools are “The Education Ministry should
hospital, we feel it is an unnecessary “We are bulldozing the content in restricted equipped to provide these resources. acknowledge the issue of readiness for online
process to send the samples,” he said in a time, and nothing good will come out of this.” learning, with focus on rural areas. The
statement. On the advancement of students to the next asynchronous approach must be utilised more
She said schools have been handicapped by level, she said public examinations such as the extensively since it takes a more non-traditional
On Nov 20, Senior Minister (Security) the repeated shutting down due to the Covid-19 Sijil Pelajaran Malaysia alone were not enough approach to learning,” Halim said.
Datuk Seri Ismail Sabri Yaakob said the pandemic and suggested the Education to determine the students preparedness due to
government had agreed for health challenges posed by the pandemic. Asynchronous courses are pre-recorded
screenings to be made compulsory for all lectures and digital curriculum materials that
foreign workers in Selangor, Negri “We need to find better tools to gauge the students can access instead of attending class at a
Sembilan, Penang, Sabah, the Federal set time. Communication is done through email,
Territories of Kuala Lumpur and Labuan social networking and collaborative documents.
using the RTK Antigen method.
1,096 new Covid-19 cases, more than half from Selangor
Subramanian also said the SOP, where a
patient confirmed to be Covid-19 positive is PETALING JAYA: Malaysia recorded 1,096 new close contacts, with 139 cases (44.7%),” he said. and an 80-year-old foreign woman who was
isolated at the clinic and made to wait for Covid-19 cases yesterday, with Selangor The statement said 72 cases (6.6%) reported treated at the Duchess of Kent Hospital. All of
pickup by an ambulance or District Health continuing to top the list with 603 cases (55%) them had a history of chronic illness, including
Office staff, was not practical. followed by Sabah with 311 cases (28.4%). yesterday were related to the clusters in stroke.
temporary detention centres and prisons,
There have been cases where patients Health Director-General Tan Sri Dr Noor comprising the Tembok cluster (42 cases), Bakti Three new clusters were detected yesterday,
were made to wait hours for transportation Hisham Abdullah said with the latest figures, the cluster (16 cases), Rumah Merah cluster (four namely the Pengkalan Barat cluster in Perak, Bakti
to arrive due to the heavy workload, and total positive cases now stands at 54,775. cases), Sandakan Prison cluster (four cases), cluster in Negri Sembilan and Bayam Indah
such proper transport arrangements for Seberang Perai Prison cluster (two cases), cluster in Kedah.
Covid-19 positive patients need to be put However, the number of recoveries exceeded Remand Prison cluster (two cases), while the
in place. the number of new cases, at 1,104, taking the tally Kepayan Prison cluster and Matambai cluster A total of 16 cases were reported under the
to 41,597 recovered cases so far. reported one case each. Bakti Cluster, Bayam Indah cluster (five cases)
He added the issue of widespread and Pengkalan Barat Cluster (one case).
commercialisation of screening must also In a statement, he said the number of active A total of 106 cases were being treated in the
be given a more serious view by the cases was now at 12,843. intensive care unit, with 46 of them requiring Meanwhile, Senior Minister (Security) Datuk
government, with the MMA having recently ventilator support. Seri Ismail Sabri Yaakob said 35 Covid-19
raised concerns about organisations not Of the 1,096 positive cases, 1,090 cases sanitisation operations were conducted in 10
registered with health authorities providing involved local transmissions while the rest were There were three Covid-19-related fatalities states, and the Federal Territories of Kuala
Covid-19 swab tests. imported cases. involving two men and a woman in Sabah, taking Lumpur and Labuan on Saturday.
the death toll to 335 cases, or 0.6%, of the total
He said there were many middlemen “The high number of Covid-19 cases in cases. He added that police detained 381 people for
and non-healthcare related agents Selangor was due to the increase in cluster cases, breaching recovery movement control order rules
involved in the screening as well as swab especially workplace-related clusters, namely the The deaths comprised a local man, aged 68, while 20 illegal immigrants and three smugglers
tests being conducted by facilities that were Teratai cluster with 502 additional cases. who died at Tawau Hospital, a 90-year-old local were held and nine vehicles seized in Ops
not self-declared with the Health Ministry. man who died at the Queen Elizabeth Hospital Benteng operations nationwide on Saturday.
“Sabah recorded a high number of cases
“This must be performed by trained following an increase of cases detected among
healthcare professionals or patients can
face the risk of injuries, health issues and
even a false negative result if the swab tests
are performed incorrectly.” – Bernama
AirAsia Group gets seven
stars for health ratings
GOOD TO BE OUTDOORS ... A family taking a ride around Taman Tasik Titiwangsa in Kuala Lumpur yesterday, which is among activities permitted KUALA LUMPUR: Every airline in the AirAsia
during the conditional movement control order. – BERNAMAPIX group has received the top seven stars for Covid-19
health ratings from aviation safety experts at
Airlineratings.com following implementation of
numerous industry innovations in recent times to
make flying more seamless, hygienic and
contactless than ever before.
As outlined on the website, airlines are judged
on seven criteria, AirAsia said in a statement
yesterday.
These include website information on Covid-19
procedures, the wearing of face masks, personal
protection equipment for the crew, modified meal
service, regular deep cleaning of aircraft, personal
sanitiser kits and social distancing onboard.
“It was concerning to find that many airlines did
not appear to comply with the Covid-19 agreed
standards for the protection of passengers and
crew.
“That is changing and our team is reviewing
compliance on a weekly basis. AirAsia was one of
the first airlines to aggressively adopt all the
recommendations,” Airlineratings.com editor-in-
chief Geoffrey Thomas was quoted as saying.
“These are based on the criteria set out by the
International Air Transport Association, the
International Civil Aviation Organisation and the
World Health Organisation on regional and
international safety guidelines,” he added.
– Bernama
5theSUN ON MONDAY | NOVEMBER 23, 2020
CELEBRITYCAUSES undergoing Sintrtueynssiwveasyoing–sapCitOrreaUdiRntTionEgSoYpineORnFisOJhOhikJaOensaShJT,oRInaUdfYtieaSr. 15theSUN ON WEDNESDAY | APRIL 15, 2020
LIFESTYLE
iTnhneecraplel oafce
Stars who don't
wwhoeeitrlJhlonchaejoelslrSisnktagrnnutodoywshhlefeeeadlplltginpeitgeiwnoapsle
settle for less
S bhCoeodlupyldbimogoaasrgdteey?noiunrgistamsw“optYaadiIdkpeeompmstbslifntu’acnoiashuospoorstCywaoeetcsusatwdDhoeprluaSalhmasowwiat█neaeftern2tnheuTalihcohantonlSlodne4iheelnceilehronroBictdlnnhdsdnaailisen.ttaeahwnlhnYnhyugeuehrhca,sfrsestiaeoeoggoschtItofceiaiwSsosboth’‘tsellsadi,uwtmusHwtrerveelsn’o.s.dfluisneaeeecerrsaesarvocSuIeEotelpasnasrsadNnseamlhptRnpc-ypedlnsybrgsDshnliswereao‘iulteehnteeeaeltoisafoawRheninrkdoley?sHehcdnnnhgseseAsditslpoaobiryfoglsdtosirJeknoniajmulmemoueessaSplodevehrom.iheordndjtieAsousoaaav’pstbmasdthnT’lhlr(mnespiiasaevaettenOec(,HmeosegplenyiaDwreOfen.rwuhIIhdai-wysscAynlhigoebhHrsaeyehJae.feduB.x’aefeanarrdto)eorn(eiSoph.aiAn.slyaoaKetwirthlthmwaaJhnarLJ,cinsoyoonoutenaJeAgioiaedljofsnrgnbaeoordnNcoeeopAntkessmceSseSineiduvleiianst.natsytnnneihesioturcacaotienggswuescDmnrrdeidutterioyviai,TgribisintisoenennswdhuoofVeaacypi)icw-snwcstnahr,)ooyre2hoiuicahehdeongvat0pqeiuetsh(narYaiaseegvil1rutrwecwenndn“ne,eoerteaTrnHr7nnhemeIetoyoeysdurhgyd“dAV’HrdiaposaytWmomwrtoaIertgesoAo,soglttochpewoutpuphtcd’ikinvsereo“shuhoirnaseW&waorimt.fyainnmIskmamyh]rle.riepoensstsgtnmniosaedin“ieiohcctdtbhIhexvnprdetsl,nilttgcceteonbdSIdatfrl.uenhutuegwaetreeeoolea’oeoeokidahfunutskoyepduBvttradortlaamiaaburtcswamlih“u’ioyeoandncruedysoacsoncaiutIlnltltlihywIrsiooi.aoieyweelauoaiigotanih,nnlpttnstismoplgsnneiesufnItwogndyhtyrnerlIeunowdgtfeiedptienahtpadoglgtw,yaneryrocsuge’ygbfompgenisearrteehede,hootenpesttmntsgglhohopHlftmadeyeyRtouoRheirhheelotlureemtagbMrhfeboeatdsnodepbrhlorrepasoeeonfaakeaaohtrm’ytlvteateoaggniyiertodwoeieanatheimiulitueslefryhewnnteehkiesnaainebai,kiflieshorlhrnilyvcemboaennvdchennrtIiieoglnieatsilsims,tsnupelfetepsretgyouyeuhsgadyaihgewyfrripdnhealekwspretamgsnoloiliwaaneliynteid,octtarwnghnermanalin,nchnpodirdshuirdaeaanitylkoronereacntnmapyamgtesiJitmrSoeotaaaieilnrlennpkrnaaotdsese.ktilenpo.tllbaiadt”tlsaywiybet.nheunndihpoph.leuiiloumn.sriafnetrnnbbcsinitaopnseehhaggslwIa1esienidswetdTatthsoaiegwatdnnuefttoussgl.hhilneao9nesoeteieonawtdeltd,andfegtetwgdoIsup,ssottereehmepsueoentultkdtilrhariwtgo.?eablnahhrwisteanynepstoIttfinnricysofeidceesiroeI.pueteniomnhyisesraermioopoeaumt[e,oheoeq’,rspofsltIasp’ntgsrsagteglsusntsltasmtnnnaw.wo.aewuo”miptrelolonirt’yresitstltclngyIssanrngnithdrtaeoshihsoiIhiitho)ooletoilkohntlnhnowheeeebydsaeeu.evvhiarehecausrdemvsisafrtuggsetwroiAboedsnntailaivnttaregcsescasthhlhawulrtlutaYos.odseddytpoeig?hrynyfd,?dghhhoseoaesognliettucoto.eoeauasorteett,eheeevceawaah.tpiIohuepedrthulnIelliohdlteIatiawfdrklncddoseeeemne’tsno’tp’l.arr”trste,reieaaadofah,hehwgentedtlrsoryrlypipovaieleeigoaibarnsinvltlnevfaIenitenihsercem“gekrhDnlewksuyioladerIrnentyewgseoyaoeptanhuhhcattehbmgyiudlhpeeoormohetyparcrempsrmeareunwev“ucoenhoaxrosfefeyrbbrWxe“eaaoounwlaincgouppee““erleiteoypWnTtielssvtnonouuitlShteTlesnparoavh“uchleepiponddperroctedea.durdsrtomhIyhoeubunniyresbesariecoawWnnfmfnsts.fensriereealontteeocfaulsssfiwfeatattdmogy,ssaimnSnetiarriihuhietetdirlsasnwydlxvstangmeesnontngmtasirlantihitaoslmis.elrvoidlyaslirthsleyoevsnyoedtsltleistRiion.i”bogtoytynortotseeeiwtnfstayrsshlotewvyneehelhwmeeburimshoIrzpsigcienarep.bigpa”stgnveinen“bsdarptnariamAaelhynodfginhadmenooae.rceeWisyeil”tkanrglorgeneeadnaeentongetmnwthoyafnisegletamoieebtliuwnrsarsnwinmxottrohwpahswwhttmasywtxtfianouedr.sa,aptse“rna’.oeertsaehotgdweontotehsetepepipfeimnrBrnntILoaehosenht?hr,ihgsrodvtei.ttiahrnenSnirein.enteqhyceeweaptidntromihfai.honipmainlaeItofnheesdrencsibnclcsuantttrrptweginotgnthmi.ewnayiueWemaohgo’ehctetaeeeeinghgnreesgit.aefailhasoeLlrgdartsooubs,sinieelces,vngniepfyItasotheeucnanaiaeltabsegwyeyeahnietucretntwithtwdtlraecsaaseboliindtcthtgosswnseawshhcitai,ntsbeopstoin!ecedtaahlhfnnruohh,ihiuttkwvhhucsitaeotbcgeenaoearrysasnt.eyaiipuciyogoeesvaehrnsosnaoifcyfpotirlsogopratowfomT.utrimtteo,are”,taoaunaesgautonieeeideedhuhfnopeufpoyhqvpnsarihsruoqeebgwountrc.veeiybtoaflogoesryeytyueerutssgxscuheusir’aeostvpj’hioleosreynuuommrepsraebiohhaehreaefnbmcrwrhtsieemanroeyuelvivapurtsasnecmyeesaestohdinlarnnaoupty,uniaaiersntececommIgilnpmwhtaatniaeshavhbboncedwcgbanpraethuhe?ecaudronalnliiliinyoihowuiriftigpecunveloxasreoedvnnnsehnosltnitthiiadouem.h.andleonht”sweotnhitumrowfwgtdeoutyen.drue?nsaotisdaoigirrhonataestefneheioitrlaktailaibrnanolhlyceirlsceygerneoltonsntotweo,ggeeihoptnhhdghfnhdgluauoeugaefewaeontueleorfrer,bfrhupeosesPepirsbhatnniisbrlpimnnuebtpooelo“phcbiscaragoogPdeetnnswtfreespmehnelf“heaheoapt.sfynlEpeuvnMtairoeoieebfAipseranaseolmicatoecsfgieunladdemnTdsnsurtohiinoystpopleyleiInttvgennmroKntitchhlmNifneoipruToeismedpnrpen,rhnhotsaelv,vatbtppiricen.ieenhhewfwTsEhnfseiyoelorggaogiespesratiiogRLarelSpprfciye-rmahcdegtonWrogsiidwnerifetnouhriegnwoaegfcniaeretrbcuoeastm.oeaertetwvd,bdgoodingfhdidsaprtrnisnaeanssmorsctitaahwvnacidoreuo,iefvnepmohbr,aeohniiloelpsihttepdmeblttaotidaliwfafeeidwmqaile,lgldhtaaonauiineiirnssooyodhutyvoyroetnvycelnmacrytrurneieyiihchtgsaohgingtcey,.ncaetacfnnnotnsnhmniiAhcbhaemiina“ihelnimhcishrehpyhnn,sngctasnocbecdhiilTbreasenionoodosg,nnaetgene,ch,aattciesdhsertotohioashsr.posddgftmbswrtassrhnair,htcssfbbneiiankoighioehlsiesidaffannltpylotneePoestbimfeonaaiesetehhpanuoecnsen.hrraphyagffunrrmaguiprcwanoecdiutosottioieaonwrimetenccoocysnibruhlpRtiiaiatpmsesnbtnhirercmtcfpaahohtahaebrieduaerlaeeluoeoetaofynraevdboldawibisereuthsitdoseebcrrdiisssghsashfptetletustsharnteueeerhb8icsesehcknitwthymghsaaseaealiitnrote.atsghnoomcetscn4eiilrveiieeholnso.esat–niitamnvnnledutlasppagreotdcmhiloorodo.tefagdecnsroeofslttwAftVtahriUfaobolielfaastthdstviaoaiahoeaerintynbcitrmnipibFypsnapyfybuonomeinnvtnrmorhndnervistakyisPeqghtsdhoaeaeirnmtonmdeidttwesbeaeecthtiesvaehnnfeceehulycedanypurddyeittnewosnedeeltnnmveebasnonhielydttersaLhSygshpattnreraiio,tnltiiheewegnpeetcasdsocrigwttlhaej,aiergeethnanpo,fletomhchiair“tria-sehuotnitasrtelassfrfanaadsgagnaraaUplhuhderyiimsnscmetratdltihtlcarnsdmdcun.allfadeoselmereoendidil-tya(yrogiaftenrsaeraysidanAisneoinbmrimd,seiildmbrnneeetwnnlnboallw,t’bmReroyesnleibn,lybepegmoegiwearUudoihntaotsarnnoldg1tsetns)hoeddgtdh,itye2tmdreaytyee’aymsrshnl.nd8eaee1jonytal
Celeb Speak aofbomoalflenrordaeytahyeom“alEedlnhvencaidaecinlsttialulppithaztroepebtisndlonlelioecgsrartiv,teesntowi.dh”scd–eoauathsstlucAlu.aeolpOFdstpttePnehabpo-neiReeonpsewrleltuoetlhdauarnreixynsocgn,aiotu-tetoctimhgeewcaehsremsmcrsftehosuhficronteeoogrivtpesaeynt,rroavtdbhtvieutuiianssrrdl,ieionaenngnd
A weekly column, published every Monday, featuring popular thheeraaSplhinyegatnuedasicnohgtehsyeorpgeeaxo,epsrloceiussenesdl.f
and on-trend local celebrities talking about their career,
personal life, and what drives them, as well as current theSUN OEN NMOTNDEARY |TAPARIILN27M, 20E20N1T5
and future projects. The celebrities featured come from a
wide range of disciplines and include actors and directors, CEALgEBSlPiElrAKlapboowuter tbawhewsetaeefwthlfhtbrniiohoareeeso“racveonSetouttetrltwaniwgWee“IDbphvw“bedmncbhDsvateBsnaameethalosheee,a“leyngdaieefaklyIanuLgtynaio,lypwenksaout.nsltjaisnmteustbpoaouiwuvsataioutn“trttrtsybunweuirisiht,eytoBdeeeanpitgvetytahescrt.slesemaeu’elrgrobuepgfonerhyouoakp,rweafxitlnrrSnetweaesenttohoxuiabemuaitththndanbtoaisacccniwtrchtavdamtnnrhpryfaeooet“matemuteeypioiatiuleeebspcniemeEasnnfwtnlesmaitssooecmimn.lvoe“ereigemmgcvagubidtgoatefonuetessBn;mcahatrreauiiecshne,trspmsc,eiaatrtmrceoiueibohelaehmeInalticalteinfebolrimnoo,uwysdlhtbeubvanttoeoeobeubnegewiodeymdenpgoeteueifnlunsumatcjunooiteesoahvmsy?tubsusnsoi.leeoaualithotttntnytltfsi,ta?meiseluwyrYmsrrsdusifunaafi“SarncuioesotonoenaivvamtAswonansblfgsbtlgoonnhhrdygnbuieertriaetuigt,cnutltifaeditrfeheauegpsobmahrdiotedttntdneirgoniutyeoeegaadrealoeharthlrbeyrea.breehthigeo’atnmelmlmupuaaltaclsegsroemeowtimngoaoleofoeftttaatpsnootgorhwolgteonwcvehhduitaaceheuptadaiinsotytvopangoaeaaudotgterfobosrohempIohahlnanaoer,eeIkeoog.eahkhyhdyerusipgttpnegoagnrkarnmytretanemerotewdhsteogswolseeeeteatapeehlhgylyheaduchliiosrmighbtdha.iutsdotwwrmonnatanceatoiiem’olrheikalgoe,stvmwosectesbolirlieoniiig“IsnahlwrigahgmtlvavuslewemnebnionasloorroalIa.regaThhybtsedyc..steyieoatnneattsmggurhctemuntIttyineohliphwWa.’ahmywatothosr’yoyIinositdnsluattrtertimt,nsccsainotlerht..lgohnhis”a,nmtfowleusaelomeksofvoawenyakeeeIcryaoeefiemb.sf?ste”aunwetopnietthonrrey.resnihaothhhstonedgrtdieroeaoryttvobdeneuIeaehfhataiannuoesragintgvrflw,onletpnhtlgo,tiicieo,sdhsvhturceheraeyeeeeewdtedsednratoseosd,
musicians, chefs, models and comedians. Celebrities orbeydBeuemcaepuptoyrweqejuurdeineicgnewJaeognmasienCnshteboenaguhtyoppeasgetoants
previously featured include Tiara Jacquelina, Carmen Soo, J THIISNOBKIINTEWERATVNUUHEWLTERYIIAFYRYUO.LNE█tfephrbutrdswbtsrpodhaBaorchbaoraniaehWeemaqlatsoe“emYtsbenem,asahdmierppgBItTisuemAnnoaetedunhhpppseeeJeerlEedmpehoeatuausweatjHeACetsyrarepesairaterbveatiyNesres.cretgssSihgdrtnSesaehsasoeocftrbydiueneereeeckhpaScuenhueonassvtOrtiewavlutcidnesnts?srnratssayynteroidtry’Cilfwau,pNteettteynealntneogtei,miamooaHthrtwnrnpybpvcneocestorgiLpitptsbeenhooroelaagianaepcoiEatweIlaobronp,erM-nrnnsugoyfesrrIejtO,tgonabrywkuCgneo,oekalstooetwaeascirsweea,NsamtgashsonnthtnwsahpeitdttilohtntaieenhuGfnthhetcsee,vhrnw’aoobhlhrmatetttbtnaaosrgeedeteiestettthyhseetfyonoinarhletefssanihrteeeolaahtaabiesrunpthratiitepmoabgansetugsfdnttenhiiaeeatguhamiMorehvtrrehtoallvttgjamnchosteahleognyutecetytohtaiewsdovvarba,peafdtsp.atsrasopalefbiesblhlgtisomcnostelenrmihiu2cheeeovfdvweiaalchoi0hetdasnoeemowrdneeAseee1nmueawaertlnnkgdroer9oaismcvltsta,gomio,tsgiyted.luhleunilojdohrpafmtuodelroqegayft.citedbinobme,n,uahnsrIbeiwceohnteoitwib–e.eajanyncaetaosscunJaadahuh?bgispengeerqioestnuendteoynenes,utymssdtseytphiyjwoCd“tupawoethWIt“oidgltnpewhknehmhfTtetogtrharntrehnpifbiahinaaneeffolatsoomlatnoaTogaetuimeknonedleoecmcnrtutywrttrithI“omotkeeewteecngtog,gIBbIe.lkjemurimrsrorguehIresbceiaumIatysreekgt’nten,’dastmoveaobahnyonamaelinhvtsismytngeeu’lstruurenddxnssholotewoetkeae,dyglebpsatoybmtrowed.lacohepooaaIoltlsafemteubesaiwbitThdadfgweaatrnnpnmrrtoatjaeenolwkhtaountgiyai,weugebehIunrnliettsdeerrteipiyo’e;istonshheponwbjremehhontmkocnlibdjItsaouttnrsiadg,iiuxoalvlotemwohuiaeflciitilsengwcuiawrnrniehaopptoeethcttcuemrggeetgeote.ptnhjirnoegadttr,qeovosaaeaoo,anrhnnpie?lrrsspshrdcennnnriiutsrmiuigoisette.remnnnonfeItreasattohdteiereiaeyIaott,e’wfergtotrrsdn’Iotytanehitddaeiemendo.hseimrobIeni?hkkwkmsee..e’s”ftlgiievyg.eetfdgn”atshutaoeIooele,hre,tt.ioyotrsxaTrryeifotIpoeenIuwekecwotsovnthne-Iigtrnsdbeu,tytoanliefjeontsuateototteIodhen,yyluiwdefbgtioet
Maya Karin, Shalini Balasundram and Haneesya Hanee. Wpoashtplboenregdmuonvtiiel May 2021Oofrrcien2RetnMoWdhlA8saeIrAirp,GaoWalrilunoehlsnIylegecNn2leaabtt0vrsodAew7eei2fe,dorLri1IsucglPLnltrisiYaafdhiaprrfnnetaanorsaboidivcmdrtknnyeehedgotebtoetudyohmntunehpwtliieeconPad.seiittctpmtouuooonrlnanenteuisgtlhnohMtscihanhiasnegy WtMP1ottp“oia5ihmdittIntrtsgw,co.’aaaaheumwnassotecmltdnapwiiOhaepnhpiadomtnorcrscnapnnntaaseh“oCineniWsehtuakthegmrsge“uHtzgpoetrwhistihnis“haalaaIcuitfnern,tphesdstneRooiiacpthtscitptdhwmhetnnvtgianenrergwaeimepeooebstIeonumdnnhal’eIrfsbhgeHotarsnetewiinla?feoitsdtaiyatreyrcivwcfseiohntytaneticratesstetfthhe?mghntonoeutdhllaaea,ttncmheriethieetusrrnsgboal,ahunItIcadeihaedmsteqetlnnsniedeacrke.vKtlwnss”he.ctsyduhnIIkahtpneyrshd.eoRoaa.eowleangoc2eianslnirutartpnlnaHotlentav0hhfgtinasptg’glfmpofhklwseshos2faaereoebniglaao,holertaeoent0fecanwoglietayfroetrtddtetnrioitpnen,sote’esyofhosqTsiranrtiadyndndetFooahnmshhItauoebVnhtoih’eueefnuaitbnatnfaovieeotBaout.wbtottaeea’nsyerigolwtlayosenntsIlyrryllubcteyoa,muwteihfsualtt’iosn wilfalliannwdgstotoiWsp“aosdntwpaatjpattisrfocpeBfuethtljanhfhosuoeorhuwhhhishoeeaedgeectttegrrrthdyiebecneahgaha“houtem“gfat“swmoorgletseytdTuhItaeuaeNrrliaorewtsaencsdehetehmdnlhmgoytsjidyloeance,tmmiuateeneoaobthcmvnrtltlhsitrpestlndluvopoieeb.sn”vagese?mmyneatateagegravue,yeppwhlarotygntsesspvnleesahrupupcsnoetyeusieyraarsnsaheuttyeebto,oaetsasghguhhyieowarlvbnvyul,psreetpiefrmafrais,twatputcleiaeueeaawdrisaeuwnlsssescrnsutwasxnontthurfhuwbehed,hootfouoantaefmcdo.eidpajsbetiipmirsopmmteyrtecollrvroojhfleleiecgjsnimieeoeentueonsaiea.etnboihsctnrnevstlntihlrbo.entatheotoeiehadiepntase,ancevibunsgrenesetdg,
FPhirucctieascqrodsPituspuariaotsrro.opa,ennmslwsaceahnohivusahctnniaohrtgseuitnhse ttnbohouetnhswieentoehprserlsodlel’oswssncilghilneoedrpemicsnulaogmss.tuehHraeoitnlolbyfomwmxo-iodoos-fdtJfiuocilsefy
Celebrity Causes has led 2LaE0Pehdcart2MsWeaheihaaW0ccgpnpveii.HhasrMTcreeyttohiiueharhdtzausldtrnaaeorb.eiihpeeckrepenfsbieaolrrssrthsoeoam.ogcb,prfenmfkr)Ieoysna,nyz,amnrws,atttIcttihTehearhhmaelelnenheioldervsaeieif2ewanrSeoCnRit0snnhafSoibh.ef0ldttocaDolisiui9(hnadacwrusprpryewrFnotcernfehlelftanfrlaoCdmaoeooaeyticirhaynenaeemvnoRraneetafntleigdoiseelaumndsegelCdntlndtrng.haabbiJoooeOowoExrtyeromnER–wnnhfj’iieeirkiBDevluiennfhotionvlsssoaahArwp.tibfomaoi,lnroaoFet,eyslnhtsrfrnP,o,te-
This column comes out every Wednesday, and
features a local personality speaking about a social Wahlberg.
cause, either as an ambassador for a social/ – AFP
charity organisation, or as an activist. The column
serves to create awareness of the cause, and to
inspire readers to make a change themselves.
Causes/organisations that have
been highlighted include
a school for refugee
children, teaching people
how to live a zero-waste
lifestyle, and helping
underprivileged
students stay in
school.
crC–EeoChNfniOenTsoitUEnanRRgngTTtwAbEjoISheNuYloiMrenOwvEeeFeNysRaTotOrhfeaCg. tKrolEifweTFiinsUgaEaLnd
Contact theSun's Sales & Marketing team to book your advertising space.
03-7784 6688 [email protected]
6 theSUN ON MONDAY | NOVEMBER 23, 2020 Wedding planners reject
NEWS WITHOUT BORDERS new venture suggestion
Light plane makes o We are professionals and have invested a lot in the field, Suhana Samsudin, who runs a public
highway landing says company owner address system business with her husband,
said they are comfortable with the idea of
KULAI: A four-seater light aircraft made █ BY ALISHA NUR MOHD NOOR operating procedures, should switch to other venturing into new businesses.
a forced landing at Km47.7 of the North- [email protected] areas of business as he said the wedding
South Expressway (NSE) after PETALING JAYA: Stakeholders in the wedding scene in the country has changed its style to “But financial assistance is needed to
developing engine problems yesterday. industry have not taken kindly to a minister’s adapt to the new norm. cushion the impact and also to start
suggestion that they venture into other something new,” she added.
It is learnt that two pilots, both businesses. Kamaruddin pointed out that most of
Singaporeans, took off in the aircraft at them take this line as a professional full-time Meanwhile, the Malaysian Wedding
about 10.50am from the Seletar Airport Indian Wedding Planner Malaysia job and have invested a lot in the field. Council Entrepreneurs Association said
in Singapore at about 10.50am and were co-founder Kamaruddin Zulkifli said the based on data recorded by the association, a
en route to the Malacca Airport when the minister’s suggestion was akin to rubbing “It is unfair to expect us to switch to total of 150,000 weddings planned during
incident occurred just 15 minutes into salt on a wound. another profession,” he said. the Covid-19 pandemic nationwide were
the flight. pushed back since April.
“Wedding practitioners are not those who “A typical small-scale event company of
The privately-owned aircraft was just choose this industry because they are three years would have assets worth nothing “Only 5% of these weddings or
flying at about 5,000 feet when its engine SPM leavers or uneducated,” he told theSun. less than half a million. solemnisation ceremonies were conducted
suffered loss of power. online and the rest are still waiting to get
“Some of us, like myself, have been “If we change industry, we can’t sell or married once the situation improves,” said
After several measures taken by the certified wedding planners for the past give the assets away as we bought its secretary-general, Arabath Ali Arul
pilots to regain normal flight failed, they seven years, and we have many equipment and use it multiple times to Alavudeen.
decided to land the single-engine photographers who have won international provide services to our customers.
aircraft on the highway. recognition and took a lot of courses to excel “This shows that a wedding gathering is a
in their particular field.” “It’s not easy to liquidate and turn it into culture of Malaysian society that cannot be
The pilots, identified as Yang Kuang cash. eliminated with the development of
Ying, 52, and Saleehullah Abdul Majid, Recently, Entrepreneur Development technology and the pandemic,” he said.
41, managed to safely land the aircraft in and Cooperatives Minister Datuk Seri Wan “We have no money as capital to start a
the midst of moving traffic on the NSE. Junaidi Tuanku Jaafar said players in the new business, we didn’t receive anything in However, he said Wan Juniaidi’s
wedding industry, who are affected during the newly announced Budget 2021. suggestion should be considered as the
Both men were unhurt and the Covid-19 due to the strict standard wedding scene in the country has changed
aircraft was not damaged. “The only option that we have is to use and adapted to the new norm.
our savings to pay our expenses. We can’t
Police were alerted and arrived at the apply for any loan as there has been no “While the association is ready to explore
scene before a traffic unit was deployed income for the past six months.” other business ventures , we hope to receive
to ensure smooth traffic flow. support and assistance such as grants from
the government.”
The US-registered aircraft, that is
owned by Yang and was parked by the
shoulder of the highway, drew curious
looks from passing motorists.
Later, the aircraft was pushed to an
open space beside the highway where it
is expected to undergo an inspection for
defects by aircraft maintenance
personnel.
Pensioner Alias Aki uses a fan cover to scoop sea snails at Pantai Pandak in Terengganu. – BERNAMA PIX Penang
Sentral
Abundance of sea snails caused by uncertain weather: Expert traders feel
pinch due
KUALA TERENGGANU: The uncertain weather survival of their population. Andaman Sea, south India, the Malacca Strait to Covid
and oceanographic changes are among factors “Apart from that, a resilient generation will be and South China Sea. Research in the waters of
for the abundant presence of sea snails at Pantai Pulau Bidong in 2018 also recorded the existence BUTTERWORTH: The majority of
Rusila near Kampung Rhu Dua in Marang here, produced to return to the habitat. Through this of the species there. traders at Penang Sentral here are
since a few days ago. phenomenon, the snails can explore new areas concerned as they have had hardly any
to find food sources,” he said when contacted by “It is widely found in areas where there is customers lately.
A senior lecturer and malacologist at the Bernama yesterday. seaweed and on sandy seabeds. It ‘reappears’
Faculty of Marine Sciences and Environment in after decades due to strong waves and Julaika Paulino, 19, who helps her
Universiti Malaysia Terengganu, Dr Nursalwa The beach was lively with locals arriving there oceanographic changes that have occurred sister sell snacks, said customers were
Baharuddin, said strong waves caused by the to watch the sea snails, said to be last seen about lately.” afraid to leave their house due to the fear
northeast monsoon caused water turbulence 50 years ago. of Covid-19 infections.
from top to bottom. She said the snail can be eaten. It is high in
Nursalwa said the snails, scientifically known protein, as well as cholesterol. It is advisable for “But for us traders, we still need to
“This phenomenon makes the adult snails as margistrombus marginatus, measures the snails to be soaked in salt water overnight to operate our business due to our financial
congregate in order to increase reproduction and between four and eight centimetres long. remove the slime, dirt and sand before cooking. commitments,” she told Bernama.
“These snails are mostly found in the Julaika also said she had difficulty
finding a part-time job as not many
employers were willing to hire workers
while the country is facing a pandemic.
“So, I help my sister here for the time
being,” said Julaika, a student at one of
the private universities in Kuala Lumpur.
Azira Abdul Manaf, 27, a trader at the
food court, also expressed concerns as
she has to bear piling debts due to
reduced profits.
“The business hardly breaks even.
From more than 15 dishes previously, we
are now down to only two.
“Our shop has to reduce production
costs as we need to cover the existing
debts. We open our shop daily but there
are no customers. This is very difficult for
us,” she said.
Siti Haslinda Kamal, 35, who sells
clothes, said although the
implementation of the conditional
movement control order in the state was
for the health and safety of the people,
she really hoped the pandemic would
end soon.
“In the past, it was very lively here with
the presence of visitors, but now the
atmosphere is gloomy. In a day, we have
only five customers or fewer,” she said.
7theSUN ON MONDAY | NOVEMBER 23, 2020
* NEWS WITHOUT BORDERS
US approves Covid antibody treatment
o Therapy aims to reduce hospitalisation of those infected therapies may help outpatients avoid But with cases surging across the US and
and alleviate burden on healthcare system hospitalisation and alleviate the burden on our globally, that means access will not be
healthcare system,” said Stephen Hahn, widespread.
WASHINGTON: US drug regulators have given number of doses will be available in the commissioner of the US Food and Drug
an emergency approval to a Covid-19 antibody coming weeks. Administration (FDA). Some states were imposing new restrictions,
therapy as the pandemic led to further closures including California, where a 10pm to 5am
in parts of the world. The same therapy was used to treat Regeneron’s antibody treatment is the curfew was taking effect.
President Donald Trump when he was second synthetic antibody treatment to receive
With cases surpassing 12 million in the sickened with the virus. an emergency use approval from the FDA after On the opposite side of the Atlantic, British
United States, the highest globally, many a similar therapy developed by phamaceutical Prime Minister Boris Johnson plans to
Americans were, nonetheless, heading to The green light for drugmaker Regeneron company Eli Lilly was granted the status on announce that restrictions across England are
airports to travel for next week’s Thanksgiving came after REGEN-COV2, a combination of Nov 9. to end on Dec 2 as planned, his office said.
holiday despite health officials’ warnings to two lab-made antibodies, was shown to reduce
stay home. Covid-19-related hospitalisations or The company said it expects to have doses Britain has suffered more than any other
emergency room visits in patients with ready for 80,000 patients by the end of country in Europe from the coronavirus,
The antibody therapy offers some hope for underlying conditions. November and approximately 300,000 patients with more than 54,000 deaths from 1.4 million
those infected, though a relatively small in total by the end of January 2021. cases.
“Authorising these monoclonal antibody
These will be available to patients at no In the Middle East, Iran announced it had
out-of-pocket cost under the terms of a shut non-essential businesses in over half its
government programme. cities and towns for up to two weeks and
introduced movement restrictions. – AFP
G20 nations back global access to vaccines England to announce
stricter measures
RIYADH: G20 nations have emphasised the trials, and as calls grow for G20 nations to plug people by adopting policies to mitigate this
need for global access to coronavirus vaccines a US$4.5-billion (RM18.5 billion) funding crisis,” he told world leaders in opening LONDON: England will end a national Covid-19
at a Saudi-hosted virtual summit dominated shortfall. remarks last Saturday. lockdown on Dec 2 and move into tougher tiered
by efforts to tackle the pandemic and the regional restrictions than before, with more areas
worst global recession in decades. “Although we are optimistic about the China President Xi Jinping spoke of the facing severe constraints to prevent the virus
progress made in developing vaccines, need to build a “global firewall against from reigniting, Prime Minister Boris Johnson’s
World leaders popped up in multiple therapeutics and diagnostics tools for Covid- Covid-19” as he called on G20 nations to help office said.
windows across a flickering screen, in a high- 19, we must work to create the conditions for distribute vaccines “fairly and efficiently”,
stakes webinar held amid the raging affordable and equitable access to these tools according to state news agency Xinhua. A second wave of infections has started to
pandemic. for all people,” said Saudi King Salman, the flatten, official data shows but scientific advisers
summit’s host. And French President Emmanuel Macron are expected to warn today that previous
The leaders are huddling online for the said the health crisis was “a test for the regional restrictions did not go far enough and
two-day gathering as international efforts “We have a duty to rise to the challenge G20”, stressing there “will be no effective harder measures are needed to prevent another
intensify for a large-scale rollout of together during this summit and give a strong response to the pandemic unless it is a global national lockdown.
coronavirus vaccines after a breakthrough in message of hope and reassurance to our response”. – AFP
“The prime minister and his scientific advisors
Trump skips summit to play golf are clear the virus is still present, and without
regional restrictions it could quickly run out of
RIYADH: US President Donald Trump went the source, adding that “he didn’t say Trump was substituted by Treasury control again before vaccines and mass testing
golfing after making a brief online anything about the global situation”. Secretary Steven Mnuchin as the other have had an effect,” a spokeswoman said.
appearance at the G20 summit, an event world leaders had their say. Later, he left
hosted by Saudi Arabia but staged virtually “It’s been an honour working with you the White House and headed to his golf “That would put in jeopardy the progress the
because of Covid-19. and I look forward to working with you in course in Virginia, not far from Washington. country has made and once again risk intolerable
the future and for a long time,“ he said pressure on the NHS (National Health Service).”
A source with access to the online according to a second participant. He was met by a handful of supporters
sessions, which were closed to the media, with Trump flags, one carrying an effigy of Johnson ordered England in to a month-long
reported that Trump had “said that he had Trump, who has still not accepted defeat the 45th US president and a “Four More lockdown in early November after infection cases
done an absolutely incredible job during following President-elect Joe Biden’s victory Years” banner. and deaths started to rise again, angering
his term, economically and with the in the Nov 3 presidential polls, spoke businesses and some of his own political party
pandemic”. following the opening of the two-day Another sign, however, showed a slice of over the economic consequences.
virtual summit. bread marked with the words: “Face it.
It was an exercise in “self-publicity” said You’re Toast.” – AFP Britain has suffered the worst death toll in
After his moment in the virtual limelight, Europe and the deepest economic contraction of
any G7 nation, prompting sharp criticism of
Johnson’s handling of the pandemic.
Prior to the latest lockdown, England had
been placed into three tiers, with the toughest
measures imposed in northern England, where
movement was limited and pubs were forced to
close unless they sold substantial meals.
Johnson’s office said the prime minister would
set out a new Covid Winter Plan today, with more
areas placed into the higher restrictions under
the tiered system. – Reuters
Rome bar bans virus talk
PORKY ISSUE ... Participants at the annual pro-labour march ‘Autumn Struggle’ in Taipei yesterday protest against the lifting of restrictions on US ROME: The message is clear from the hand-written
pork containing ractopamine feed additive. – AFP poster above the counter, all talk of coronavirus,
lockdowns or virology is strictly forbidden.
In this little bar on the outskirts of Rome, the
manager hopes to give her clients a brief respite
from the global pandemic while they drink their
coffee.
“We’ve been talking about the same thing for
months, so we chose to lighten the atmosphere,“
Cristina Mattioli, manager of the Feeling bar,
told AFP.
Bruna Piazza, a regular who comes in to buy
lottery tickets, thinks it’s a great idea.
“We’re fed up with talking about Covid, we can’t
take it anymore, everywhere we go we only talk
about Covid,“ the 58-year-old said.
“I’m happy to talk about anything except that,
I’d rather talk about the weather or celebrities.”
As the first European country hit by the
pandemic, Italy has been under the shadow of
Covid-19 for longer than most, and endured one of
the toughest lockdowns. After a heady few weeks
over the summer where life almost returned to
normal, the pandemic again dominates everything,
with deaths mounting each day.
“It’s not at all about denial or not understanding
the difficulty of what the world is going
through, but just about giving yourself a break,“
Mattioli said.
Most customers in the bar have reacted
positively to the ban, she added.
8 theSUN ON MONDAY | NOVEMBER 23, 2020
NEWS WITHOUT BORDERS
UK, Canada agree to ‘rollover’ EU deal
LONDON: The UK and Canada have agreed a The agreement will continue a settlement “This is a fantastic agreement for Britain negotiations to begin in the new year on a
“rollover” deal to continue trading under already agreed between the EU and Canada in which secures transatlantic trade with one of comprehensive deal with Canada, which
existing terms as the current European Union the Comprehensive Economic and Trade our closest allies,” Johnson said in a Brexiteers have touted as a benefit of leaving
agreement when the Brexit transition period Agreement and does not give any new statement. the bloc.
ends, the government has announced. benefits to UK businesses.
“British businesses export everything from But with negotiations over a trading
Prime Minister Boris Johnson and his However, the government insisted it avoids electric cars to sparkling wine to Canada, and agreement with the EU, the UK’s biggest
Canadian counterpart Justin Trudeau sealed an estimated £42 million (RM228 million) in today’s deal will ensure that trade goes from trading partner, going down to the wire and
the “agreement in principle” during a video tariffs for businesses if negotiators had failed strength to strength.” key issues still unresolved, there remains a
call last Saturday, the Department for to secure a deal before the end of the Brexit considerable amount of uncertainty for
International Trade (DIT) said. transition period next month. DIT added the settlement with Canada businesses. – The Independent
secured this weekend paves the way for
Court rulings put new BRIEFS THOUSANDS IN FRANCE
pressure on Trump PROTEST OVER BILL
o Outgoing president fails in lawsuits and mounted a pressure campaign to speculative accusations.” PARIS: Several thousand people
attempts to prevent states prevent states from certifying their vote totals. For Trump to have any hope of remaining in protested in Paris against a Bill
from certifying votes that would make it a crime to
So far, attempts to thwart certification have the White House, he needs to eliminate Biden’s circulate an image of a police
WASHINGTON: After a scathing court setback in failed in courts in Georgia, Michigan and 81,000-vote lead in Pennsylvania. officer’s face with the intention
Pennsylvania, President Donald Trump faces Arizona. that they should be harmed.
increased pressure from his fellow Republicans The state is due to begin certifying its results Supporters say police officers and
to drop his effort to overturn the US presidential “This should put the nail in the coffin on any today. their families need protection
election and concede to Democrat Joe Biden. further attempts by President Trump to use the from harassment, both online
federal courts to rewrite the outcome of the 2020 Trump’s lawyers vowed a quick appeal but and in person when off duty.
Since Biden was declared the winner two election,” said Kristen Clarke, president of the lawyers who opposed him in court say he is out Opponents say the law would
weeks ago, Trump has launched a barrage of Lawyers’ Committee for Civil Rights Under Law. of time. infringe journalists’ freedom to
report, and make it harder to hold
Last Saturday, Matthew Brann, a Republican Some of Trump’s fellow Republicans in police accountable for abuses
federal judge nominated by former President Congress are now breaking ranks. such as excessive use of force, a
Barack Obama, dismissed a similar effort in growing public concern. On the
Pennsylvania, writing that the case amounted to Republican Senator Pat Toomey said the Trocadero Square in western
“strained legal arguments without merit and ruling closed off any chance for a legal victory in Paris, rights activists, trade
Pennsylvania and called on Trump to concede unionists and journalists chanted
the election. – Reuters “Everybody wants to film the
police!” and “Freedom!”. Edwy
UNREST ... Demonstrators Plenel, chief editor of the
set part of the Congress investigative news website
building on fire during a Mediapart, said the proposed
protest demanding the legislation was “a green light
resignation of Guatemalan for the worst elements in the
President Alejandro police”. – Reuters
Giammattei in Guatemala
City on Saturday over 430 STRANDED AS
discontent on the 2021 FERRY RUNS AGROUND
Budget. – AFP
STOCKHOLM: A passenger ferry
ran aground next to islands
between Sweden and Finland,
leaving nearly 430 passengers
and crew stranded for the night,
the Finnish owner and coast
guard said. The Viking Line’s
Grace, sailing between the
Finnish port of Turku and the
Swedish capital Stockholm, hit
rocks shortly before a stopover in
Mariehamn, Finland’s coast guard
said. The cause of the accident
was not immediately known but
there were powerful winds in the
region. “There is no water leak
and no immediate threat” to
passengers, the coast guard said.
Aboard the vessel were 331
passengers and 98 crew. – AFP
Students rally in
dinosaur outfits
Hong Kong, Singapore travel bubble delayed BANGKOK: Thousands of high
school students upset about
HONG KONG: A planned travel bubble between But with small populations and a heavy “In light of the recent surge in local cases, we Thailand’s lacklustre education
Hong Kong and Singapore was scrapped a day dependence on links to the outside world, they have decided, together with the Singapore system rallied alongside protestors
before its launch after the China city announced have been hard hit as the global economy government, to defer the air travel bubble’s dressed as dancing dinosaurs in
a sudden spike in coronavirus cases. collapsed. launch by two weeks,“ commerce secretary Bangkok.
Edward Yau told reporters.
The decision is both a blow to the two cities’ Desperate to help their key tourism and It was the first mass gathering in
battered tourist industries but also for other aviation sectors, they came up with the plan After weeks of single-digit infections, Hong the kingdom since Prime Minister
countries who had been hoping the scheme allowing limited, quarantine-free travel between Kong health authorities have begun reporting a Prayut Chan-o-cha warned
might be a model to replicate during the the cities as long as visitors test negative for sudden uptick in cases in recent days. authorities would use all laws,
pandemic. Covid-19. The travel corridor was set to kick off including harsh royal defamation
yesterday morning. They recorded 36 local coronavirus cases last charges, to crack down on
The two financial hubs have both suffered Saturday. Crucially, 13 were from unknown pro-democracy protesters.
comparatively mild outbreaks with strict social But on Saturday, Hong Kong announced the transmission sources, prompting fears the
distancing and border measures imposed soon scheme would have to be delayed for two weeks city has a new wave of out-of-control Ahead of last Saturday’s rally,
after the pandemic first emerged. following a sudden rise in coronavirus infections. infections. – AFP three student leaders were
summoned for police questioning
and Thai Lawyers for Human
Rights said there were now four
juveniles facing potential
prosecution.
But despite the threats the
youngsters remained defiant as they
danced alongside half a dozen T-Rex
characters representing Thailand’s
“political dinosaurs” and bounced
around giant “asteroid” balls.
“We have to come out and make
our voices heard to force change,“
Leaf, 15 told AFP.
9theSUN ON MONDAY | NOVEMBER 23, 2020
SPEAK UP
COMMENT by Chandra Muzaffar
RCEP brings hope amid gloom
IN the midst of the gloom brought by
the twin health and economic It is also the reassertion of the through RCEP that their real neighbours disputes between and among RCEP
crises, the birth of the Regional importance of multilateralism which has are in Asean and North East Asia. members with the aim of weakening the
Comprehensive Economic also been subjected to immense “The very organisation.
Partnership (RCEP) is a ray of light pressures in the last few years. creation To put it starkly, RCEP may be the
auguring hope. of RCEP is conduit through which the two This is why RCEP should develop
More than a million lives have been The very creation of RCEP is a a statement countries finally acknowledge that they mechanisms that will address these
lost worldwide as a result of the statement that economies at different that economies are not part of the West but integral to disputes.
coronavirus pandemic, there is massive levels of progress need not succumb to need not Asia.
unemployment and entire societies have myopic nationalistic measures in order succumb to It could be an Eminent Persons
been devastated. to preserve their political independence myopic In other words, for Australia and New Group drawn from within RCEP or an
For the 10 Asean states and their five and sovereignty. nationalistic Zealand, RCEP could turn out to be an Early Response Caucus which will
partners, three from North East Asia and measures identity marker. deliberate on a dispute and recommend
two from South Pacific, to come together Indeed, multilateral arrangements in order solutions to the RCEP leadership.
to form RCEP in a situation like this is a can always been worked out which will to preserve It is not inconceivable that as the 15
bold and brave leap of faith. help members of the partnership their political members of RCEP re-orientate, their What RCEP should not do is to sweep
The countries are of course hoping achieve their economic goals while independence regional and even international roles problems under the carpet.
that the new grouping will accelerate strengthening their autonomy and and will change considerably.
their economic recovery since they have independence. sovereignty. In this regard, appointing a RCEP
all been affected by the twin crises to a But attempts to consolidate and secretary-general, who will focus upon
greater or lesser degree. More than contributing to strengthen RCEP will not be a walk in the its primary agenda of developing the
As trade barriers are removed and regionalism and multilateralism, RCEP park. economies of the region but is also
bureaucratic hurdles overcome, there may also pave the way to a positive deeply cognisant of political
will be a greater flow of affordable goods re-orientation of its member states Even as it is, there are major political undercurrents, is imperative.
and services across borders leading to which in turn will impact the global and security issues facing individual
enhanced economic growth and more economy and world politics. RCEP states. It could be a retired political leader or
opportunities for shared prosperity. a retired diplomat who is also
RCEP, however, is more than a Through RCEP, Asean states may For instance, they relate differently to knowledgeable about RCEP’s complex
response to immediate and urgent begin to realise that getting closer to Beijing on the contentious South China cultural nuances.
challenges. their North East neighbours China, Sea issue.
It is a tremendous boost to Japan and South Korea, on the one hand, The person will serve as the regional
regionalism at a time when the concept and their South Pacific neighbours such The United States’ stance on the issue grouping’s anchor in the initial years.
and practice are faced with new as Australia and New Zealand, on the complicates matters.
problems as witnessed by the other, not only makes economic sense The secretary-general’s principal task
experience of the European Union in but also denotes deeper geographical There are also longstanding disputes is to ensure that RCEP does not flounder
recent years. roots and cultural meanings which have between RCEP states which occasionally and fail.
Regional cooperation promises the yet to be discovered. erupt into friction.
more rational and efficient utilisation of Its success, which in the ultimate
new technologies. RCEP may well serve The same argument goes for China, Relations between China and Japan; analysis will depend upon the collective
as a platform for this. Japan and South Korea that have Japan and South Korea; China and political leadership of the grouping, will
somewhat limited interaction with Vietnam; Thailand and Cambodia; be a fundamental prerequisite for the
Asean countries at the cultural and Singapore and Malaysia; Malaysia and evolution of a new global economic
societal levels. the Philippines; Myanmar and Malaysia; order.
and Australia and Indonesia have all had
Perhaps re-orientation will have the their ups and downs. Dr Chandra Muzaffar is International
greatest significance for Australia and Movement for a Just World president.
New Zealand as they come to appreciate What makes it worse is the role Comments: [email protected]
played by individuals and groups
outside the region, including sections of
the media that are ever ready to exploit
COMMENT by R. Murali Rajaratenam A potted history of the PlayStation
Video games can be good Sony launches the PlayStation 5 this autumn. Together with its four earlier namesakes, it brings to
for mental health almost 20 the number of game consoles produced by the Japanese tech giant since its 1994 debut model
PlayStation (PS1) PlayStation 2 (PS2) PSOne
Lifespan: Dec 1994-Jul 2000 Lifespan: Mar 2000-Oct 2004 Lifespan: Jul 2000-Mar 2006
Price: $299 1 Price: $299 2 Price: $99 3
Units sold: 104.25m Units sold: 157.68m Smaller, cheaper
Primarily focused Most successful redesign of original
on 3D-modelled game console PS1, featuring
games read from ever made. Plays improved graphic
CD-ROM discs most PS1 games user interface
PlayStation 3 (PS3) PlayStation Portable (PSP) PlayStation 2 Slimline
THE Covid-19 lockdowns have with individual values, and pursue with friends, or even a stranger Lifespan: Nov 2006-Sep 2009 Lifespan: Dec 2004-Aug 2007 Lifespan: Oct 2004-Jan 2013
online (with whom you may be
boosted user engagement with meaningful goals); competence battling a common enemy or Price: $499 6 Price: $249 5 Price: $99 4
completing a same task together).
video games around the world. (feeling effective and capable of Units sold: 86.90m Units sold: 80.82m Smaller and quieter
Gamers can also feel a sense of than original PS2,
Being an avid gamer myself, I can overcoming problems); and relatedness with the virtual First console to Handheld games includes built-in
attest to this as I have been relatedness (feeling connected to characters in the game and with the support HDMI, console, more Ethernet port for
spending numerous hours on my others). game world itself. Identifying 1080p TV displays powerful than rival online gameplay
closely with a character and their and Blu-ray Disc media Nintendo DS
situation motivates players to help
console and PC. Satisfying these basic the character, and, when the PSP Slim and Lite PlayStation 3 Slim
character succeeds in achieving
Many gaming companies and psychological needs leads to tasks, enhances their sense of Lifespan: Aug 2007-Dec 2014 Lifespan: Sep 2009-Sep 2013
competence.
platforms have seen their revenues greater well-being and motivation. Price: $169 7 Price: $299 8
Some games have been
increase during the pandemic. Conversely, when these needs developed specifically to promote Redesigned PSP, Slimmer form factor,
In Australia, in are frustrated (such mental well-being during the with brighter decreased power
the same week that as by home pandemic. For example, a game display and other consumption and
confinement and called Shadow’s Edge aimed to help minor refinements. quieter cooling
“Some games havesocial distancing players cope with isolation and Tweaked again 2008 system
fear, using empirical and
rules were ‘social distancing’ of theory-based foundations like PSP Street PSP Go
narrative therapy and artistic
been developed16 to March 22), the lockdown and expression to enable players to save Lifespan: Oct 2011-Dec 2014 Lifespan: Oct 2009-Apr 2011
announced (March a city destroyed by a storm.
intensification of Price: $99 10 Price: $249 9
Such games are known as
specifically toconsoles passive surveillance) “functional games”. Simplified model Half size of PSP
sales of game there may be with mono speaker, Uncharted 4: due to mechanism
and In conclusion, video games are a no microphone, A Thief’s End that slides controls
games increased by negative effects. popular medium with potential to no Wi-Fi and no sold 16 million behind screen
help people cope psychologically brightness buttons copies on PS4 when not being used
promote mental285.6% and 278.5% with many of the adverse aspects of
well-being duringrespectively. Video games the Covid-19 crisis. PlayStation Vita PlayStation 3 Super Slim PlayStation TV
There is a have potential to
satisfy these Game providers can take steps Lifespan: Dec 2011-Feb 2014 Lifespan: Sep 2013-May 2017 Lifespan: Nov 2013-Feb 2016
to protect players’ health and
suggestion that the psychological needs players should be aware of the need Price: $249 11 Price: $270 12 Price: $99 13
during the Covid-19 for moderation to keep themselves
the pandemic.growth of gaming safe and healthy. Units sold: 10-15m 2kg lighter than Units sold: Poor
previous PS3, with
during the crisis. The writer is senior lecturer Successor to manual sliding disc Non-handheld
pandemic hasn’t Research shows at Faculty of University PSP, intended cover instead of variant of PS Vita.
Foundation Studies, to compete with motorised slot-loader Connects to TV
smartphone games and uses controller
HELP Matriculation Centre.
just been because people wanted games help facilitate a sense of PlayStation 4 Slim PS Vita Slim PlayStation 4 (PS4)
more entertainment, but rather autonomy by giving players a sense
Lifespan: Sept 2016-present Lifespan: Feb 2014-Mar 2019 Lifespan: Nov 2013-Sept 2016
wanted more interpersonal of being free to make choices and, Price: $299 16 Price: $199 15 Price: $399 14
interaction. depending on the game, provide a Smaller, quieter, Revised edition of Units sold: 110.40m
cooler version PS Vita, lighter and
The top five most downloaded meaningful narrative for of PS4, with thinner, with better Sold 1m units in 24
games during the lockdown all completing tasks. improved Wi-Fi battery life thanks hours. Can share
support a multiplayer experience. Well-designed games facilitate a and Bluetooth support to cheaper screen gameplay images
on social media
In China, eight out of 10 of the feeling of competence by PlayStation VR PlayStation 4 Pro PlayStation Classic
fastest growing video games are presenting challenges that are Lifespan: Oct 2016-present Lifespan: Nov 2016-present Lifespan: Dec 2018-present
also online games that allow neither too hard or too easy to Price: $399 17 Price: $399 18 Price: $99 19
multiple players to play achieve and imbue a sense of Units sold: 5m Improved hardware Units sold: Poor
enables 4K TV
simultaneously. reward by finishing designed tasks. Virtual reality rendering and Miniature, nostalgic
Self-Determination Theory Players also get a sense of headset that better PlayStation replica of original
posits three basic psychological progress and achievability while requires PS4 VR performance PS1, preloaded
to operate with 20 games
needs for people’s mental they play a game. Sales of all PlayStation consoles, from 1994 to 2020: 560 million units shipped
well-being: autonomy (feeling able Games also offer a sense of Introductory prices shown. These are usually lowered several times during device’s lifetime. Models often receive updates that change internal components,
but do not alter functionality or exterior design. Illustration features machines categorised as new consoles or relaunches by Sony only. Omits televisions with
built-in PlayStations. “Units sold” figure includes all redesigns of same console series
to make choices, act in accordance relatedness as gamers can play Sources: GameSpot, Guinness World Records, central-manuals.com, Sony, PlayStationLifeStyle Picture: Naughty Dog/Sony © GRAPHIC NEWS
10 theSUN ON MONDAY | NOVEMBER 23, 2020
MEDIA & MARKETING
Providing necessary aid
KK SUPER MART’s
corporate social o KK Super Mart lights up the lives of others this Deepavali
responsibility (CSR)
programmes are actively
organised in a way to help out
communities in need, as the
initiatives are not only limited to
the terms of activities organised by
the company, but also the Create delicious
government and non- cocktails at home
governmental organisation (NGO)
programmes that engage with the UPLIFT #StayHome moments with your
communities. loved ones and surprise taste buds by
In conjunction with the creating exhilarating cocktails using the
Deepavali celebration, KK SUPER exclusive Somersby Cocktail Kit! Bring on
MART is entrusted to assist the your bartender skills and concoct delicious
Kuala Lumpur City Hall (DBKL) drinks with Somersby’s cocktail kit.
and the Ministry of Federal
Territories (KWP) in providing Purchase RM150 worth of Somersby
essential items for the Food Basket products and you will be rewarded with a
Giving Programme and Donation free Somersby Cocktail Kit that comes with a
to 500 recipients who have been shaker with lid and cap, ice tongs, double
affected by Covid-19. jigger, stirrer and a booklet of Somersby-
The ceremony in Menara DBKL inspired cocktail recipes with refreshing
Tower 1 was attended by Deputy brews like 1664 Blanc, Carlsberg, Brooklyn
Minister of Federal Territories and more!
Datuk Seri Dr Santhara J.P., Federal
Territories Deputy Secretary Datuk Simply submit your receipts for purchases
Hajah Rosida Jaafar, Community at participating super- and hypermarkets via
Development and Urban www.somersbymalaysia.com to redeem the
Wellbeing Department Director exclusive cocktail kit and stand a chance to
Tuan Hj Anwar Mohd Zain and Santhara (centre) giving the food basket to a recipient, together with Chai (right, in orange face mask). be in the running to win a Nintendo Switch
Socio-Economic Development weekly from now until Dec 31.
Executive Director Datuk Ibrahim sugar, cooking oil, flour, rice KK SUPER MART. responsibility activities will
Yusoff, along with KK Group of vermicelli, instant noodles, soy As a leading corporate company continue to be carried out, such as Unused smartphones
Companies Founder and Group sauce, and other supplies costing the upcoming programme weigh 24,000 tonnes
Executive Chairman Datuk Dr KK RM100. in the retail industry, KK SUPER organised by KK SUPER MART; the
Chai. MART’s 490 outlets throughout the GEROBOK MUHIBBAH in Masjid ACCORDING to a recent study, the
Every recipient will receive Each of them will receive an country were not spared from the Jamek Sultan Abdul Samad, Kuala cumulative number of shelved cell phones
essential supplies such as rice, amount of the fund from DBKL and effects brought upon by Covid-19, Lumpur. per capita accounts for some 23,964 tonnes
KWP, as well as facial masks from but the company’s social of e-waste – equivalent to more than 54
Boeing 747-8 airplanes.
Covid-19 coverage from as low as 31 sen per day
The study, carried out by the online used
BERJAYA Sompo Insurance they are not burdened by the fall ill and have to be purchase this policy online electronics store reBuy and covering 27
Berhad (Berjaya Sompo) sudden loss of income and hospitalised. We have also made without the need to undergo a countries worldwide, shows that disposing of
recently launched a new unexpected expenses when they it convenient for customers to medical check-up.” old mobile phones remains an arduous
protection plan, SOMPO endeavour for many households. That
CashNow, which provides Depending on the SOMPO particularly seems to be the case in Sweden,
insurance coverage for death CashNow plan chosen, the where there’s an average 1.31 shelved
and bodily injury resulting from insured will receive a daily cash mobiles per capita, which means that the
accident, daily hospitalisation benefit of up to RM18,000 when Scandinavian country has more discarded
income as a result of injury or hospitalised for any illness or phone models gathering dust in homes than
illness and hospitalisation injury or, a lump sum payment it does citizens. – AFP-Relaxnews
allowance in the event of of up to RM5,000 if hospitalised
hospitalisation due to Covid-19 for Covid-19.
from as low as 31 sen per day.
In the event of the insured’s
“Health and income death due to an accident, a
protection have become all the maximum lump sum payment of
more important during this RM20,000 is payable under the
unprecedented time,” said Tan SOMPO CashNow policy.
Sek Kee, Chief Executive Officer
of Berjaya Sompo. To find out more about
SOMPO CashNow, please visit
“By introducing SOMPO www.berjayasompo.com.my/
CashNow, we aim to better product/sompo-cashnow.
prepare our customers so that
* Terms and Conditions apply.
CAREERS
Ready for a career change in 2021?
PUBLICATION DATE 15 DECEMBER, 2020 (Tuesday)
Speak to theSun’s Sales team now for special deals on BOOKING & STORY DEADLINE 1 DECEMBER, 2020 (Tuesday)
digital, video and print advertising.
MATERIAL DEADLINE 10 DECEMBER, 2020 (Thursday)
S E C U R I T I E S S D N. B H D. SunBIZ MONDAY
NOVEMBER 23, 2020
197201001092 (12738-U)
Editorial: Tel.: 03-7784 6688
A Participating Organisation of Bursa Malaysia Securities Berhad Fax: 03-7785 2624/5
A Trading Participant of Bursa Malaysia Derivatives Berhad Email: [email protected]
Advertising: Tel: 03-7784 8888
Participation Bought Sold Net
% Fax: 03-7784 4424
RM m RM m RM m Email: [email protected]
48.3 Institutions 2490.4 2493.4 -3.0
38.7 Retail 1996.9 1996.0 0.9
13.0 Foreign 668.8 666.7 2.1 106.97 5.99 8.05
NIKKEI TSEC S&P/ASX200
100.0 5156.1 5156.1 0.0 10.07 36.01 94.57 14.64 25,527.37 13,716.44 6.08
KLCI STI HANG SENG SCI KOSPI 6,539.17
Preliminary stats (excluding trade amendments). For final data, please refer to www.bursamalaysia.com 1,593.75 3,377.73 2,553.50
Source: Burs Malaysia 2,813.01 26,451.54
KL MARKET SUMMARY Ex-doctor with passion
November 20, 2020 for skincare business
INDICES 11,463.80 CHANGE +86.90
FBMEMAS
FBMKLCI 1,593.75 +10.07
CONSUMER PRODUCTS 586.78 +2.76
INDUSTRIAL PRODUCTS 160.18 +1.79
CONSTRUCTION 173.20 +2.88
FINANCIAL SERVICES 14,023.30 +16.19
ENERGY 742.17 +4.31
TELECOMMUNICATIONS 609.57 +4.68 RM150,000 a month, from regular
HEALTH CARE 3,959.64 +55.92 o Nurul A’in Sa’ari leverages on social media to grow postings on social media, Aen said.
TRANSPORTATION 751.82 +4.80 Alluskin brand However, the MCO also delayed the
PROPERTY 640.62 +1.62 production of the company’s skincare
PLANTATION 7,344.48 -4.51 products.
FBMSHA 13,221.70 +141.88
FBMACE 11,153.50 +12.85 █ BY EE ANN NEE products and subsequently creating Aen said she frequently shared
TECHNOLOGY 63.70 +0.13 [email protected] Alluskin. medical and skincare postings on
“I started (formulating) Alluskin Twitter and had generated a following
TURNOVER VALUE PETALING JAYA: Following her passion during my housemanship and I’m before launching Alluskin products.
9.008 BIL RM5.156 BIL to pursue a skincare business as confident that Alluskin will grow.” Using her influence on social media to
opposed to being a doctor was the best Alluskin is made to be gentle on promote Alluskin, she also engaged
decision that Dr Nurul A’in Sa’ari said sensitive skin and currently sells three micro-influencers to review the
5 MOST ACTIVES she made, despite objections from her products: cleanser, toner and light bulb company’s products and is now
November 20, 2020 family. serum (brightening serum). Its best expanding its various social media reach
selling product is the cleanser which it and working with more influencers to
STOCK VOL CLSG (sen) +/– (sen) Nurul A’in, or more commonly sells 5,000-7,000 bottles a month. secure a stronger social media presence.
AT 432,927,200 18.5 +0.5 known as Aen, is the founder and CEO of Retailing at RM59 for 100ml and RM30
VSOLAR 412,298,700 5 +0.5 Alluskin Sdn Bhd which she established for 30ml, Aen said, the cleanser has “Previously we focused more on
ASB 223,706,700 18.5 +3 in August 2019 after quitting as a glycolic acid that helps remove dead Twitter and we’re now trying to reach out
SCHBHD 218,821,700 36.5 +3 medical officer just a week into the job. skin cells, improve skin texture and to other social media. We’re planning
KANGER 196,061,800 19 +1 brighten up skin. billboard advertising across Malaysia.
“My husband was fully supportive. We have started to enter pharmacies and
However my parents were against it. “In the local market, not drugstores (Farmasi Hero in Sendayan
Thus, it took a while for them to many products use active and Farmasi UKM Kesihatan). We’re
5 TOP GAINERS accept my decision,” the 28- ingredients in their exploring digital marketing as well, like
November 20, 2020 year-old told SunBiz. cleanser. My cleanser not Google Ads, Facebook Ads as strategy to
only cleans, it also move forward.”
STOCK VOL CLSG (RM) RM “I quit (becoming a doctor) exfoliates the skin cell. It’s
NESTLE 74,400 140.00 1.20 because the medical field is like two-in-one and it About 80% of Alluskin’s sales come
SCIENTX 1,494,000 12.50 0.74 not my passion. I love does more than just a from its sales representatives across
TIMECOM 1,720,600 13.90 0.48 enterpreneurship and I make basic cleanser.” Malaysia, Brunei and Singapore, while
PETGAS 311,600 16.76 0.44 use of what I have learned in The movement control the remaining 20% comes from its
EURO 1,103,500 3.87 0.37 medical school in Alluskin. order (MCO) period saw website. Aen said it is eyeing a 50-50
Applying the knowledge that I contribution from both channels moving
have is more beneficial for the Alluskin’s revenue double forward.
skincare business and I hope it to a record
5 TOP LOSERS will become a trusted local RM260,000 in She said the focus in the immediate
November 20, 2020 brand.” May 2020, term is to launch its new product,
from an nicknamed Alluskin Barrier Care, next
STOCK VOL CLSG (RM) RM Aen said she had average year. She plans to release the full range
PPB 395,200 18.08 0.40 difficulty in finding of Alluskin basic skincare products by
DLADY 17,000 37.40 0.20 skincare products next year, before moving to the advanced
HLFG 33,600 16.06 0.18 that suit her dry range in the following year.
KLCC 227,600 7.75 0.18 and sensitive skin,
VIVOCOM 68,240,100 1.74 0.18 which led to her “We want to market our products to
formulating her Southeast Asia and penetrate into the
EXCHANGE RATES NOVEMBER 20, 2020 own skincare UK market. We have customers from UK
Nurul A’in applies where they buy from Malaysians
Foreign currency Bank sell Bank buy Bank buy what she learned studying there.”
in medical
1 US DOLLAR TT/OD TT OD school on her Now, Aen’s parents are fully
1 AUSTRALIAN DOLLAR 4.1570 4.0310 4.0210 products supportive of her business.
1 BRUNEI DOLLAR 3.0420 2.9200 2.9040
1 CANADIAN DOLLAR 3.0890 2.9990 2.9910 “My mother starts to talk about my
1 EURO 3.1740 3.0890 3.0770 business to other family members and
1 NEWZEALAND DOLLAR 4.9410 4.7800 4.7600 friends,” she said.
1 SINGAPORE DOLLAR 2.8830 2.7770 2.7610
1 STERLING POUND 3.0890 2.9990 2.9910 Malaysia Airlines seeks aid from
1 SWISS FRANC 5.5150 5.3390 5.3190 Khazanah, talks with creditors continue
100 UAE DIRHAM 4.5520 4.4430 4.4280
100 BANGLADESHTAKA 114.4800 108.5300 108.3300 KUALA LUMPUR: Malaysia Airlines’ airline will depend on the outcome of
100 CHINESE RENMINBI 5.0100 4.6590 4.4590 parent company has sought financial aid discussions with creditors and lessors,
100 HONGKONG DOLLAR from its sole shareholder, the county’s which it said is crucial to the success of the
100 INDIAN RUPEE N/A N/A N/A sovereign wealth fund, as debt restructuring.
100 INDONESIAN RUPIAH 54.1800 51.4800 51.2800 restructuring talks with creditors drag on,
100 JAPANESE YEN 5.7000 5.3500 5.1500 the company said on Saturday. Malaysia Airlines is seeking to
100 NEWTAIWAN DOLLAR 0.0304 0.0275 0.0225 restructure after the Covid-19 pandemic
100 PAKISTAN RUPEE 4.0060 3.8800 3.8700 “Malaysia Aviation Group has requested forced it to slash operations.
100 PHILIPPINE PESO financial support from our shareholder
100 QATAR RIYAL N/A N/A N/A Khazanah Nasional although the company The parent company had warned
100 SAUDI RIYAL 2.6400 2.4700 2.2700 isn’t in a position to comment on amount leasing companies that Khazanah would
100THAI BAHT 8.7300 8.2100 8.0100 at this point in time,” it said in an email to stop funding the group and force it into a
115.3800 109.5400 109.3400 Reuters. winding down process if restructuring talks
112.0400 106.3600 106.1600 with lessors were unsuccessful, Reuters
14.3000 12.6800 12.2800 The group said it remains in talks for a reported last month.
restructuring and that it was targeting a
Source: Malayan Banking Berhad/Bernama commercial agreement in the first week of The carrier restructured after two tragic
December. events in 2014, with Khazanah pumping in
RM6 billion. This time the government has
The airline could be seeking as much as said it will not bail out the company.
US$500 million (RM2.1 billion), said The
Edge weekly, which first reported the news, Chief executive Capt Izham Ismail told
citing unnamed sources. staff in a memo last month that the
restructuring talks were taking longer than
Khazanah said any funding for the planned. – Reuters
12 theSUN ON MONDAY | NOVEMBER 23, 2020
SUNBIZ
Retune your business
for growth
Perikatan Nasional’s maiden budget has a raft of technology-focused measures ranging from THE ACCOUNTANT‘S
improving digital connectivity to promoting investments in high-value added and green PERSPECTIVE
technologies. – REUTERSPIX
COVID-19 has challenged businesses like survival. Think of new ways to improve or replace
Technology players among businesses no other event before it and many business processes to increase efficiency and
most receptive to Budget 2021 businesses are now fully focused on productivity such as automating repetitive
building greater resilience into their processes. In terms of products and services, it is
KUALA LUMPUR: The Covid-19 crisis has buildings stand to save the most in terms operations. Building resilience requires a crucial that leaders and frontline employees react
demonstrated the importance of of energy bills, the RM1 billion allocation thorough and ongoing monitoring of the trading quickly to address challenges and find solutions
technology and innovation to ensure the for the Industrial Digital Transformation environment and then tuning the business to that address the local demand and expectations
people’s well-being and business Scheme can potentially assist these optimise performance in those conditions. It is that Covid-19 has created.
sustainability, and Budget 2021 is placing a businesses to adopt Internet of things about treating the current downturn, in the words
great emphasis on these aspects. technology which can help make energy of Professor Andrew Scott of the London Business The pandemic combined with the movement
consumption more intelligent,“ he said. School – like a pit stop. control orders and economic uncertainty have
It is therefore of little surprise that certainly changed the way we consume products
technology players are among the most Hence, he said, Budget 2021 needs to If you are a Formula 1 race fan, you would be and services and it has also changed how your
enthusiastic supporters of the budget, be approved in due time, with open very familiar with what happens during the pit clients and customers behave too. Businesses will
which is currently being debated in the conversation from all parties to ensure that stop. The strategy is for the car to spend a very short become irrelevant to their customer base if they
Dewan Rakyat and is scheduled for voting priority is given for the financial allocations time off the track undergoing a highly-focused fail to understand the changing behaviours and
in Parliament in a few days’ time. to address the Covid-19 pandemic crisis performance review and reset. This involves priorities brought about by the pandemic.
and revitalise the economy as well as for changing tyres, refueling and retuning to complete
Perikatan Nasional’s maiden budget has the nation’s overall political stability. the race in optimal alignment to the conditions. Businesses should know by now that
a raft of technology-focused measures This is how businesses should respond to Covid-19 consumers are turning to technology at a very
ranging from improving digital Meanwhile, Halal Street UK (HST), an e- – by adjusting and transforming some of the rapid rate, thus it is crucial for businesses to have
connectivity to promoting investments in marketplace for Malaysian products in the external and internal drivers to boost business a robust online presence. When everybody is
high-value added and green technologies. United Kingdom, said the proposed performance, achieving a velocity that returns the probably searching for information and shopping
budget is positive as it addresses problems business to a growth trajectory. online, how you talk to your customers, how you
Ko Chuan Zen, co-founder and CEO of and challenges that cut across all sectors of communicate, and what messaging you’re giving
solar photovoltaic solutions provider Plus the society while cushioning the economic If there’s one lesson that the pandemic has taught out will become a differentiator. With the help of
Solar Sdn Bhd, said the budget’s proposed impact of the Covid-19 pandemic. businesses, it would be the importance of agility. technology and social media channels,
measures would facilitate economic Business agility as we know, is the ability to compete businesses need to improve their digital presence
recovery for the people’s well-being, It applauded the government’s move of and thrive by responding quickly to market changes and digital engagement with consumers seeking
including through allocations for the allocating RM1 billion to accelerate the – internally and externally, and seizing opportunities immediate feedback and comments.
development of a more sustainable and adoption of digitalisation under the digital with innovative business solutions. Being agile can
knowledgeable Malaysia. transformation scheme and additional thrust businesses ahead and organisations that were In today’s digital age, businesses are not only
funds of RM150 million which will be lacking this agility ability on not just one, but bound to serving the domestic market.
“Though tabled, the budget’s approval provided under the SME Digitalisation multiple levels of the operation, will unfortunately Businesses should explore using digital channels
hinges on getting parliamentary approval. Grant Scheme and the Automation Grant. face the end of the road. to access customers beyond their borders. With
At the same time, Malaysia’s renewable the proper platform and logistics in place, it is
energy sector finds itself at a critical “Sufficient initiatives and incentives To stay in the game, businesses must possible to your make your products available to
juncture. have been announced towards supporting continually learn from their operations and customers who are in other regions of the world.
businesses, especially among small and environment, then quickly execute change
“Several initiatives and allocations medium enterprises (SMEs) that are still whether it is product development, better Besides that, never stop communicating with
under the budget, such as the first reeling from the impact of the pandemic, customer experience or growing new markets. your customers and anticipate their changing
Sustainability Bond in Malaysia for to move to e-commerce. needs. Customer communication remains more
environmental and social initiatives, will The pandemic has definitely forced businesses valuable than ever from both a basic survival and
position Malaysia as a regional hub for a “The RM35 million being allocated to to take a closer look at how their operations can future trends perspective. The decline of physical
sustainable lifestyle,” he told Bernama. promote Malaysian-made goods and be more responsive. One area that business meetings presents challenges to relationships.
services under the Trade and Investment owners should review is the supply chain. Many However, alternative interactions such as video-
Ko said the bonds, which are loans used Mission is certainly helpful for the SMEs to businesses experienced major disruptions during calling prove to have benefits of their own and with
to finance projects that bring clear recover from their losses and have a bigger shutdowns internationally and also in local people spending less time travelling, there is more
environmental and social-economic market reach by going global,” it said. markets, which poses the question – should a time to make those calls which results in more
benefits, will help sustain the industry at business’ supply focus be more domestic or more personalised time and attention to your clients.
this difficult time. HST said all entrepreneurs should take international?
these opportunities that will definitely The market conditions are changing fast. It will
He also said the RM2 billion allocation benefit them in the long run and assist them One must weigh the risks and benefits of be wise for businesses to adapt and retune to be
under the Green Technology Financing in riding out the economic storm as well as offshore and onshore suppliers and also review ready for the curves in the road ahead. So, keep in
Scheme (GTFS) for two years up to 2022 is a empowering the digital and gig economy. alternative or underutilised sales and distribution mind to readjust customer strategies and
great initiative, especially for firms planning channels. Select the lowest risk profile that best operations to meet the conditions. Don’t just
to invest in green technology. Meanwhile, Ericsson Malaysia, Sri Lanka aligns with your long-term business strategy for power through the crisis, pause for a pit stop to
and Bangladesh head David Hagerbro said growth. retune your business for the twists and turns on
“Commercial and industrial sectors investment into expanding critical digital the road ahead.
stand to benefit from the GTFS,” Ko said, infrastructure and innovative services Disruption to the supply chain may mean
noting that the main criteria include the while democratising internet access will be having to create products using inputs that This article was contributed by Grant Thornton
company or business must be at least a key drivers for Malaysia’s recovery and businesses might not otherwise have considered, Malaysia PLT senior partner and MICPA Council
51%-owned legal Malaysian entity. economic growth. and this results in innovation. We all know that
innovation is key for business growth and member Desmond Tan.
“Given that commercial and industrial
Mah Sing and AirAsia jump on actives bandwagon
WARRANTS WATCH RHB Investment Bank’s statement Top warrants by volume traded came in second on the top traded list.
that the Covid-19 vaccine deployment Out of the total 120.7 million units
THE Malaysian warrants market could be a new demand source for Warrant Volume Issuer Exercise Expiry date traded, bearish investors accumulated
recorded a RM809.8 million turnover rubber gloves at up to 18 billion pieces name (mil) Kenanga level/price 26 Jul 2021 more than 5.0 million units as the
last week, which was 1.7% higher than a year assuming that 60% of the SUPERMX-C1I 220.1 Macquarie 30 Dec 2020 warrant’s bid price fell 35.0% week on
the prior week due to renewed world’s population of 7.5 billion will HSI-HDI 120.7 Macquarie 14.00 21 May 2021 week, moving in an opposite direction
interest in stocks which were badly get the vaccine in two doses annually MAHSING-C30 91.8 Kenanga 23,400 26 Apr 2021 to the 1.1% weekly gains in the Hang
beaten down due to the Covid-19 (The Edge Markets, Nov 19). AIRASIA-C1J 80.4 26 Jan 2021 Seng Index futures.
pandemic. Nonetheless, warrants TOPGLOV-C84 63.9 CIMB 1.58
over rubber glove stocks continued to Call warrant SUPERMX-C1I was 0.80 To view the full list of structured
dominate the warrants space with crowned the top traded warrant last 6.00 warrants available on Bursa Malaysia,
RM455.4 million traded, which made week with 220.1 million units traded, visit malaysiawarrants.com.my.
up more than 56.2% of the total followed by MAHSING-C30 and inflated by other investors queuing in Group finished in the green for the
warrants market. TOPGLOV-C84 which ranked third the market. second consecutive week as its share Provided for Malaysian residents’
and fifth on the list with 91.8 million price recorded an 8.3% week-on- information only. This commentary has
Supermax, Mah Sing and Top and 63.9 million units traded, Following the positive vaccine week gain on hopes of the upliftment not been reviewed by the Securities
Glove were among the most popular respectively. Last week, investors took developments by Pfizer and BioNTech of travel bans. Call warrant AIRASIA- Commission Malaysia. It is not an offer or
rubber glove underlyings last week. home a total of 11.5 million units of on Nov 9, another American biotech C1J secured the fourth spot on the top recommendation to trade and is not
The shares of rubber glove players MAHSING-C30 which resulted in this company Moderna Inc said on traded warrant list with 80.4 million research material.
experienced heavy selling pressure call warrant being close to sold out. Monday that its experimental Covid- units traded as the warrant price
throughout last week before staging Investors should practise caution 19 vaccine was 94.5% effective in jumped 25.0% on-week. Past performance is not indicative of
small rebounds on Friday following when trading sold out warrants as the preventing the disease. future performance. You should make
warrants market bid price may be Meanwhile, put warrant HSI-HDI your own assessment and seek
Low-cost airline operator AirAsia professional advice.
13theSUN ON MONDAY | NOVEMBER 23, 2020
SUNBIZ
Be prepared to
weather storms
with no warnings
oThis week, SunBiz gets the thoughts and views of
Open House KLCC founder AndrewWong
SUCCESS: replaced by a new sense of caution and although I think I would be terrified of him. Malaysia’s greatest brand.
THE INSIGHT STORY understanding that technology can be harmful I’ve read a lot about him, and his biographies, I know it isn’t a typical brand per se, but I have
too. While the internet did bring the world but it would be fascinating to meet him in to say KLCC’s Petronas Twin Towers. That put
How has your life experience made you the closer, it also caused deeper rifts. person. He went to an art school, a dropout, us on the map over 20 years ago, and today it
leader you are today? and nothing in his history suggested that he still has its value despite losing the tallest
I think it is because I come from a very liberal The evolution is now people wanting more was a technologist. No one asked him why he buildings crown many times over. It was
family, and they allowed me to explore what privacy, being aware of the social ills the tech thought personal computing was the future, emblematic for Malaysia, and that trickled
I’d like to do with the life that has allowed me revolution brought, and wanting more self- and how did he see so far into the future that down to so many other businesses and brands
to learn, observe and experience things for control over it rather than institutional control that is where we will be heading. trying to stand out because all of a sudden if a
myself. I have also been very lucky to have over us. What has been the biggest challenge you have brand said they are from Malaysia, the rest of
spent time away in the US and the UK growing How has mentorship made a difference in faced? And what did you learn from it? the world knew where.
up, and that gave me different perspectives on your professional life? Without a doubt, it is this current pandemic. I A must-read for every business
the same thing. Seeing the same things Like a potential seed growing in the garden, have gone through several global financial owner/manager is ...
through different lenses lets you expand on having a gardener tend to it will allow it to crises before, and have survived it, but this is a I am not sure if you can print this, but Mark
something. bloom fruitfully. This is not saying that wild whole new level. It is uncharted territory and Manson’s The Subtle Art of Not Giving A F**k.
weeds can’t bloom too, but having a mentor to what I have learned is to never cross Mother Once you are free from fear of failure, judgment,
It is also my good fortune to have been guide you through the muddle especially in Nature. Her powers are extra-territorial and and other people’s crippled EQ development,
surrounded by great friends who strive for your formative years is a plus. nothing we plan can ever stop her. We just you can do more and move forward faster.
excellence in whatever they do, and also being have to be constantly prepared, without How do you expect policies on climate
mentored by the ex-bosses that allowed me to I encourage young people to come into the sounding alarmist. The question on my mind change to impact businesses in the future?
grow. I hope to pass that on down to my team now. workforce to find one that will guide you and is – What’s next? How and where do we go The change impact hasn’t been so great yet in
What traits do you look for in your talent or advice. I am lucky to have encountered several from here? Malaysia, although baby steps have been taken
how do you decide who is right for a job? ex-bosses that have given me the opportunity What was the most outlandish business like banning plastic straws and bags. But I do
Passion, creativity, integrity, and a hunger to and shared their experience with me. proposal you have ever heard of? believe it is something that we need to address
succeed. And not in any particular order. Unless What do you want to accomplish in the next I was told, “What if I told you I found the secret holistically with a timeframe that allows
I’m hiring a doctor or a pilot, I’m not that five years? to everlasting happiness, and I want to share businesses to shift step-by-step. I don’t see any
interested in how many paper qualifications I am working towards growing our group, this with the world?” I wasn’t quite sure if he masterplan of sorts that addresses this yet,
one possesses. If one has these qualities in expanding into other areas of the hospitality was asking me to invest in a cult or be gullible which is worrying because what I don’t wish for
every strand of their fibre, you can throw them industry. I would love to move into creating a enough to want to invest in this scheme. are last-minute diktats.
into anything and they will come out great at resort/hotel brand, bringing together all our What man-made innovation confounds you? What are the top three factors you would
whatever they do. food & beverage brands, and extending it into Why? attribute your success to?
an interconnected lifestyle experience where it The modern-day chain letters you find on social I still see everything I do as a work in progress,
What I cannot accept are people that are too includes living, dining, fashion, music, arts and media. It is a useless innovation of virally so I am not sure if I can call myself successful
lazy to think. Those that just want to be told culture. This intersection is happening in all promoting nothingness. The ones where they yet. But what I can share is... success is so
what to do. It doesn’t matter if the results don’t aspects of our lives. It is not by chance the latest ask you to participate or your cat dies. It’s a transient. I can have success one day, but can it
come out as hoped, but if I know they have iPhone color du jour is blue, and the newest challenge of posting something, or copy/paste sustain for the next? I rather see my “success” as
thought about it and gave their best, it is all I can BMX X5 show car is in blue too. something, or sends it to 10 friends to show how value over a longer period. Did I add any value
ask for. good a friend you are. I know it is harmless to what I do and over time, did that value
How do you think the industry you are in will Our lifestyles are subtly linked, and the mostly, but I don’t know why. increase is how I prefer measuring myself.
evolve in the future? undercurrents that drive our choices in what we
The hospitality industry is going through its wear, eat, listen to, or use is far more prevalent
toughest challenge with the pandemic and with than seen by the naked eye.
no end in sight. And even if there is, would it Best piece of advice you ever got on your
ever be the same again? career.
Train your replacement, or for the rest of your
I still believe humans need a physical life, you’ll be doing the same thing.
connection, and when all this is over, I strongly Most-admired business leader? Why?
believe people will come out again. It is even Steve Jobs. He had a singular vision and despite
more imperative for our industry to focus on how many setbacks he faced, and many times it
creating memorable experiences each time we was through his own mistakes, he never failed
come out, and be that through amazing dining to learn from it and moved closer to his vision.
spaces or customer service. So much of what he did (and still does through
Apple) greatly influenced and changed the
I think the food & beverage industry will split world we live in today. It is his relentless pursuit
mostly into providing a sustenance service – of this vision that I admire most.
such as eating three times a day, or a
connection service – going out to a restaurant to It is different from being stubborn.
celebrate, gossip, find solace with a book and Stubbornness can be foolish. But a person with
coffee, or pow-wow over business dinners. a vision is always navigating the paths to
What advice can you offer those looking to achieve its goals and learning when not to let
start their career/own business? go, and when to let go.
Jump into it with eyes wide open! And be How do you stay abreast of issues affecting
prepared to weather storms with no warnings. It your industry?
isn’t for everybody, and it takes a certain spirit I try to read as widely as possible, both for my
to want to be an entrepreneur. The fulfillment industry and for others. I truly believe lifestyle-
and reward come in different forms and shapes, oriented businesses such as hospitality
and it isn’t always monetary. intersects at so many levels, and what is
happening in the fashion world can be
Of course, one goes into business to make interpreted into a dining experience, for
money unless you’re in some sort of social example. Technology plays an important part
enterprise, but one only has a 50/50 chance to too. I had my first ride in a Uber in San
succeed so I would say the motivation has got to Francisco years before GrabCar came into
be more than just money. existence, and who would have thought then
We all know about the industrial revolution, ride-sharing could evolve to a food delivery
are we in for a technological revolution? Your service also? Now that 5G is knocking on our
thoughts. doors, what will come next?
We have already gone through a tech revolution If you could have an hour with any thought
and I think we are now going into a phase of leader in the world, who would it be and why?
tech EVOLUTION instead. Our earlier I would love to have that time with Steve Jobs,
amazement with the internet and social media,
smartphones, and computers, are being
14 theSUN ON MONDAY | NOVEMBER 23, 2020
SUNBIZ
Sunak: No return China to consider joining
to austerity in trade pact dumped by Trump
new spending plan
o Eleven countries have agreed to sign summit, Xi said the grouping “must That deal, which comprises 30%
LONDON: British finance minister Rishi trans-pacific partnership deal continue to promote regional of the world’s total economic output
Sunak said there would be no return economic integration and establish and excludes the United States, was
to austerity and instead he will KUALA LUMPUR: China will originally backed by former US an Asia-Pacific free trade zone at an viewed as a major coup for China at
announce “quite a significant” consider joining a free trade pact president Barack Obama as an early date”. a time Washington is retreating.
increase in funding for public services once championed by the US but effort to counter China’s rising
in a one-year spending plan on abandoned by Donald Trump, might in Asia. China “will actively consider Singapore-based international
Wednesday. President Xi Jinping said Friday, as joining” the CPTPP, he said, trade expert Deborah Elms said if
Beijing increasingly seeks to Trump pulled out of it after according to Chinese state media. China did join the CPTPP, it could
“You will not see austerity next influence the global rules of winning the presidency in 2016 as encourage others to follow.
week,“ Sunak told Sky News television commerce. he turned away from what he Trump attended this year’s
yesterday. “What you will see is an viewed as unfavourable multilateral virtual summit, the first time he has “If Xi’s statement of interest is
increase in the government’s The Comprehensive and deals, but 11 countries eventually participated since 2017, as he pushed forward in the coming
spending on day-to-day public Progressive Agreement for Trans- agreed to sign the new version. continues to challenge his election weeks and months, it will, of course,
services, and quite a significant one, Pacific Partnership (CPTPP) is an defeat to Joe Biden. lead to a lot of questions from
coming on the increase that we had updated version of a giant deal Addressing the Asia-Pacific current members, prospective
last year.” Economic Cooperation (Apec) Xi’s comments came just days after members and others that are not
Beijing and 14 other countries signed thinking of CPTPP membership at
Sunak will announce the heaviest what will be the world’s biggest trade all,” said Elms, executive director of
public borrowing since World War deal, the Regional Comprehensive the Asian Trade Centre. – AFP
Two after Britain suffered the biggest Economic Partnership.
economic crash in over 300 years.
US real estate market boom highlights rich-poor divide
Economists think Britain is on
course to borrow about £400 billion WASHINGTON: The US real estate have nots,” said Dana Scanlon, a where they can work from home”. considering buying a second home.
(RM2.17 trillion) this year, approaching market is booming even as the property agent in the Washington For some, it has, perhaps With many white-collar
20% of its gross domestic product, or coronavirus crisis intensifies, and area.
nearly double its borrowing after the the seemingly insatiable appetite for counterintuitively, even meant a employees contemplating a long-
global financial crisis. new and older homes has sent In a bid to mitigate the economic “little uptick in savings” as term shift to telework, and children
prices soaring – meaning more and crisis provoked by the pandemic, commuting and other costs have still going to school over Zoom, the
Sunak told Sky that the forecasts more families with modest incomes the US Federal Reserve slashed been cut due to restrictions on travel pandemic is still fuelling demand.
to be published alongside his are seeing their dreams of owning interest rates in March to near-zero. and dining out, she says.
spending blueprint would show the property shattered. That soaring increase in home
“enormous strain” that coronavirus As Scanlon explains, “that gives a That means some families have purchases has surprised industry
has put on the economy and the “It very much is a tale of haves and very big boost to buying power for more money to spend on upgrading experts, who still remember how
priority for his plan would be to fight those people who still have jobs... to a bigger home – or even the market bottomed out during the
the pandemic. financial crisis of 2008-2009.
A sign is seen in front of a home in Arlington, Virginia. The US real estate market is booming even as the coronavirus
Britain’s finance ministry said on crisis intensifies. – AFPPIX But all is not rosy for all
Saturday that Sunak was expected to Americans seeking to buy.
announce one-year package worth
more than £3 billion to support the In October, sales of existing
state-run National Health Service as it homes hit their highest level since
struggles with coronavirus. early 2006, according to the National
Association of Realtors (NAR).
Asked about reports that he
would freeze public sector pay as But a dip in the number of
part of an attempt to slow the surge available homes for sale has sent
in borrowing caused by the prices skyrocketing.
pandemic, Sunak said it was
reasonable to look at state salaries in According to NAR data, the
the context of the broader economy. median price for individual houses
rose to US$313,500 (M1.28 million) in
Sunak declined to answer the third quarter, up 12% year on year.
questions on possible tax increases
saying he would not be talking now The country’s four main regions
about future budget decisions. saw double-digit increases – 13.7% in
the West, 13% in the Northeast, 11.4%
Separately, Sunak said there is in the South and 11.1% in the central
genuine progress in Brexit talks with US. At this rate, the NAR said, house
the European Union (EU), but that it prices are rising four times faster
would be better to walk away from a than median household income.
bad trade deal than tie Britain’s hands
in the future. As a result, more and more
potential first-time home buyers are
Sunak was thought to be one of finding themselves unable to enter
the leading voices in the cabinet who the market.
wanted a free trade deal with the EU.
Indeed, the percentage of first-
He told the Sunday Times that he time buyers has dropped to 31% of
hoped Britain and the EU would the total in 2020, from 33% a year
secure an agreement. ago, according to the NAR’s chief
economist Lawrence Yun. – AFP
“Every day I am reviewing bits of
text, so there is genuine progress,“ he G20 should boost trade financing for
said. “Certainly, it would be preferable developing countries, back reforms: WTO official
to have a deal.”
WASHINGTON: Group of 20 (G20) recovery will be delayed for all,” Wolff said close cooperation engage seriously in a “major
But he added: “The major impact major economies should work to Wolff, a US citizen, told the leaders. among international financial institutional reform effort” and
on our economy is the coronavirus. provide trillions of dollars in trade “A trade finance initiative should be institutions, the WTO and the large restore the WTO’s deliberative and
It’s absolutely not (a question of financing for developing countries seen as an essential part of commercial banks would be negotiating functions.
doing) a deal at any price. to ensure the recovery of the global improving the outlook for economic needed to free up trillions of dollars
economy from the Covid-19 recovery.” in required financing. Wolff also called for new
“If we don’t get a deal, why is that? pandemic, a top official with the measures to speed the supply of
It is because they are refusing to World Trade Organization (WTO) The World Economic Forum this G20 leaders will underscore their essential medical products to where
compromise on what are some said on Saturday. year said the Covid-19 pandemic commitment to multilateral trading they are needed, including updates
completely reasonable and very was exacerbating a gap in global system in a joint statement to be to existing agreements to ensure
transparent principles that we’ve laid WTO deputy director general trade finance that was already at released on Sunday, a draft of the duty-free global trade in
out from the beginning. We are not Alan Wolff told G20 leaders it was US$1.5 trillion (RM6.13 trillion) communique showed. pharmaceuticals and medical
asking for ... super-special treatment.” critical to utilise trade to help before the crisis began, with over equipment.
– Reuters underwrite the economy, facilitate 50% of requests for financial The Geneva-based world trade
trade in essential medical supplies, support of trade being rejected. body is in turmoil as the He said barriers at borders and
Saudis to launch special and reform the institutional administration of outgoing U.S. the use of export restrictions should
economic zones in 2021 framework for world trade. The lack of access to trade President Donald Trump has be reduced, providing for much
financing hits least developed blocked both selection of a new greater transparency and
DUBAI: Saudi Arabia’s Minister of “When crops do not move and countries hardest that already suffer director general and the functioning accelerating improvements in trade
Investment Khalid al-Falih said on factories are idled throughout the from the high cost of financial of a dispute settlement body. facilitation efforts, particularly for
Saturday the Gulf state plans to launch developing world, the global transactions. the poorest countries. – Reuters
special economic zones in 2021. Wolff urged G20 leaders to
Speaking to a G20 panel, Falih also
said the kingdom’s Vision 2030 plan
to diversify the economy away from
oil was more popular today than ever
and that the country was emerging
from the coronavirus pandemic with
a resilient economy and private
sector. – Reuters
15theSUN ON MONDAY | NOVEMBER 23, 2020
ENTERTAINMENT
CELEB SPEAK
Staying hungry
o Ariff AB speaks about the challenges he faces
as a musician pursuing his passion
█ BY AZIZUL RAHMAN ISMAIL He gave Henry Golding as an ‘reset.’ They are not worried about
example. “He started as a TV show their next few shows because they are
HE had big dreams when he host, and when he got his big break, getting dividends from their past
took his first steps into the he knew how to compose himself. He decade of hard work. They get good
music scene over a decade has the chops and was prepared to support from their fans and
ago. He went straight for fulfil the opportunity he was given management or others,” said Ariff.
the international market and signed while still staying true to himself,”
up with a UK-based record label. said Ariff. Knowing both the local and
international scene, Ariff noted that
Now, London-based Malaysian When he released his first album the issue with the local music scene is
musician and songwriter Ariff AB is while he was in England, Ariff got internal politics and cliques. In a lot
back in Malaysia and is working on himself banned from the Malaysia of cases, it is no longer about the
his third album, We Are Wolves. Hall in London because he was music, but about who you know and
selling his CDs. who likes you.
“This year was supposed to be a
year of tours for me. It began with “Making it in England is difficult. I “What I mean is, if you like one
shows in England earlier this year was thinking that since I was in band, and there is another equally
and was to go on until 2021. We had England and I had been doing shows good band, the former would not
performed all over England, and we every day and I had surplus CDs, even speak about the latter. They act
were going to go to Norway. what could I do? So I tried to sell my as though a fan of one band cannot
albums to Malaysians or anyone who be a fan of another at the same time.
“So I was looking forward to the visited. But [the authorities] put a There is a clique mentality. It’s no
Norway show. But then the stop to that,” said Ariff. longer about the music.”
pandemic hit during the fourth
show,” said Ariff. Going international may not be for He added that for up-and-coming
everyone, however. What made Ariff music artistes, one of the best advice
At the time, the UK was not in a realise that he was making the right is to not listen to what other people
lockdown, and Ariff decided to come decision was the pandemic. say and to not let anyone else tell you
back to Malaysia when the numbers what your music is.
here were dropping. “Most musicians surround
themselves with fans, and they know “But, more importantly, you need
Facing challenges is nothing new what they want to do. If you meet an to have a goal, where you want to be
for him. Ariff’s first steps into music in five years. Stay in your lane. Let’s
were difficult. The self-taught act from the US or the UK, say you want to be like Yuna and go to
musician faced many rejections after those who reach for the United States, focus on that. Don’t
he won a singer-songwriter the top, right hold yourself back. If you don’t have
competition held in Kuala now, they sponsors, save up some money, and
Lumpur in 2009, which led are in a get yourself there. You will never
him to be featured at the know your full potential until you get
World Expo 2010 in there,” said Ariff.
Shanghai.
Based on his experience and
His passion for observations, Ariff said that there are
music took him to two ways that an artiste could reach
Singapore, Indonesia, their full potential, either through
and Thailand. their hard work and talent, or by
being sponsored. And it is always
However, in 2013, better to be at the top because you got
Ariff took his yourself there, instead of having
biggest step and someone else put you there.
went to the UK.
YOU HAVETO
“You have to be BE MENTALLY
mentally prepared
for what’s to come,” PREPARED
said Ariff. FOR WHAT’S
TO COME.
“I always tell myself to
be prepared for the future. – Ariff AB
You may start small, and one
day your lucky break will
come, but you must be
prepared for that.
“Don’t let the
opportunity sweep
you away.”
Ariff doesn’t believe in letting opportunities slip away. – ADIB RAWI
YAHYA/THESUN
Swift reveals that rights to her music have
been sold without her knowledge
TAYLOR SWIFT (right) has Swift said she had been trying to Braun is yet to respond to Swift’s
confirmed that the rights to her first actively regain control of her master incendiary tweet.
six albums have been sold to a private recordings for the last year in a recent
equity firm without her knowledge, in post on Twitter, following a report by Swift had vowed last year to regain
the latest dispute over the pop entertainment magazine Variety that command of her first six albums by
megastar’s lucrative back catalog. Braun had sold the assets for US$300 making her own new masters.
million (RM1.23 billion).
The 30-year-old singer has She said at the time that she was
become one of the most bankable But despite attempting to contractually allowed to do so from
musicians in the world after more negotiate with Braun, she said her this month.
than a decade of chartbusting hits team had “received a letter from a
including Shake It Off and I Knew You private equity company called The dispute between Swift and
Were Trouble. Shamrock Holdings” announcing Braun simmered for months last year
they had purchased her music, after the industry mogul purchased
But last year she began sparring videos and album art. Big Machine, the singer’s label of
publicly with music mogul Scooter more than a decade.
Braun, who manages rival popstars “This was the second time my
Justin Bieber and Ariana Grande, music has been sold without my At one point, the singer said Big
after his company’s decision to knowledge,” she wrote, adding that Machine had barred her from
purchase a majority stake in the bulk she had begun re-recording her performing her songs on television or
of her recordings. earlier songs. releasing a Netflix documentary –
claims the company denied. – AFP-
Relaxnews
16 theSUN ON MONDAY | NOVEMBER 23, 2020
ENTERTAINMENT
Dance of strength
oMeet Spain’s new flamenco
prodigy ‘El Yiyo’
EL YIYO, a flamenco dancer wanted to give me free lessons, Room for improvement performance dance training by
whose real name is Miguel because I was a diamond he wanted El Yiyo, who has modelled clothes for that displayed his ability to watching YouTube
Fernandez, honed his skills to polish,” he told AFP at Madrid’s Armani and IKKS and was even improvise. performances of
by watching YouTube videos. Teatro Real before his debut featured in Vogue, used the lockdown legendary flamenco stars
Now, aged just 24, he made his performance there on Friday night. to choreograph the show which he While he was performing a who have passed away, such as
debut at Spain’s main opera house performed at the Teatro Real. “zapateado”, which is marked by a Antonio Gades who he admires for
with a show he developed during the “In our family, we celebrated good rapid rhythmic stomping of the floor, his “elegance” and Carmen Amaya
country’s virus lockdown. news by singing. Children sang and He appeared on the stage one of his heels broke. who performed in several Hollywood
danced, it was very normal for them, alongside his brother Ricardo in a films at the peak of her career in the
Spain’s new flamenco prodigy was a reflex that I absorbed at a very El Yiyo swiftly took off his shoes 1940s and who he called a “genius”.
born into a Roma family in Badalona, young age without being aware of it.” and continued the performance in The contemporaries he admires
near Barcelona, who are from the his socks to the applause of the are Antonio Canales and Joaquin
southwestern region of Andalusia, He was just seven when he first audience. Cortes, who fuses various styles with
the birthplace of the art form which began performing for the public at a flamenco, and “Farruquito”, hailed by
incorporates poetry, singing, guitar hall in Barcelona. “My dance is a state of mind,” he critics for his entrancing, rapid foot-
playing, dance and rhythmic hand- said, before adding it is “a dance of tapping turns who he is proud to
clapping and foot-stomping. At the age of 11 he was already the strength, of intensity”. have danced with.
headline act during a tour of Taiwan. While El Yiyo is more of a
El Yiyo recalls catching the While he was happy to be invited flamenco purist, he said he sees
attention of flamenco dancer Manuel And before Spain went into a to perform at the two-centuries-old nothing wrong with fusing it with
Jimenez, alias “Bartolo”, as a child nationwide lockdown because of the Teatro Real, he said there was still “a other genres like the blues, jazz or
while dancing at a family wedding. pandemic in March, he danced for lot of ground to cover” before rock, a trend that has become more
four months at the legendary Corral flamenco has the “weight” it popular following the success of
“He told my parents that he de la Moreria flamenco venue in deserves in august institutions such Grammy-winning Spanish singer
Madrid. as the Madrid opera house. Rosalia who mixes flamenco with
reggaeton, trap and R&B.
El Yiyo poses Slender and with shoulder-length Rosalia, who is not Roma, has
during an AFP hair, El Yiyo – a diminutive form of been accused by some of
interview at Miguelillo (little Miguel) – said he appropriating an art form with Roma
the Teatro Real gets his inspiration from the great origins.
(Royal Theatre) names of flamenco. “I am in favour of variety, that way
in Madrid. there is a wide range of purists, of
“I try to learn something from all non-purists, and that way flamenco
of them,” he said. is always talked about,” said El Yiyo. –
Eclectic education AFP-Relaxnews
El Yiyo said he bolstered his formal
Malian music’s forgotten great
SORY BAMBA, a Malian music He says he once brought a young through nationwide musical Bamba holds a flute in his courtyard in Mopti, central Mali.
pioneer, spends his days ensconced Ali Farka Toure to play in his home – competitions designed to foster a
in the courtyard of his home in the long before the singer-songwriter sense of national identity in the vast Paris. But this is out of the question for
old quarter of Mopti, a town in the achieved international success – and country. But the ensuing album, Dogon Bamba, who hums tunes with young
centre of the country on the edge of that few recognised his talents. children every time they pass him by
the Sahara. Bamba, as leader of the group, Blues, enjoyed little commercial in his courtyard.
“Many people didn’t like (his) type also sought and received rare success, and Bamba returned home
One of the original modernisers of of rhythms,” Bamba says. permission from ethnic Dogon elders to Mopti. “Without music, it’s all over. And
Malian music, the 82-year-old to play their traditional music – to there are so many things left to do,” he
infused traditional sounds with funk Toure, who died in 2016, went on which he added his own layers of His children now describe him as says, resting his flute on his knees. –
and jazz. He was also known to be a to become a two-time Grammy Latin-jazz, funk and folk. “tired”, and some hope he will stop AFP-Relaxnews
dedicated talent scout. winner and one of the African playing music.
continent’s most important Some dubbed Kanaga de Mopti
But few now remember Sory musicians. “Mali’s Pink Floyd”.
Bamba in Mali, a conflict-ridden state
known to music fans for its strong Bamba, who never achieved the But reggae artist Koko Dembele,
guitar-playing tradition. same level of success, appears to 66, a former member of Kanaga de
harbour no bitterness. Mopti, said: “Anything that doesn’t
Outside of the country, the evolve is bound to disappear.”
musician is almost a complete “He was here, in this very house,”
unknown, although connaisseurs he says of Toure, with a smile, before “Sory Bamba has always evolved
insist he belongs among the ranks of taking out his flute and by trying to make innovative music”.
Mali’s famous musical icons such as spontaneously beginning to play.
Ali Farka Toure or Salif Keita. Mali’s Pink Floyd Bamba recruited Dembele to his
Bamba began his musical career as a band when the latter was 18 years
“He is one of the greatest Malian child in the late 1940s when Mali was old, and was known to scour the
musicians,” says Cheick Tidiane Seck, still a French colony and a friend floodplains of the Niger river and the
a Malian musician himself whose gifted him a flute. rural camps of nomads for
blend of jazz and traditional music undiscovered musical talent.
won him renown in the 1990s. Later, he worked as an assistant to Nothing without music
a trumpet player in a Mopti band – Next, Bamba pursued a solo career in
But Bamba “is not someone who before making off with his boss’s Ivory Coast, and then in France,
puts himself forward,” Seck says, instrument and dedicating himself to completing 33 tours. He also cut a
adding that he always prioritised music full time. record titled Du Mali in 1979.
“real music” over popular
commercial tunes. In 1957 he started his first group, But international recognition
Kanaga de Mopti, which quickly never really came.
Wearing a corduroy flatcap, and became popular with youngsters in
with eyes clouded by cataracts, the town. Bamba’s prospects brightened in
Bamba sits in his courtyard 2010 when Universal Music offered
surrounded by clucking chickens and The band found wider success him a record deal, after the then 72-
children at play. after Mali’s independence in 1960, year-old musician gave a concert in
17theSUN ON MONDAY | NOVEMBER 23, 2020
FASHION
WHILE the Covid-19 Face masks have become the most
pandemic has played popular accessories of 2020. – AFPPIX
havoc with the way we documentaries Normal People,
dress in 2020, it’s far Tiger King and The Last Dance got
from being the only influence on the internet buzzing too,
wardrobes this year. British singer influencing searches for ready-to-
Harry Styles, French fashion wear pieces and accessories seen
designer Marine Serre and the onscreen.
Netflix show Emily in Paris also Upcoming trends for 2021
inspired people’s shopping habits, As for the most popular items of
according to the Year in Fashion 2020, face masks top the bill this
2020 report from the global fashion year. Searches for the category
search platform, Lyst. increased 502% year-on-year, and
searches for the Off-White brand’s
So 2020 is and always will be a logo face mask saw a 496% increase
peculiar kind of year, marked by from January to March. Safe and
the Covid-19 pandemic, mass stylish was the name of the fashion
lockdowns around the world, and game this year. Apart from masks,
profound changes in the way we do casual clothes and accessories
things like shop and work. It’s also feature as the hottest products of
been a year of activism, with the year, including Birkenstock
movements like Black Lives Matter Arizona sandals, the Telfar
that have influenced various shopping bag and Nike joggers.
domains such as culture and
fashion. As the end of the year After a year when comfort, and
approaches, it’s time to take stock, even protection, were fashion’s
and it’s no surprise to see that our watchwords, Lyst foresees the
wardrobes have been inspired by return of more audacious styles in
the major events of the last 12 2021. In particular, 2021 looks set
months. to see a kind of “modern-day
Roaring 20s” style – with short
Ethics, activism and stay-at- hems, bright colours and prints –
home style as well as growth in more
While apparel relating to the Black purposeful shopping as consumers
Lives Matter movement proved look for commitment on activism,
popular worldwide, another event sustainability or gender-neutral
largely contributed to making pieces.
fashion about activism this year:
the US presidential elections. Emily in Paris provided plenty of fashion inspiration in 2020. – COURTESY OF NETFLIX The Lyst Year in Fashion report
Americans and supporters is based on analysis of the
elsewhere didn’t Style influencers behaviour of over 100 million
hesitate to wear consumers who searched for and
their political ideas bought their fashion items online
on their sleeves – in 2020 from 12,000 brands and
literally – in stores. The Year in Fashion report
recent weeks. In
the US, searches takes into account global
for terms such as o How Harry Styles, Marine Serre and Emily in Paris influenced fashion searches on Lyst and Google,
“vote” were up choices in 2020 conversion rates and sales,
29% week-on- social media mentions for
week according to brands and products, as
the Lyst report, with well as engagement stats,
T-shirts becoming political fashion statements. sweatpants shot up 104% month- celebrities who had the biggest since January 2020. –
the most Plus, 2020 saw consumers on-month in April, when many impact on fashion this year. AFP-Relaxnews
popular looking to shop in a more countries were under stay-at-home Styles. – REUTERSPIX
ethical, more conscious orders. As for TV shows,
way. The global Harry Styles at the cutting edge of Emily in Paris
fashion search style leads the way
platform reports an One thing that didn’t change in in the
average of over 35,000 2020 was that celebrities continued fashion
monthly searches for to drive fashion trends, with Harry stakes this
“vintage fashion” in Styles leading the way. The British year. The
September, as well as singer – who recently wore a dress drama,
a 104% rise in online on the cover of Vogue magazine – which
fashion searches for has a vintage style that’s been a hit gained
secondhand-related each time he stepped out. This is much
keywords. reflected in spikes in searches for media
Lockdowns also the clothes he wears in music attention,
have had a major videos or public appearances. went all out in
impact on fashion Beyonce rides high when it comes terms of styling
choices, with many to fashion influence too, notably its characters’
consumers trading when sporting the now famous looks. From the
their stilettos and Marine Serre crescent moon print Kangol bucket
loafers for slippers catsuit in Black Is King (+426% in hat (+342%) to
and sneakers from searches for pieces by the French the beret (+41%) to
the end of Q1 2020. designer in the 48 following the Ganni skirts (+289%),
Searches for film’s debut). Next come Kim the clothes worn in the
Namjoon of BTS, US politician show proved a hit with
Serre. – AFPPIX Alexandria Ocasio-Cortez and its audience, keen to
rapper Travis Scott, among the tap into chic French
style. Note that
the shows and
Designer Isabel Marant apologises for Mexican appropriation
FRENCH fashion designer Isabel motifs with documented origins community, they implore you, IMarant
Marant has apologised after the in Mexico. and the country you represent, to recently
Mexican government criticised accept their most sincere found
her for appropriating and selling One includes a cape that apologies,” said a letter from herself
clothes based on traditional appears to copy a pattern used by Marant, dated Nov 6 but made in the
indigenous patterns. the Purepecha community of public on Frausto’s Twitter feed centre
northwestern Michoacan state, on Nov 9. of a
Marant heads the latest which retails on the fashion dispute.
fashion brand to be condemned house’s website for 490 euros Mexico has sought to publicly
by the Mexican government for (RM2,373). shame multinational brands that
copying indigenous designs, with it has accused of ransacking the
similar complaints levelled Marant acknowledged to cultural heritage of poor
against Spanish retail giants Zara Frausto that Purepecha textiles villagers.
and Mango. had influenced her latest
collection and said future Some Mexican leaders have
Culture minister Alejandra designs would properly “pay also pushed to toughen a
Frausto Guerrero published an tribute to our sources of copyright law that already
open letter earlier this month inspiration”. protects traditional patterns to
demanding an explanation as to punish “plagiarism that
why her Paris-based company “If the Isabel Marant house indigenous peoples have
was selling garments based on and the designer have suffered”. – AFP-Relaxnews
disrespected the Purepecha
18 theSUN ON MONDAY | NOVEMBER 23, 2020
ZEST
DIY answer to anti-virus ventilation
o A German school finds a simple solution
in an easily assembled device
KEEPING the windows open rate and regularly airing out Rising warm breaths that potentially carry virus-laden tiny particles are sucked through tubes and pushed outside.
to combat Covid-19 is easier classrooms is considered key to
said than done as winter keeping schools open – regardless of other alternatives has left many The DIY ventilation system works like a kitchen extractor fan.
approaches. One German the weather outside. educators scratching their heads, said
school believes it has found a cheap Heinz-Peter Meidinger, president of can be useful in schools, but are more even after the pandemic.
and simple solution with a DIY Sophia Wettig, 18, keeps an extra the German Teachers’ Association. expensive, noisier and more energy- Headmaster Wollowski plans to
ventilation system designed by a jumper in her locker. She said she consuming than his prototype.
teacher’s scientist husband. finds it hard to concentrate in the The association has been spend the next few weekends
cold and it was “pretty cool” her “overrun” with offers from firms And unlike his invention, they installing Helleis’ system in all the
“It works like a kitchen extractor school had come up with a warmer trying to sell their air filtration don’t also remove CO2 from the school’s classrooms, helped by
fan,” said inventor Frank Helleis, solution. systems, he said, with prices ranging room, which has been blamed for parents, teachers and pupils.
standing in a classroom at the IGS up to €6,000 (RM29,143) per unit. causing tiredness, giving schools a
Mainz-Bretzenheim secondary “It’s more pleasant being here reason to keep his homemade system “Everyone is very motivated,” he
school. than in other rooms,” she told AFP Politicians have been slow to said. – AFP-Relaxnews
from behind a face mask, which she address schools’ concerns about
Above every desk hangs a clear and her classmates keep on during aerosols, probably because many
plastic funnel attached to a narrow lessons since the outbreak of the options are “too expensive”, he told
pipe, with all the pipes in turn pandemic. AFP.
connected to one wide pipe leading
to a fan that directs the air outside Helleis has already received Under Germany’s federal system,
through a tilted window. almost 3,000 inquiries about the responsibility for schools lies with
ventilation system, and expects it will each of the country’s 16 states.
Warm breath exhaled by the be rolled out in many more schools.
pupils, potentially carrying virus- To date, just six state governments
laden tiny particles known as The inspiration came from have pledged funding to address
aerosols, rises up overhead and is brainstorming with his colleagues these pressing ventilation issues.
sucked through the tubes and about how they could help in the
pushed outside before it can spread pandemic. The regional government in
through the room. wealthy Bavaria has committed 50
“We figured the best thing to do million euros (RM271), although
Another window is kept ajar to was to carry out the trash,” he said, Meidinger expects that will also be
allow in fresh air. referring to being rid of any virus- spent on low-cost tools like CO2
carrying aerosols. readers that alert teachers when it’s
Tests carried out by the prestigious time to air a room.
Max Planck Institute for Chemistry, Because his wife teaches at IGS
where Helleis works, have shown that Mainz-Bretzenheim, he reached out Helleis says portable air purifiers
the system manages to remove over to headmaster Roland Wollowski equipped with high-efficiency filters
90% of aerosols from the room, on who, as a scientist himself, was
par with the most high-tech air immediately on board with the idea.
filtration units on the market.
His school in western Germany
The difference is that Helleis’ happens to be just a five-minute drive
light-weight contraption can be built from another Mainz institution
from materials from the do-it- making headlines, the BioNTech
yourself store for around €200 company leading the race for a
(RM971.50), making it a cheaper and Covid-19 vaccine.
effective alternative. Confusion
The official guidance from Germany’s
A handful of volunteers put it federal environment agency is for
together in half a day, he said, and the schools to open windows for several
Max Planck Institute has shared the minutes every 20 minutes to reduce
assembly instructions online for the risk of infection among teachers
anyone who wants to copy the idea. and students in a closed classroom
Extra sweater environment.
The timing of this invention could
scarcely be better. But not all of Germany’s roughly
40,000 schools have windows that
Germany’s coronavirus numbers fully open, and confusing advice
have been climbing at an alarming about air purifying machines and
Video games may be good for you GOOD VIBES
WHILE video games often get was even more the experiences that positively to people’s mental health More to life than paper
accused of having negative effects the players had while gaming that – and regulating video games could qualifications
on health, a new study by Oxford were associated with a positive withhold those benefits from “People rarely
University researchers reveals that impact on mental health. players.” IT was really disturbing to succeed unless
they may ultimately have a positive read about the student they have fun in
impact on our psychological well- Furthermore, the researchers However, there are significant who chose to take her life what they are
being. found that the social connection that differences among gamers that after she received her Sijil
gaming creates with others is Pelajaran Malaysia ( SPM) doing.” – Dale
The results are timely, as many also associated with a sense should not be glossed over. exam results. Carnegie.
countries around the world have of well-being. Researchers indicate that 50-plus, my life
chosen to implement stay-at-home Academic education is changed and now I
mandates and measures for their “Our findings show those who truly enjoy important but it is not the means am surrounded by books.
populations in an attempt to limit video games aren’t gaming tend to experience to all ends. Each one of us has Every person has dignity and
the spread of Covid-19. necessarily bad for your increased well-being but certain skills, capacities and just to be alive is a wonder. We
health; there are other this is not the case for interests. These constantly change. have many options to select from
This is the first study of its kind psychological factors gamers who turn to video and academic studies are not the
that looks not at the playing time which have a significant games to escape a real I was a music teacher for more only one.
declared by the players themselves, effect on a persons’ well- world that isn’t meeting than three decades and observed Parents have a part to play in
but at the actual playing time being,” explained how mediocre students in the this. They can monitor their
provided by two industry giants, Professor Andrew their psychological earlier stages excelled and became children’s interests, guide and
Electronic Arts and Nintendo. Przybylski, lead needs. – AFP- concert pianists. I know of very encourage them to pursue what
author of the study. Relaxnews successful business people today they are good at and not harp on
Researchers analysed gamer who did not even complete formal academic qualifications alone.
behaviour for two of the world’s “In fact, play studies. Einstein and Thomas Edison
most popular video games, Plants Vs can be an activity were considered poor students in
Zombies: The Battle for that relates I too, was a poor student, their early years but what brilliance
Neighborville and Animal Crossing: having had to skip lessons in class they showed in later life!
New Horizons, and then asked 3,274 because of my involvement in Bridget Menezes is the author of
gamers to complete a survey. music activities. I managed to Second Edition of
scrape through my exams. I was Self-Empowerment and
In results that surprised many, distraught at that time, but my Spiritual Counsellor. Readers
scientists have found that video parents encouraged me to pursue
games are far from being harmful to my music as they were aware of my can email her at
health, quite the contrary. talent in which I excelled and [email protected].
became one of the best music
In fact, they have been shown to teachers in Kuala Lumpur. I had no
have a positive impact on the mental interest in reading but at the age of
health of gamers and to be beneficial
to their well-being.
While the time spent gaming was
associated with positive feelings, it
19theSUN ON MONDAY | NOVEMBER 23, 2020
TECH TODAY
█ BY AZIZUL RAHMAN ISMAIL Finding the perfect match
HER career began in o Anisa Hassan talks about her career as a matchmaker and the app Joompa perhaps say something about why
journalism. When her first they initiated the conversation.
child was born (left) The
prematurely, waking up Joompa “Talking about childhood
before sunrise to read the news was app. – experiences is almost always very
not an option. Anisa Hassan felt that COURTESY interesting. It makes it less daunting
it was time for a career change. OF and intimidating.
JOOMPA
“I decided to pursue a different “It is relatable because everyone
career that would capitalise on my Anisa has a childhood. You don’t start with
strengths as a people person, as Hassan. – your past drama, or something
someone who is always curious, who COURTESY negative.
always loves to interact and loves to OF JOOMPA
understand people’s voices and “People always want to be with
where they are coming from,” said part of the progression of her career chat, and with the agreement on both someone positive, optimistic, and
Anisa. as a matchmaker. sides, both parties can take it a step fun. What needs to happen is
further and do a video chat. Malaysians need to learn how to have
To be a matchmaker, she said that “I know from doing matchmaking more fun and lighthearted
one needs to be willing to delve into for the past 16 years that there are “I think what Malaysian men need conversations. To not overthink what
the lives of the people whom they are certain variables and certain aspects to do is to think of good conversation needs to happen when in a chat.”
matchmaking. that, once we get nailed down, we topics to approach a lady. They do a
know we can get to a higher level of lot of browsing for possible matches; I For the socially awkward nerds
“It is not much different from compatibility,” said Anisa. can tell that they are looking at all the and geeks, she advised that if the
being a journalist. But, now you are profiles,” said Anisa. person with whom you are
delving more into their personal lives, In addition to its compatibility conversing has listed the same
and people always like to talk about algorithms, Joompa focuses on “But, their conversation is always interests in their profile as you, to go
themselves. All you need is to arm making a match based on someone’s the same, they start with ahead and talk about your interests.
yourself with the right questions and personality and what they are looking ‘Assalamualaikum’ and they stop
they will lead you to the interesting for besides physical appearances. there.” “Whether or not somebody is
answers,” said Anisa. going to be scared by how nerdy or
During registration, users will She explains that it would be good geeky you are is very much
She noted that meeting someone need to complete a questionnaire. for the person who initiated the chat dependent upon the other
in person to figure out who they are is This includes faith-based questions to think about something to say about person. Some people would
far more helpful when looking at their in addition to personality traits. themselves first. For example, to accept that.
presence on digital platforms. The introduce themselves, they should
fact that her services require payment Once a match is found, a state where they are from, and “Remember, all you need is to
syphons out those who are not conversation can be initiated through find that one person.
serious or who are just casually
looking for a match. “That’s why you need to read
through someone’s profile and
“It is incumbent upon me as a
matchmaker, to not just see what is play with the compatibility meter
on the surface, but to go deeper into in the app, to see how similar
what they have gone through in the or compatible you are.
past,” said Anisa. “This will prevent
people from just looking at
“A large part of my job is to ensure the most good looking or
personal awareness in my clients, to the most successful-
be their motivator, to give them hope, looking person.”
and optimism. But first, they would This, she said, is one of
have to get their lives sorted out to the keys for a long term
ensure that they don’t bring along all relationship. And that is what
their previous hurts and traumas into
the relationship.” Joompa is promoting. As a
Muslim matchmaking platform,
Now, with 16 years of experience Joompa is concerned about
at being a matchmaker, she launched creating committed and serious
a dating app that is dedicated to relationships that lead to
Muslims. To her, embracing new marriage.
technology while catering to an
underserved need is just a natural
Discovering Kuaishou in China
Instead of PARALLEL to the global Kuaishou
sitting idle, phenomenon that is TikTok, a host currently
unused IT of Chinese applications are has over
hardware jumping on the same bandwagon, 400
could be with platforms for creating and million
repurposed sharing short videos with laughs, users.
or, if music and more. With over 400 isn’t stopping there. The platform
necessary, million users and an upcoming has filed for an initial public
recycled. stock market debut, Kuaishou is an offering on the Hong Kong Stock
outsider that’s on the up. Exchange.
The three Rs of digital waste Outside China, the application
After Douyin (of which TikTok is goes by the name of Kwai and is
THE European Week for Waste Reuse the international version) with its gained considerable popularity. still relatively unknown. Note that,
Reduction (EWWR), running from The second golden rule is to reuse 600 million users, Kuaishou is Now, as well as saving and like TikTok, the app has been
Nov 21 to 29, aims to raise public products, either by passing on China’s next most popular short banned in India due to alleged
awareness about sustainable devices to others or by buying video sharing application. sharing videos, Kuaishou offers data and privacy issues. – AFP-
resource and waste management. For second-hand. Many outlets currently online games and has even turned Relaxnews
the occasion, France’s Environment recondition high-tech devices, giving Like Douyin-TikTok, Kuaishou itself into a veritable e-commerce
and Energy Management Agency them a new lease of life. The lets users edit clips easily with platform. The site currently claims
(ADEME) reminds us of the three advantage of a second-hand product features such as animated filters, to receive some 500 million orders
golden rules for dealing with digital is that it can have similar tech specs to stickers and text. per month.
waste: reduce, reuse, recycle. a new device, with some new
Reduce replacement parts where necessary, When it originally launched in And Kuaishou, which is already
Good waste management starts while selling at a lower price. All in all, 2011, Kuaishou was nothing more backed financially by the Chinese
with reducing the amount of raw refurbished products can be than a modest application web giant Tencent (QQ, WeChat),
materials in use, limiting the beneficial to consumers and to the designed for making and sharing
environmental damage that sourcing environment. GIF images. It was only when it
them can cause. Digital devices Recycle turned to video that the app
contain an array of rare earth Finally, try to recycle electronic
minerals, essential to their operation, devices that reach the end of their life, Smarter and safer scooters in future
which are notably found in the recovering usable components to put
batteries of smartphones and back into production lines, rather ELECTRIC scooter-sharing service Voi is is in an area with high pedestrian Installed on its
laptops. By reducing usage, lifespans than leaving them to clog up your tackling the issue of safety hazards density and to help it to react e-scooters, Voi is
can be prolonged. It’s therefore home – or worse, the world’s rubbish experienced by pedestrians by developing accordingly.
preferable to extend the lifespan of dumps. Most major players in the artificial intelligence (AI) motion detectors testing Luna’s
existing products rather than high-tech world now play an active to avoid collisions. In order to achieve technology to
systematically replacing them with role in, or initiate their own mass convincing results, Voi will
new ones. If you do have to buy a recycling schemes. Apple and For this project, Sweden-based Voi has have to execute multiple test help avoid
replacement, think about donating or Orange, for example, have already partnered with startup Luna to become the phases to clock thousands of collisions with
selling old devices to ensure they committed to taking back old devices first e-scooter brand to offer real-time kilometers of automatic learning.
have the longest possible lifespans. for recycling. – AFP-Relaxnews pedestrian recognition, in line with what pedestrians.
certain car manufacturers already do. The first test phase is launching
this week in the UK, in Northampton.
The technology uses high-quality It will focus on data collection.
camera detectors linked to several
algorithms. Other local tests will launch,
notably in France, in 2021. – AFP-
It is designed to determine if the scooter Relaxnews
20 theSUN ON MONDAY | NOVEMBER 23, 2020
FEATURE
█ BY S. TAMARAI CHELVI Art as a form of escapism
THESE days, art is something o Lisa Wong Sook Kuan escapes into her imaginary world
that cannot be excluded from and captures the flow of her creative vision on canvas
our daily life. For an artist like
Lisa Wong Sook Kuan, who Remain district.
graduated with a Bachelor of Fine Arts – COURTESY OF
in Illustration from the California LISA WONG
College of the Arts in San Francisco in
2015, art can be found in everything Wong painting
she sees and does. in her garden.
“I think it’s safe to say that I don’t “Currently, I am doing a slight world cemented in reality, but at the vigour. Comfort in the chaos.
think art can be avoided. If you live in offshoot of that series, focused more same time is disconnected from it. Art “At that point, I found that birds Bathers.
a house, someone designed it. The on the interior of the home versus the is a means to play with our definition
books you read, the clothes you wear, exterior. The idea behind the sub- of reality.” were a means to convey certain
and the places you visit, requires some series is focused on the mind’s How would you describe your art? qualities or symbols we are drawn to;
sort of designer or creator,” said the internal boudoir – a room that doesn’t “If we’re talking about genre, I would such as fidelity, luck, or fortune (in
former graphic artist, who quit her job exist in reality but consists of several say magic-realist contemporary Chinese culture) without being too
to pursue art. different objects and elements that painting; otherwise, I would describe intimate or personal.”
define the character of the space. As it as an alternate universe of sorts. Tell us about an artwork that had a
“Even the cartoons I watched as a these rooms don’t actually exist, they Maybe it could even be a peek into the huge impact on you.
child were, in a sense, a form of art, still follow the theme of magic realism 4th dimension.” “Pablo Picasso’s painting First
relying heavily upon the skill of the in line with the rest of the series.” How has your childhood or Communion (1896) was created when
animator,” said the 28-year-old visual What do you want to convey through environment influenced your art? he was only 14 years old. He had the
artist, who uses acrylic paint on your art? “The art stems directly from my skill of an academic master at that age,
canvas. “I want to provide a form of escapism. garden and home. The plainest and it is precisely because he had the
I have the power as an artist to create a comparison to the imaginative skill and knowledge that he could
“What I love about art is that you aspects of my work (the garden produce pieces like Guernica or Les
can tell so much about a person from coming alive at night), share parallels Demoiselles D’avignon, pieces many
the drawings and paintings they with Toy Story or Enid Blyton’s deem to be unskilled or naive.
produce,” said Wong, adding that an Toyland characters coming alive,
artist’s personality shows through the away from the eyes of their owners. “This may be an unpopular
artwork. opinion, but I think that some form of
“As a kid, one of the games I played art education or learned skill is
Wong’s fine art depicts her vision the most relied heavily on using my needed to pursue art. Otherwise, I
(borne out of escapism), inspired by imagination and storytelling. Many of would still be painting in
nature. Her contemporary art has the elements in the work itself are monochrome to this day.”
been exhibited in the Louvre Museum objects I own or have a personal What is your future project?
Carrousel Galleries, Paris, France in connection to.” “I am in the midst of planning an
2019, and many other locations such Why did you choose to paint birds? online exhibition with two of my artist
as Spain, Hong Kong, China, U.S.A, “The birds are part of an older series friends from college, one who
and Singapore. titled Wild or Warrior, which were currently lives in Sweden and the
What is the main subject of your paintings inspired by my trips to other who lives in Seattle. The
artworks? China and its natural landscape. I planning of this show would not have
“The title of the series of my current chose to paint mainly birds as I find become a reality if the Covid-19
work is Night Magic. The series that they have a phoenix-like quality. pandemic had not shifted many of the
explores the possibilities of the Their beauty is so vibrant and full of exhibitions to the online space. I also
supernatural and mystical in the plan to paint, paint, and paint some
midst of the mundane. more.”
“Much of the inspiration came
from my own home, primarily during
my walks with my dog in my garden in
the nighttime. In my work, the veneer
between the physical and magic is
thin, and the garden and house come
alive at night.
“Goldfish leave the pond and take
flight, woodland nymphs cavort
around the patio, and the magic
begins.
Sanctuary.
Could solar panels become artists’ canvases?
Solstice Series #01 (2020) by Alexandre COULD photovoltaic panels become ±MaisMenos± took part in this questions and changes ways of tonnes of solar panels will have
Farto, aka Vhils, part of the Solar Art a new medium for visual artists? An initiative. thinking and living,” said artist Olafur reached the end of their useful life by
Panel programme. – COURTESY OF initiative called Solar Art Panel Eliasson in a press release. 2050. This phenomenon will result in
UNDERDOGS GALLERY invited international artists to paint Each of the artists took up the the production of roughly six million
works on solar panels to raise funds challenge in their own way, with The Solar Panel Art Series does tonnes of new solar e-waste per year.
for the Little Sun Foundation. street artist Bordalo II using plastic exactly that, and it is a great example
waste, LED bulbs and wood panels to of how to open up the discussion While these figures seem
Since its creation back in 2016 by create a multicoloured Lighted about renewable energy and the worrying, photovoltaic sector
renowned Danish-Icelandic artist Plastic Giraffe, while ±MaisMenos± unequal distribution of energy today. producers throughout Europe are
Olafur Eliasson, this charity provides used spray paint and stained glass getting organised to limit the
solar energy lamps to thousands of paint and varnish to create Dualities. While raising funds for the Little environmental impact of this
pupils and teachers living in Sun Foundation’s Solar Kids School industry all along the production
Rwanda. These works were presented until programme, Solar Panel Art raises line, and especially in recycling.
Nov 13 on the Underdogs gallery questions about the thorny issue of
To support Little Sun Foundation, website, where the unique pieces recycling PV panels. For instance, PV Cycle France
a Lisbon gallery called Underdogs went on sale for between €2,500 and collects and recycles old solar panels
asked several artists to create works €20,000 (RM12,143 and RM97,146). While the environmental impacts throughout France for free.
on photovoltaic panels to create the of solar energy are widely known, the
Solar Art Panel series. “An artwork is never just the impact from the photovoltaic sector Last year, this non-profit
object; it is also the experience and are far lesser known. The organisation collected 280,000
Acclaimed artists such as Bordalo its contextual impact, how it is used International Energy Agency panels that were no longer in use. –
II, Tamara Alves, Wasted Rita and and enjoyed, and how it raises predicts that close to 78 million AFP-Relaxnews
322 Notices 21theSUN ON MONDAY | NOVEMBER 23, 2020
* SPORTS
IN THE HIGH COURT OF
322 Notices MALAYA AT KUALA LUMPUR Top dogs ousted Daniil Medvedev
returns to Rafael
BOON BROTHERS (SENDIRIAN) (COMMERCIAL DIVISION) Young guns Thiem, Medvedev dump
BERHAD (13481-X) COMPANIES (WINDING-UP) Djokovic and Nadal out of ATP Finals Nadal during
NO. WA-28NCC-395-06/2020 RAFA NADAL’S dream of a first ATP yesterday’s ATP
(Incorporated in Malaysia) In the matter of Mysmartgold Bullion Finals title and Novak Djokovic’s To put world No. 4 Medvedev’s World Tour men’s
(In Members’ Voluntary Winding-Up) Sdn. Bhd quest for a record-equalling sixth win into perspective, Nadal had singles semifinal
NOTICE OF FINAL MEETING (Co. No. 970777-U) vanished in defeats by Daniil triumphed in the last 71 matches in match at the O2
NOTICE IS HEREBY GIVEN that Medvedev and Dominic Thiem in two seismic which he had taken the first set. Arena in London.
pursuant to Section 459 (1)(b) of And “I played a bad game at 5-4, I had
the Companies Act 2016 a final In the matter of Section 465 (1)(e) semifinals yesterday. a big opportunity, but well played to – AFPPIX
meeting of the members of the read with Section 466 (1)(a) of the As the curtain comes down on London’s 12 him,” Nadal said. crashed the ball and everything went in. What
abovenamed Company will be Companies Act, 2016 years as host of the ATP Tour’s prestigious Earlier in the empty arena, the 27- can you do?”
held at Suite 12-A Gurney Tower season-ender, it would have been fitting for year-old Thiem saw four match
Office, 18 Persiaran Gurney, 10250 And Nadal and Djokovic to face off for the 57th time points vanish in the second set Thiem is now established as a major force
Penang on Tuesday, 22nndd December In the matter of Companies in their glittering careers. tiebreak against Djokovic and it and will attempt to go one better than last year
2020 at 11.00 a.m. (Winding-Up) Rules, 1972 But times are a changing, or so it seems, seemed he would pay a heavy price. when he lost to Stefanos Tsitsipas in the final.
and Medvedev and Thiem had not read the Djokovic led 4-0 in the
AGENDA Between: - script. deciding “From 0-4 in the third-set tiebreak I went for
1. To receive accounts from the PX Swissmet Sdn. Bhd. Nadal, seeking the one major pot missing every single shot and every single shot went in.
(Co. No. 1132215-A) from his vast collection of silverware, must It was amazing,“ he said. – AFP
Liquidator showing the manner have seen the door creaking open when Thiem
in which the winding-up has … Petitioner produced a staggering fightback to beat
been conducted and the assets And Djokovic 7-5, 6-7(10), 7-6(5) in a classic contest
of the Company dispose of and Mysmartgold Bullion Sdn. Bhd lasting almost three hours.
to hear any explanations that (Co. No. 970777-U) It seemed like Nadal had exhausted the wily
may be given by the Liquidator. Russian’s box of tricks when he served for the
2. To consider and, if thought fit, … Respondent match at 5-4 in the second set but Medvedev,
pass the following resolution as ADVERTISEMENT OF PETITION 10 years his junior at 24, stormed back to win 3-
an Ordinary Resolution: NOTICE IS HEREBY given that a Petition 6, 7-6(4), 6-3.
“That the books, accounts and for the Winding-Up of the abovenamed “At 5-4 in the second set I decided to change
documents of the Company Company by the High Court at Kuala some small things and start going for things a set tiebreak. But US Open champion Thiem
and of the Liquidator, shall be Lumpur was, on the 01st June, 2020 little more. I had to change and it worked really unleashed a stunning counter-attack to reel off
kept by the Liquidator for a presented by PX Swissmet Sdn Bhd well,” said Medvedev, who was 100% in group six points, reaching match point with a ripping
period of three months after the ( Co. No. 1132215-A ) a company play, including a win over Djokovic. crosscourt backhand.
Company has been dissolved, incorporated in Malaysia having its “To beat Rafa, you need everything – good Djokovic saved a fifth match point but then
and that thereafter such books, registered office at 51-21-A Menara backhand, good forehand,” Medvedev said. floated a defensive forehand long.
accounts and documents may BHL Bank, Jalan Sultan Ahmad Shah, “Mentally you need to be super strong, “What he did from 0-4 in the tiebreak was
be destroyed by the Liquidator.” 10050 Georgetown, Pulau Pinang. And because he’s there (for) all the points.” unreal,” Djokovic told reporters. “He just
that the said Petition is directed to be
LAU KIM SEONG heard before the Court sitting at Kuala 322 Notices I’m not part of a ‘Fab Four’, says Dominic
Liquidator Lumpur at 9.00 o’clock in the forenoon
Penang on the 02nd day of February, 2021; NNOO.D.DMMAAPPAALALALALA--AA2M2SMSYY44AAAANMNMMMCDCDAAAAVVIIHHNNCPCPKK--UUPPAA6L6LEEMMA2A2MM4UA4UAUUHH-P-PLLIA0ITA0TNN9I9INANA//GNGN2G2GGG00II 2200 DOMINIC THIEM says he is not yet bracketed with Nadal and Federer, “To beat them all five times is
Dated: 23rrdd November 2020 and any creditor or contributory of the D01D019898aa//l//la01a01m81m81////121290P90P7171ee85r85rkk,,aa((PPrraalloo22tt9P9P11/e/e7171rr)1)j1j;a;a//n1n1j9j9iiaa77nn88,, JJuuaa00ll77/B/B00ee22lli/i/119b9b9e9e6r6rttaarriikk&&hh part of a “Fab Four” at the top of who have won 20 Grand Slam titles, something great for me. Every
said Company desirous to support or DDaann;; men’s tennis despite becoming only and Djokovic who has 17 majors to match against them is a privilege
DDMMAAAALLLALAAAMMYYAAMMDDAAIIHHPPKKUUAALLMMAAUAUAHHPPIITTNNIINANAGNGNGGGGII oppose the making of an Order on the D0D099aa/l/la0a0m8m8//119P9P77ee8r8rkk,,aarraa330P0P/e/e11rr1j1jaa//n1n1j9j9iiaa77nn88,, JJuuaa00ll77/B/B11ee22lli/i/119b9b9e9e3r3rttaarriikk&&hh the second player to record five his name. and a huge chance to learn, but to
NNOO.. PPAA--22SS44AANNMMCCAAVVNNCC--PP66EE22MM55UU--LL00AA99 // 22002200 said Petition may appear at the time 1188//1111//22001155 ((PPlloott 1188));; career wins against Roger Federer, beat them is huge confidence
DDaallaamm PPeerrkkaarraa PPeerrjjaannjjiiaann JJuuaall BBeellii bbeerrttaarriikkhh of hearing by himself or his counsel DDaann;; Rafa Nadal and Novak Djokovic “Of course not, I’m so far away. I boost.”
0099//0088//11997788,, 2277//1122//11997788 && 1155//0088//11999900 ((PPlloott 1144));; for that purpose; and a copy of the DDaallaamm PPeerrkkaarraa mmeennggeennaaii 1111,,889922//229911,,663300 yesterday. have one Slam and one Masters
DDaann;; Petition will be furnished to any Creditor bbaahhaaggiiaann bbeelluumm ddiippeeccaahhkkaann ddaann hheerreeddiittaammeenn 1000 title, that’s it,” said the modest Andy Murray is the only other
DDaallaamm PPeerrkkaarraa mmeennggeennaaii 77,,443322//229911,,663300 or contributory of the said Company P16yP16ya19ai19innn,n4,4aagD,gD,nnaTaTgdgdeeeeiim(krm(krPPaaeeplplhhnonoaatataSSttl1l1eieiBB77bbssuueee&e&kkrbrbaiai11taatnn8g8gTTgg)a)aee;;iPinPngGegGerareaeaahrhriiaa,,TTnnPePe..nMWnMWgg.u.uaakkChChiie,me,mnNnNttee8r8ragag99lele,,,,rrNNiMiMoPoPuu..uukkLlLliaiamomouutt After several years spent Thiem. player to have beaten Federer, Nadal
bbaahhaaggiiaann bbeelluumm ddiippeeccaahhkkaann ddaann hheerreeddiittaammeenn requiring the same by the undersigned DDaann;; knocking on the door, the 27-year- and Djokovic at least five times each
yyaanngg ddiikkeennaallii sseebbaaggaaii GGeerraann MMuukkiimm 8899,, NNoo.. LLoott on payment of the regulated charge for DDaallaamm PPeerrkkaarraa SSeekkssyyeenn 3388 AAkkttaa KKoonnttrraakk 11995500;; old Austrian joined the Grand Slam “But I love to play against them, and he also topped the world
669944,, TTeemmppaatt BBuukkiitt TTeennggaahh,, PP..WW.. CCeennttrraall,, MMuukkiimm the same. DDaann;; winners’ club this year when he won these living legends. rankings.
1111,,DDaaeerraahh SSeebbeerraanngg PPeerraaiiTTeennggaahh,,NNeeggeerrii PPuullaauu The Petitioner’s address is at 51-21-A DSDSpapaelelaassmmiiffiikkPPRReeeerrllkkiiffaa1r1raa99550S0S;;eekkssyyeenn 1111((11))((cc)),, 1111((22)) AAkkttaa the US Open.
PPiinnaanngg ((PPlloott 1144));; Menara BHL Bank, Jalan Sultan Ahmad DDaann;; “It’s super special (to have five Thiem’s record against Djokovic
DDaann;; Shah, 10050 Georgetown, Pulau Pinang. DTTDaaaannllaaaammhh NNPPeeeeggrraakkrraaaarraa1199mm6655ee;;nnggeennaaii SSeekkssyyeenn 441177,, KKaannuunn But the world No. 3 says he has a wins each against the big three), and now stands at 5-7, against Nadal it is
DDaallaamm PPeerrkkaarraa SSeekkssyyeenn 3388 AAkkttaa KKoonnttrraakk 11995500;; The Petitioner’s solicitors are Messrs DDaann;; long way to go to start being it’s special to have my 300th Tour 6-9, while he leads Federer 5-2.
DDaann;; Sothi & Ang, Advocates & Solicitors kDDkaaaaeellaaddmmaahh MPMPeeaarrhhkkkkaaaarramamaammhhee22nn00gg11ee22nn;;aaii AAttuurraann 77 KKaaeeddaahh-- win today,“ Thiem told reporters.
DDaallaamm PPeerrkkaarraa SSeekkssyyeenn 1111((11))((cc)),, 1111((22)) AAkkttaa whose address for service is at Suite
SSppeessiiffiikk RReelliiff 11995500;; 3-2, 3rd Floor, Wisma Bandar, No. 18 AAnnttaarraa Birdie blitz puts Kim BRIEFS
DDaann;; Jalan Tuanku Abdul Rahman, 50100 M(M(NNAAoo..YYKKEE//OOPPNN:: 55MM330O0O22OO00YY44--0022--55334488//44339999447788)) five ahead in Florida Hamilton wants more time
DDaallaamm PPeerrkkaarraa mmeennggeennaaii SSeekkssyyeenn 441177,, KKaannuunn Kuala Lumpur.
TTaannaahh NNeeggaarraa 11996655;; NOTE: ------ PPllaaiinnttiiff KIM SEI-YOUNG used a late birdie run to LEWIS HAMILTON has dropped a hint on what he wants
DDaann;; Any person who intends to appear DDaann shoot a sizzling 64 and open up a five-stroke included in his new contract at Mercedes. The 35-year-old
DDaallaamm PPeerrkkaarraa mmeennggeennaaii AAttuurraann 77 KKaaeeddaahh-- on the hearing of the said Petition 11.. TTAANN SSAAYY LLAAEEKK lead over Ally McDonald at the LPGA Tour’s is currently the best paid driver in Formula One, earning a
kkaaeeddaahh MMaahhkkaammaahh 22001122;; must serve on or send by post to the ((NNoo.. KK//PP:: 335500442222--0077--55008899// 11223366001155)) Pelican Women’s Championship yesterday. reported £40 million (RM212m) a year. However, it’s not
abovenamed Messrs Sothi & Ang, 2k2ke.e. ppAAaaMMddaaAANNeesAsAttHHeettRTRTAAAANYNYAAHHOOBBCCEEKKRRHHLLAIAIMMDD,, ss((isisemembbaaaattggii))aaii PPeennttaaddbbiirr money that Hamilton sees as a key factor in his
AAnnttaarraa Notice in writing of his intention so to South Korea’s Kim caught fire on the back negotiations with Mercedes. When asked on BBC whether
TTAANN SSAAWW TTIIEENNGG do. The Notice must state the name ------ DDeeffeennddaann--ddeeffeennddaann nine, making birdie on four straight holes working in more time for himself in the contract will be an
((NNoo.. KK//PP:: 666611112222--0077--55552288//AA00556622889977)) and address of the person, or, if a firm, NNOOTTIISS ((PPeennyyaammppaaiiaann GGaannttii)) from the 14th through the 17th to reach 14- important part of the talks, Hamilton said with a smile:
the name and address of the firm, and KKeeppaaddaa:: under 196 at the Pelican Golf Club in Florida. “Potentially. That’s always going to be a part of the
-- PPllaaiinnttiiff must be signed by the person or firm, or T2T112TTaAa40A40mm,0N,0NL0L0aaoSo0S0nnrrAAoBoBSSYYnnuurrgigkLikLRiARiABtBtaaEEiMiMnmnmKKjejeaabbrriiatatTaTaii,,ijijgagaamam,,,, conversation. I need more time. And I think this year has
DDaann;; his or their solicitors (if any) and must PPuullaauu PPiinnaanngg.. American McDonald had a roller-coaster shown that for example you can work from home. So I’m
11.. TTAANN SSAAYY LLAAEEKK be served, or, if posted, must be sent APSPASeoeMoMmkmkBBoouunInIlLlLgagaaannPPbbEEeebbRrRretetHaHarrrtArtAaiaikTkTrrhIihIikAkAhhNN114141/b4/b499a/a//9/9hh22//aa0202ww202002a02a00 sdsd((aaaasstntneeuulleeppAASaSaffsasaiiddmmaaaivaivnninintiti round of 68 that included a hole-in-one on sure there will be a lot of Zoom days in the contract other
((NNoo.. KK//PP:: 335500442222--0077--55008899// 11223366001155)) by post in sufficient time to reach the dYStdtYSeeiEoiEokrkrOkOhkheeooNaNannnnddaaggaMalMliiapapOOnnssOOkekeYaYbabmmaayygtgtuaueaeaanrnriisdsgdgeea“a“bbSlbSlbaauueaeammttrmrm””aa))alalMaMannmmaahhaPaPttktkeeteeaalmlmdadammihihuuaalNlNaahhoo..ddiidndna1a1iiiink2nk2eoAeoAlAllAl,,ueueffDhaDhaiiddrreekakaMMnnavavaaAinAintiti the par three 12th and a double bogey on than actual present days which means I have to fly less,
22.. AAMMAANNAAHH RRAAYYAA BBEERRHHAADD ((sseebbaaggaaii PPeennttaaddbbiirr abovenamed not later than 12.00 noon BBaayyuu 1122,, SSeerrii TTaannjjuunngg PPiinnaanngg,, TTaannjjuunngg TTookkoonngg,, No. 8 to get to nine-under for the which is good.” When pressed whether that was a “scoop”
kkeeppaaddaa eesstteett TTAANN HHOOCCKK LLIIMM,, ssii mmaattii)) of the 01st day of February, 2021. 1gdS1dgS0iaa0iaassn4mn4maat7t7mmiaia,0,0nnppiiaaaGaGPPiiiietektekeuuooamamrrnngdgduueeeelklkaatntneeooggaawdwdatataaaannnnnnss,, mmAPkAPkafuafueeiimdlmndlnaaaaaauuuuvmvmiistsPtPppeeiiaSaSnncclolaoaakakknkrnaraaoaoggnnnnppggdsdseeaaaaaannnnntntyuyuaattbbememssaarraasphsphlleieaaiaannbbiwiwaaaauunnannatt tournament. on his contract negotiations, Hamilton replied, “yes” before
SSaammaann PPeemmuullaa ddaann AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt letting out a laugh.”
--DDeeffeennddaann--ddeeffeennddaann SOTHI & ANG dMdmddMmaaaaaeaenlnlahnahnmkamkaPPamameemamarrppikiknnaaaahhthtlhlbakbakhaahaaiinnrnrnyiyittaeasedsdnmnamaaagtgtnnpupuadadjjsutsuitipapaaaggnenellaaiirnrn““ooamamTTllneneHHeehhEEnnSSiiyySaSaiiininmaUmaUiirrN,N,akakd”dn”anaiindndPPppaaesesananememppakakaauukakannllhlhlaaiiininrrssdondonaaatyatyjijinaasnaas “She made a hole-in-one. I got a little bit
NNOOTTIISS ((PPeennyyaammppaaiiaann GGaannttii)) ………………………….. AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt ddii pprreemmiiss tteerraakkhhiirr pressure, but I just tried to focus on my Aussie Open decision‘soon’
KKeeppaaddaa:: Solicitors for the Petitioner PkThTkhPiaeuiaeuggmnlmnlaaaadd,uu,uuaaTTkPkPaayylilmimanaanahhnanaaangngnmnmggeSeSddddnnrriiakiakjijaaneneRRddttacaaciaimamphaphrreueubabaniniaaypypiidd,a,eaeiim1nm1n4y4yNNppa0a0aoaom0m0.i.ia20a20ppn0n0aaBB,,yyiiuauaaaLLknknnnooiigtgrstrsooeeMsMsnnddeegegeeemmrrmmttppBaBaiiuukjikjiananrriinamjnamjaananai,i, game,“ said Kim, who responded with her
TTAANN SSAAYY LLAAEEKK ddaann ccuukkuupp aakkaann SSaammaann PPeemmuullaa ddaann AAffiiddaavviitt birdie binge. AUSTRALIAN OPEN chief Craig Tiley said yesterday he
2200,, LLoorroonngg BBiinnjjaaii TTiiggaa,, DALAM MAHKAMAH TINGGI SssSeeoollkkeeooppnnaaggssaattnnaarrttiiekekrhrhssepepbebeununtytyaakkmmeeppaaaattaiaiaassnnkkyyaaaammnngguu,,aattkkuuhhjjuiuirrh.h. ((77)) hhaarrii,, expected “decisions soon” on arrangements for the
TTaammaann SSrrii RRaammbbaaii,, DI MELAKA JJiikkaa kkaammuu bbeerrhhaassrraatt uunnttuukk mmeemmbbeellaa ttiinnddaakkaann Second ranked Kim and McDonald are tournament after reports said it could be shifted from its
1144000000 BBuukkiitt MMeerrttaajjaamm,, ths2hst2eee5ae5arrndndssNNdadeaeoiopibpbrrvvaiuaiueentntm,m,aaMMktbktbaaaaaaeeuuhmhmrrkk2u2uaam0m0mm2m2mee0a0alleeah,ah,sslplpuTutTtuiuiiiiillnnakakgghuhuppgglleeihi9h9ggdda:a:u0u0idida0a0PPiirmrmuuppllbsbasaaaaeageugumlmliiaa..PPaaiinJdnJdkikaiaaakkaannaammgsgskekeuuppacacaamamaddrdrduaauaaii both breakthrough winners in their last usual January slot. “Tennis Australia is doing everything we
PPuullaauu PPiinnaanngg.. DALAM NEGERI MELAKA, MALAYSIA iinnggkkaarr hhaaddiirr sseeddeemmiikkiiaann,, ppeenngghhaakkiimmaann bboolleehh starts. can to finalise the summer of tennis as soon as possible,”
AAMMBBIILL PPEERRHHAATTIIAANN bbaahhaawwaa ssaattuu SSaammaann GUAMAN SIVIL NO.: ddiibbeerrii tteerrhhaaddaapp kkaammuu.. Tiley said in a statement. “We are working closely with the
PPeemmuullaa bbeerrttaarriikkhh 1144//99//22002200 ddaann AAffiiddaavviitt bSbSoaoalmlmeehhaannddiPiPppeeeemmrriikukuslslaaaa ddooaalleennhhAAkfkfiiaaddmmaavvuuiittaaSSttoaoaksksoopnpnegegrraammnniinntteettaarrsasaeennbbududtiti Kim is making her first start since Victorian government on a plan that takes into account the
SSookkoonnggaann bbeerrttaarriikkhh 1199//88//22002200 ((sseelleeppaass iinnii MA-22NCvC-47-09/2020 MMaahhkkaammaahh iinnii.. winning the Women’s PGA Championship a needs of the players, fans, our partners and staff, and is of
ddiikkeennaallii sseebbaaggaaii ““SSaammaann PPeemmuullaa ddaann AAffiiddaavviitt Antara BBeerrttaarriikkhh ppaaddaa 2277 OOkkttoobbeerr 22002200.. month and half ago for her first major major benefit to the Victorian and Australian economy…
SSookkoonnggaann tteerrsseebbuutt””)) tteellaahh ddiikkeelluuaarrkkaann crown. and are confident we will have decisions soon.” The
tteerrhhaaddaapp kkaammuu ddaallaamm MMaahhkkaammaahh iinnii oolleehh TTAANN LILIN ATAN tt..tt.. Melbourne Age newspaper said it understood the Open
SSAAWW TTIIEENNGG yyaanngg bbeerraallaammaatt ddii NNoo.. 11334422,, MMKK (No. K/P: 640602-61-5084) ---------------P-P--ee--gg---u-u--aa--m-m---c-c---aa--rr--aa----PP--l-l-aa--i-i-nn--t-t-ii--ff-------------- McDonald captured her first tour title late would likely be delayed by one or two weeks, with Feb 1
2200,, KKuubbaanngg SSeemmaanngg,, 1144000000 BBuukkiitt MMeerrttaajjaamm,, NNOOTTIISS ((PPeennyyaammppaaiiaann GGaannttii)) iinnii ddiiffaaiillkkaann oolleehh last month at the Drive On Championship in emerging as a possible start date. But the Melbourne
PPuullaauu PPiinnaanngg ddaann bbaahhaawwaa SSaammaann PPeemmuullaa ddaann …PLAINTIF dTRMTdMReeaoaoeettnznzururhhttaaaPaaPannjjenenaag,g,mmOOuuTT,o,aoaaaimimmmWPWPccaauueaeannllnarnaraaguguHHwbHwbHeePoPoaarroioiananiiSSlalaaa&&eennmmnnggCCgag.a.,o,o,t,tmmAAddPPplpiliememaagNgNnnaauuooy,y,aa,.,.m1m1PP2244eec6c600gga9a900uur2r20a0aaa,,mmJJBBbabbabuulaelaekakaglglinainatiti Georgia in the Tour’s most recent Herald Sun said it could be pushed back as far as early
AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt ddiissaammppaaiikkaann kkeeaattaass Dan PPllaaiinnttiiff yyaanngg ddiinnaammaakkaann ddiiaattaass.. tournament. March. “Tennis Australia is acutely aware of the need for
kkaammuu sseeccaarraa ppeennyyaammppaaiiaann ggaannttii,, iiaaiittuu ddeennggaann 1.HANG LEE MUI certainty, but also conscious of reaching a solution with the
mmeennaammppaallkkaann ssaattuu ssaalliinnaann SSaammaann PPeemmuullaa (No. K/P: 591122-04-5408) Kim came into the third round with a state government that ensures the safety of the entire
ddaann AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt ddaann PPeerriinnttaahh 2. HANG LEE ENG one-shot lead over McDonald then used the community,” said Tiley.
yyaanngg ddiippeerroolleehhii iinnii,, ddii ppaappaann nnoottiiss MMaahhkkaammaahh (No. K/P: 601030-04-5028) birdie run to leave the American behind in
iinnii ddaann jjuuggaa mmeennyyiiaarrkkaann sseekkaallii ssaajjaa ddaallaamm 3. HANG YEAK CHUNG the first year tournament which was
aakkhhbbaarr tteemmppaattaann ““TTHHEE SSUUNN”” ddaann aakkhhiirrnnyyaa (No. K/P: 720319-04-5215) originally scheduled for May.
mmeennaammppaallkkaann ssaattuu ssaalliinnaann SSaammaann PPeemmuullaa …DEFENDAN-DEFENDAN
ddaann AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt ddii pprreemmiiss Menurut Perintah yang dikeluarkan “I just trying to keep pushing myself until
tteerraakkhhiirr kkaammuu yyaanngg ddiikkeettaahhuuii ddii NNoo..2200,, LLoorroonngg dalam Kamar di hadapan ANALIA the last hole,“ Kim said. “That is way to make
BBiinnjjaaii TTiiggaa,, TTaammaann SSrrii RRaammbbaaii,, 1144000000 BBuukkiitt BINTI KAMARUDDIN Penolong more birdies.” – AFP
MMeerrttaajjaamm,, PPuullaauu PPiinnaanngg ddaann ccaarraa ppeennyyaammppaaiiaann Pendaftar, Mahkamah Tinggi di Melaka
sseeddeemmiikkiiaann hheennddaakkllaahh mmeennjjaaddii ppeennyyaammppaaiiaann pada 10 November 2020.
yyaanngg sseemmppuurrnnaa ddaann ccuukkuupp aakkaann SSaammaann PPeemmuullaa NOTIS IKLAN BAGI
ddaann AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt kkee aattaass kkaammuu,, PENYAMPAIAN GANTI
ttuujjuuhh ((77)) hhaarrii,, sseelleeppaass ttaarriikkhh ppeennyyaammppaaiiaann Atas permohonan Plaintif dalam
yyaanngg aakkhhiirr.. tindakan ini melalui Notis Permohonan
JJiikkaa kkaammuu bbeerrhhaassrraatt uunnttuukk mmeemmbbeellaa ttiinnddaakkaann bertarikh 23 Oktober 2020 dan difailkan
tteerrsseebbuutt,, kkaammuu mmeessttiillaahh hhaaddiirr ssaammaaddaa sseeccaarraa di sini adalah diperintah bahawa
sseennddiirrii aattaauu mmeellaalluuii ppeegguuaammbbeellaa kkaammuu ddii penyampaian Writ yang bertarikh
hhaaddaappaann MMaahhkkaammaahh TTiinnggggii ddii PPuullaauu PPiinnaanngg 22-09-2020 dan Pernyataan Tuntutan
ppaaddaa 2255 NNoovveemmbbeerr 22002200,, ppuukkuull 99::0000 ppaaggii.. JJiikkaa yang bertarikh 22-09-2020 (selepas
kkaammuu iinnggkkaarr hhaaddiirr sseeddeemmiikkiiaann,, ppeenngghhaakkiimmaann ini dirujuk secara kolektif ‘Dokumen-
bboolleehh ddiibbeerrii tteerrhhaaddaapp kkaammuu.. Dokumen tersebut’) terhadap
SSaammaann PPeemmuullaa ddaann AAffiiddaavviitt SSookkoonnggaann tteerrsseebbuutt Defendan-Defendan dilaksanakan
bboolleehh ddiippeerriikkssaa oolleehh kkaammuu aattaass ppeerrmmiinnttaaaann ddii secara penyampaian ganti iaitu dengan
MMaahhkkaammaahh iinnii.. menampalkan sesalinan Dokumen-
BBeerrttaarriikkhh ppaaddaa 2277 OOkkttoobbeerr 22002200.. Dokumen tersebut pada pintu hadapan
premis Defendan-Defendan di alamat
tt..tt.. terakhir yang diketahui No.17, Jalan
------------------------------------------------------------------------ Rumbia 14, Taman Daya, 81100 Johor
Bahru, Johor, No.6, Jalan MJ5, Taman
PPeegguuaammccaarraa PPllaaiinnttiiff Merdeka Jaya, 75350 Melaka dan No.
NNOOTTIISS ((PPeennyyaammppaaiiaann GGaannttii)) iinnii ddiiffaaiillkkaann oolleehh 8299, Jalan Merak 17, Bandar Putra,
TTeettuuaann OOooii WWeenngg HHooooii && CCoommppaannyy,, PPeegguuaammbbeellaa 81000 Kulaijaya, Johor, menampalkan
ddaann PPeegguuaammccaarraa bbeerraallaammaatt ddii NNoo.. 22669922,, JJaallaann sesalinan Dokumen-Dokumen tersebut
RRoozzhhaann,, TTaammaann HHwwaa SSeenngg,, AAllmmaa,, 1144000000 BBuukkiitt di papan notis Mahkamah Tinggi di
MMeerrttaajjaamm,, PPuullaauu PPiinnaanngg..,, PPeegguuaammccaarraa bbaaggii Melaka, melalui suatu notis iklan
PPllaaiinnttiiff yyaanngg ddiinnaammaakkaann ddiiaattaass.. yang disiarkan dalam suratkhabar
berbahasa Inggeris “The Sun”. Adalah
dimaklumkan bahawa kes tersebut
akan didengar di Mahkamah ini pada
10-12-2020 pada pukul 9:00 pagi,
iaitu hari yang Defendan-Defendan
dikehendaki hadir; dan jika Defendan-
Defendan ingkar hadir Mahkamah
boleh membuat suatu Perintah
terhadapnya dengan ketiadaannya.
Penyampaian ini hendaklah menjadi
penyampaian yang sempurna dan
cukup akan Dokumen-Dokumen
tersebut terhadap Defendan -Defendan
Empat Belas (14) hari selepas tarikh
iklan dan penampalan tersebut dan
kos dan perbelanjaan yang disebabkan
oleh permohonan ini hendaklah
menjadi kos dalam kausa.
Bertarikh pada
10 NOVEMBER 2020
t.t
……………………….
Penolong Kanan Pendaftar
Mahkamah Tinggi di Melaka
Notis ini dikeluarkan oleh Tetuan S. K.
Song, peguamcara bagi Plaintif yang
beralamat penyampaian di No. 75A,
Jalan Mutiara 1/9, Taman Mutiara Mas,
81300 Skudai, Johor.
(Ruj: SKS/L 8680/20/LIM)
22 theSUN ON MONDAY | NOVEMBER 23, 2020
SPORTS
ATLETICO MADRID delivered a major Barca in disarray AtleticocondemnCatalanstoworst
boost to their hopes of winning La Liga start in La Liga as Real drop points
yesterday by beating Barcelona 1-0 and
consigning their opponents to their better results,” Koeman told spanish sports daily Real Madrid had earlier been held to a 1-1 league to 24 matches.
worst start to a league season in 29 years. Marca. draw by in-form Villarreal, another slip-up for the “Today we were able to win but it absolutely
reigning champions to enforce the sense that this
Yannick Carrasco finished brilliantly from “In principle we have done our best. Then we could be Atletico’s year. doesn’t change anything,” said Simeone. “We’re
range after mistakes from Gerard Pique and had two very clear chances to equalise. It’s always working well and I’m excited about this team.”
Marc-Andre ter Stegen left the goal gaping but difficult, we know that Atletico defend very well. And beating Barcelona in La Liga for the first
Barca, and a below-par Lionel Messi, failed to time since 2010 – before Diego Simeone arrived Another disappointing day for Barca was
respond at the Wanda Metropolitano. “The goal (we conceded) was our fault; it’s not as coach – will do wonders for the team’s belief soured further by the sight of Pique hobbling off in
good and it can’t happen.” and extends what is now a considerable tears with what the club said was a “sprained right
Instead, Atletico recorded their first league advantage in the table. knee”.
victory over Barcelona in 10 years, which puts “We must improve in attack and defence. We
them three points ahead of Real Madrid, with a know that we need to go on a run of winning It also extends Atletico’s unbeaten run in the Pique was hurt during a collision with Angel
game in hand, and second in the table, level on matches.” Atletico Madrid’s Correa and was in distress as he departed.
points with early leaders Real Sociedad. Yannick Carrasco
scores past “I am worried,” said Koeman. “A lot of damage
It also leaves their opponents languishing in Barcelona keeper has been done.”
10th, with Barcelona’s 11 points from their first Marc-Andre ter
eight games their worst tally at this stage since the Stegen during Earlier, a patched-up Real Madrid had to hang
1991-92 season. yesterday’s La on for a draw against Villarreal.
Liga match at
“Like any coach, I am responsible,” said coach the Wanda Mariano Diaz gave Madrid the lead after just
Ronald Koeman. “We know we have to improve Metropolitano 105 seconds but Zinedine Zidane’s team faded at
the results. I continue to trust the players I have.” Stadium in La Ceramica and Villarreal claimed a deserved
Madrid. point through Gerard Moreno’s second-half
“The players are working well, but we want – REUTERSPIX penalty.
5201/2020 22/11/2020 (SUN) “It feels like a small reward,” said Zidane. “We
deserved more today for the game we played. I’m
annoyed because of the effort from the boys.” –
AFP/Agencies
SPORTS TOTO MALAYSIA SDN BHD (8420 - D)
TOTO 4D PRIZE PAYMENTS GUARANTEED IN FULL DrawDate:22/11/20(Sun) DrawNo:5148/20 Venue: PERAK TURF CLUB
1st Prize 2775
2nd Prize 4520
3rd Prize 5101
Special Consolation 4977
4649
6513 9589 9860 7352 8154
5081 4764 6030 7355
0007 3533 2562 6878
8402 5345 3606 0331
6552 2031 4799 7754
3,977,293.07 Hot Ron at the double for Juve 3305 + 8407 3081 + 8493
9514 + 0945 6016 + 6618
2775 4520 4520 2775 CRISTIANO RONALDO scored his third Alvaro Morata cross on 38 minutes, before 1818 + 1983 1127 + 9472
2775 5101 5101 2775 brace in five games as champions latching onto a Merih Demiral header from 7395 + 9666 3515 + 3476
4520 5101 5101 4520 Juventus moved up to second place in a corner for the second from close range 4854 + 0347 1488 + 5357
Serie A yesterday with a 2-0 win over minutes later.
119,216.68 Cagliari in Turin. RM5,524,576.30
Ronaldo, 35, has come back strong
Winning combination of any 1 of Top 3 & any 1 of Special prizes. Andrea Pirlo’s side are one point after his coronavirus layoff, scoring eight
behind leaders AC Milan, who have a goals in five games to join Milan’s Zlatan
1st Prize 2775 + game in hand. Ibrahimovic at the top of the Serie A 4977 + 4649 4649 + 4977
2nd Prize 4520 scorers’ chart. 4977 + 8154 8154 + 4977
3rd Prize 5101 + Lazio also won 2-0 under torrential rain 4649 + 8154 8154 + 4649
4th Prize at Crotone, but Atalanta were held 0-0 at Gian Piero Gasperini’s Atalanta stalled
Special Prize + MONKEY promoted Spezia days before their before their big match at Anfield in three RM100,000.00
Champions League trip to Liverpool. days’ time, being held to a second
+ consecutive stalemate.
Juventus had been held 1-1 at Lazio
5th Prize Consolation Prize + last time out – one of four stalemates this Atalanta are sixth, level on points with
season for the nine-time reigning seventh-placed Lazio after eight games.
6th Prize Any 4D drawn number champions – but quickly took charge 604 977 + RABBIT RM140,000.00
against the Sardinians. “Technically it was not a good
TOTO 5D & 6D PRIZE PAYMENTS GUARANTEED IN FULL performance but there are no easy
“We needed a match like this,” said matches and the team did what they had
76508 Pirlo. “There were excellent performances, to do,” said Gasperini, whose side failed to 814 649 + MONKEY RM2,623,749.00
6508 even from those returning from national score for the first time this season.
60756 508 teams. 128 154 + TIGER RM1,703,207.60
27323 08 In Calabria, Ciro Immobile scored on his
“A lot of them arrived two days ago and return from coronavirus isolation with his
659116 did their first training yesterday and were 21st-minute diving header paving the way 133 305 378 407 573 081 268 493
also tired from the trip. for victory for Lazio on a waterlogged 619 514 810 945 796 016 906 618
65911 59116 pitch in southern Italy. 491 818 021 983 641 127 629 472
6591 9116 “Tonight they also had fun, 017 395 969 666 393 515 533 476
659 116 performances like this allow the players to “The whole thing has been 684 854 130 347 681 488 175 357
65 16 gain confidence.” unpleasant,” said Immobile, who had been
out for three weeks because of Covid-19.
Federico Bernardeschi had an early
goal ruled out for offside before Ronaldo “But now I’ve come back even more
struck twice in a four-minute spell before motivated because when you have been
the break. stopped you realise how much you love
this sport.” – AFP
The Portuguese striker blasted in an
TOTO GAMES GIVES YOU MORE WINNING CHANCES! Haaland scores four for Dortmund 977 649 154
ERLING Braut Haaland netted four goals There was still time for history to be
3 7 17 28 45 50 and Youssoufa Moukoko became the made as Moukoko made a late cameo off
youngest player in Bundesliga history the Dortmund bench to replace Haaland.
36,129,887.42 yesterday as Borussia Dortmund routed
Hertha Berlin 5-2 to trim Bayern Munich’s One day after his 16th birthday,
lead at the top of the table to just a point. Moukoko is the youngest player in RM742,230.90
Bundesliga history.
3 5 7 8 25 30 It was the first time the 20-year-old 977 + 649 + 154 649 + 154 + 977
8,684,075.30 Haaland had scored four goals in a game “He’s only just turned 16 – that is
for Dortmund since his January debut, amazing,“ Haaland said of Moukoko. “He 977 + 154 + 649 154 + 977 + 649
with all of them coming in the second half. has a big career ahead of him.” 649 + 977 + 154 154 + 649 + 977
Jackpot 1 8 18 27 38 43 44 39 “I drank a Red Bull at half time, I got Dortmund’s romp in Berlin moved 1+3D Jackpot 2 RM118,820.10 won
Jackpot 2 1,762,496.42 some wings and everything was good,“ them second in the standings, behind on 21/11/2020 !
147,962.72 said Haaland. defending champions Bayern who stayed
top despite a 1-1 home draw with Werder
Toto 4D Jackpot 2 The Norwegian now has 10 goals in Bremen.
seven Bundesliga matches this season to
RM117,780 give him a total of 31 goals in 30 games in Germany goalkeeper Manuel Neuer
all competitions for Dortmund. produced great stops to twice deny US
won on 21/11/2020! forward Josh Sargent as Bremen earned
After Matheus Cunha gave Hertha a their first point at Bayern for a decade.
Visit www.sportstoto.com.my for e-Results and more info. first-half lead at Berlin’s Olympic Stadium,
Dortmund roared back. “We had to invest a lot,“ Neuer told
Sky. – AFP
23theSUN ON MONDAY | NOVEMBER 23, 2020
* SPORTS
VAR denies Blues shine bright
Villans point Lampard salutesWerner, welcomes consistency after stroll in the ParkIMO WERNER shrugged off his
against Seagulls international embarrassment and
inspired Chelsea to extend their
BRIGHTON won at Villa Park for the first
time in their history, deservedly edging Tscintillating recent form with a 2-0 win
out Aston Villa in a dramatic and Lampard singled out Werner for special praise “It’s nice to be in the position we are, and to
entertaining encounter on Saturday. after the match, saying: “He (Werner) had a have gained confidence from the clean sheets,
couple of chances and sometimes it doesn’t go in which were a problem for us earlier in this season
Solly March’s delightful curling finish for you, but I thought he was a real threat for us and parts of last, but we need to keep working and
settled it after Ezri Konsa’s sliding over Newcastle at St James’ Park. throughout. be consistent,” he said.
equaliser cancelled out Danny Four days after featuring in Germany’s “You need players of that quality to win game “The international break was challenging but
Welbeck’s solo run and chip. humiliating 6-0 Nations League defeat to Spain, and the pace he travels with the ball is something we came here against a team we lost to last year,
the £48 million (RM255m) man shone against special. He was so unselfish, and you rely on we dominated possession and we scored our
All of that preceded a frantic period Steve Bruce’s Premier League strugglers as those players who are top-class.” goals, and we could have scored more.”
of stoppage time that saw Tariq Chelsea made it five straight wins in all The victory lifted Chelsea top of the Premier Magpies boss Bruce bemoaned his side’s
Lamptey sent off for a second yellow competitions. League for a few hours – the first time under inability to make the most of their opportunities
card and a decision to award Villa a A 10th-minute own goal by Federico Lampard – but the Blues boss refused to get and admitted conceding early goals is becoming
penalty for a foul by March overturned Fernandez helped the visitors on their way before carried away with his side’s increasingly a worrying habit.
after referee Michael Oliver consulted Werner’s brilliant solo charge in the 68th minute impressive run of form. “That’s the fifth time we’ve been one down
the pitchside monitor. cued up the simplest of opportunities for Tammy Instead, he pointed to their defensive display with five or 10 minutes played and we have to
Abraham to effectively seal victory. as another reason why they may be in better address that,” Bruce told Sky Sport.
“I don’t know what a penalty is now. Sean Longstaff’s stunning 30-yard drive which shape to launch a title challenge. “I’m frustrated because we can’t get a result. I
We could all hear the contact inside the rattled the woodwork proved the only real Edouard Mendy has registered seven clean make no excuses but we’ve played three of the top
ground,“ Villa boss Dean Smith told BBC positive for the home side who simply struggled sheets in his nine appearances for Chelsea in all six in the last few weeks. It’s been difficult but
Sport. to match Frank Lampard’s confident side for competitions, with Saturday’s shutout at St James’ there was a lot to like about that second-half
much of the afternoon. Park his fourth in five Premier League games. performance.” – The Independent/Agencies
“If VAR thinks it’s not a penalty then
just tell the referee it’s not a penalty. It 437/20 22/11/2020
wasn’t given so we have to take it on
the chin. 2139
8665
“I don’t think we were bad. We 9577
missed chances and we’ve made big
mistakes for their goals. 1228 3546 9789 8758
8916 7860 9557 1365
“We have to defend much better. 0654 2920 6607 2356
Brighton were a threat on the counter 3201 6111 4497 6131
but I wasn’t overly concerned. 8628 9242 3142 1571
“I thought we had control of the RM 3,267,241.17
game and if we had taken our chances
we would have won.” 2139 + 8665 2139 + 9577
8665 + 2139 8665 + 9577
In the end, Brighton were simply 9577 + 2139 9577 + 8665
more clinical, with Villa’s threat
diminishing after they went behind for From left: Marlon RM 187,801.68
the second time. Pack, Joe Ralls,
and Curtis 2nd Prize Won
Brighton had managed only three - 2 winner(s)
goals in their previous four League Nelson of Cardiff
matches, but despite often having to City react after
gather men behind the ball, they kept
their attacking threat through Welbeck yesterday’s draw
and his strike partner Neal Maupay. against Millwall.
“Our second was a really good team Harris wants Cardiff 02 03 05 11 13 24 31 36
goal and a great finish by Solly March,” to find winning edge 06 12
said Brighton manager Graham Potter.
“I’m pleased for him because he NEIL HARRIS has said Cardiff City must find good point if we follow it up with a really good 396577 96577
influences games. their clinical edge and start winning games of performance and more importantly three 6577
football after yet another draw against Millwall points on Wednesday (Thurs 3.45am Malaysian 39657 577
“We’ve had a few penalties against turned up the pressure another notch. time) at Coventry. 3965 77
us this season so I’m not sure what is 396
and what isn’t a penalty these days. I The Bluebirds were their own worst enemy “We moved the ball well, created some 39
know Solly touched the ball so we’re once again at The Den, with Alex Smithies and chances in the second half, but we gave
just happy it went our way this time.” – Curtis Nelson allowing Matt Smith to nod ourselves a mountain to climb with a poor 65
Agencies home the game’s opener. But Kieffer Moore’s goal.
goal with 11 minutes remaining salvaged a 01
RESULTS draw for the Welsh side. “In the Championship you have to deny
people opportunities and if that game is 0-0 at RM 7,445,994.84
ENGLISH PREMIER LEAGUE: Aston It has been a far too familiar story this 60 minutes or 70 minutes I think we go on and
Villa 1 (Konsa 47) Brighton 2 (Welbeck season and is the primary reason Cardiff find win that. RM 104,498.14
12, March 56), Newcastle 0 Chelsea 2 themselves battling in 15th place in the
(Fernandez 10-og, Abraham 65), Championship table. “We have to start winning games of
Tottenham 2 (Son 5, Lo Celso 65) football, that goes without me having to say
Manchester City 0, Manchester But, with a dozen games now under the that. Ultimately, that’s what matters.
United 1 (Fernandes 56-pen) West belt and only three wins on the board, Harris
Brom 0. has said Cardiff must start their winning streak “I’m not one to hide behind stats. I can see a
CHAMPIONSHIP: Bournemouth 4 now, with a trip to Coventry City on its way in lot of good in what we do, but is that winning
Reading 2, Barnsley 2 Nottingham midweek. mentality really there?
Forest 0, Bristol City 1 Derby 0, Luton 1
Blackburn 1, Middlesbrough 0 Norwich “It’s another game without a win and we “I’ve seen it on the training pitch the last 10
1, Millwall 1 Cardiff 1, Preston 1 want to win games of football,” Harris said. days, a massive shift in winning mentality. That
Sheffield Wednesday 0, QPR 1 Watford has to translate to a Saturday afternoon.
1, Stoke 4 Huddersfield 3, Swansea 1 “I don’t just look at today, I look at breaking
Rotherham 0, Wycombe 0 Brentford 0. down four games and what is coming this “Did I see it this afternoon? I did in the
LA LIGA: Levante 1 (Melero Manzanares week. second half. But it’s fine looking like a good
12) Elche 1 (Morente 64), Villarreal 1 team on paper, but we need to win games of
(Gerard 76-pen) Real Madrid 1 (Mariano “I just said to the boys that becomes a really football.” – WalesOnline
2), Sevilla 4 (Kounde 5, En-Nesyri 45+3,
Escudero 85, Munir 87) Celta Vigo 2
(Aspas 10, Nolito 36), Atletico Madrid 1
(Carrasco 45+3) Barcelona 0.
SERIE A: Juventus 2 (Ronaldo 38, 42)
Cagliari 0, Crotone 0 Lazio 2
(Immobile 21, Correa 58), Spezia 0
Atalanta 0.
BUNDESLIGA: Bayern Munich 1
Werder Bremen 1, Borussia
Moenchengladbach 1 Augsburg 1,
Hoffenheim 3 Stuttgart 3, Schalke 04 0
Wolfsburg 2, Arminia Bielefeld 1 Bayer
Leverkusen 2, Eintracht Frankfurt 1 RB
Leipzig 1, Hertha Berlin 2 Borussia
Dortmund 5.
LIGUE 1: Brest 4 Saint-Etienne 1.
MONDAAYY••NNOOVVEEMMBBEERR2233,,22002200 QUOTE OF THE DAY
Of course not, I’m so far away. I have one
Slam and one Masters 1000 title, that's
it... But I love to play against them, these living
legends.Every match against them is a privilege
and a huge chance to learn, but to beat them is huge
confidence boost.”
DominicThiem on being part of the ‘Fab Four’
Solskjaer admits West Brom performance ‘not a step forward’
OLE GUNNAR SOLSKJAER admitted half of the table, and insisted that “A lot has been said and written and it unsettled star since he returned to England.
Manchester United’s performance against West improvement was needed. probably affected players more than I’d have “I spoke to Paul about it. Of course, he’s not
Bromwich Albion was “not a step forward” and liked but it has. We got a win, clean sheet and a
“way below-par”, though welcomed their first “It’s definitely not a step forward game here again in three days.” happy when he’s not been playing and not
home win of the Premier League season. performance-wise,” he said. “We played really playing really well.
well against Everton last time. That’s a One notable absentee in United starting XI
United required a retaken Bruno Fernanders performance I was really happy with. yesterday was Paul Pogba and Solskjaer later “He’s not been happy with his (club
penalty in order to beat winless West explained that the unsettled star had picked performances). But Paul had a difficult season
Bromwich, with the Portugal international “This one was way below par and up an ankle problem since returning to last season. Then he’s had Covid. But three
scoring from the spot at the second attempt sometimes three points are more important England and subsequently had to be left out games for France have helped him get his
after goalkeeper Sam Johnstone had strayed than performance, even though we know that of yesterday’s match. fitness and rhythm.
off his goal-line. to move up the table we have to play better.
“He (Pogba) tried to finish the last session “I spoke to him and he feels stronger for it.
Solskjaer’s side laboured for long spells and “After the international break it isn’t easy, but it (ankle) got worse and worse so he is He plays in the same position for France as he
failed to put away the few chances which fell there’s not much time to prepare for the unavailable today,” the United boss said. does for us, so that scenario isn’t an issue.
their way, while Slaven Bilic’s visitors were left game.”
ruing referee David Coote’s decision to “Hopefully he is OK for Tuesday (against “It’s about getting momentum and rhythm
overturn a penalty award after an on-field VAR Solskjaer was nevertheless “delighted” with Istanbul) but we’ll see.” and Paul said he felt really strong towards the
review. the win, which was United’s first at Old Trafford end of the games against Portugal and
in the League at the fifth attempt this season. Pogba impressed for France over the Sweden.
After the final whistle, Solskjaer conceded international break, with national team
that United had not convinced despite picking “I think it’s very important. Towards the end manager Didier Deschamps voicing his “I think he’s going to improve and be a very
up all three points and moving into the top it meant a lot for us and maybe then we were opinion over the midfielder’s United struggles. important player, and person, for us. To have
too edgy. We haven’t had a win at home in the him in form is vital.” – The Independent/Daily
league this season. But Solskjaer says he has spoken to the Star
‘I’ll sleep like TOTTENHAM coach for the visitors after just five
Jose Mourinho has minutes when one simple ball
played down his side’s over the top from Tanguy
chances of winning the Ndombele caught Joao Cancelo
Premier League this season sleeping and Son Heung-min
after a 2-0 victory against had the pace and precise finish
Manchester City sent Spurs to under Ederson to register his
the top of the table. sixth goal in 11 games against
an angel’ Yesterday marked the first City.
time since August 2014 that
Tottenham finished a day atop “The stats speak for
the standings, and the first time themselves, we were better in
since 1985 that the north many departments but we
London club have achieved that conceded a goal we cannot
feat after at least nine top-flight concede,” said Guardiola.
fixtures.
“It was the perfect scenario
But Mourinho, keen to avoid for them. We knew (Harry)
putting unnecessary pressure Kane drops and Son runs in
on his players, dismissed the behind. We have to defend
significance of his team’s two- better.”
point advantage over Chelsea,
Mourinho not putting pressure on Spurs despite victory over City who beat Newcastle 2-0 on And Tottenham landed the
Saturday and who await Spurs knockout blow 25 minutes from
this weekend. time with another simple
“It feels good (to be top), but counter-attack.
maybe tomorrow we are second
again and honestly that would Kane was afforded plenty of
not be a problem for me, I am time and space to collect a loose
just happy with the evolution,” ball in midfield and drive
Mourinho said in the forward before feeding Lo
knowledge that a Leicester City Celso, who had barely been on
win at Liverpool overnight the field a minute and with his
would send the Foxes above first two touches, controlled
Spurs. and then slotted the ball low
“People cannot expect us to beyond the advancing Ederson.
come here and after one season
we are fighting for the title. We Guardiola, who ended
are not fighting for the title, we speculation over his future by
are just fighting to win every committing to a new contract as
match. City boss until 2023 last week,
“But we are going to lose has won eight league titles at
matches, we are going to draw Barcelona, Bayern Munich and
matches,” Mourinho said, City, but now faces a challenge
almost a year to the day that he he has never had before in
took over at the club. rebuilding a second title-
“Dinner tonight will be nice winning side at the same club.
and relaxed and (I will) sleep
like an angel. But no problem if For the sixth consecutive
Leicester wins and we are League game City failed to score
second again,” he said. more than once with little sign
The Portuguese, however, of Guardiola’s men
couldn’t hide his pride at an rediscovering the cutting edge
accomplished performance of the free-scoring sides that
from his side. won back-to-back titles in
“Big team, big hearts, big 2017/18 and 2018/19.
Tottenham Hotspur’s solidarity, a proper team – a
Giovani Lo Celso (left) team that I believe makes “We are struggling to score
celebrates scoring his Tottenham fans proud. goals this season, that can
team’s second goal happen. They shot two times
with Son Heung-min “Players going to the limits of (on target), two goals and we
during yesterday’s their energy, sacrifice for the cannot score with 22 shots,”
English Premier League game plan, coping well with, Guardiola said.
against Manchester let’s say, a new pressure of: ‘If
City at the Tottenham you win the match, you go top Tottenham’s title challenge
Hotspur Stadium in of the League for 24 hours.’ will be fully tested with Arsenal,
London. – REUTERSPIX Liverpool and Leicester to come
“I’m very proud. They before Christmas, but they
deserve big applause and lots of could not have made a better
respect.” start to that daunting run.
The writing was on the wall
“You can see it is open with
the way the table stands.
Whoever can put a good spell
together has a chance of
winning it,” said Kane. – The
Independent/AFP
theSun is published and printed by Sun Media Corporation Sdn Bhd (221220-K) of Lot 6, Jalan 51/217, 46050 Petaling Jaya, Selangor. Tel: 03-7784 6688 Fax: 03-7783 7435 • Tel (Editorial): 03-7784 6688 Fax: 03-7785 2624/5 Email: [email protected] • Tel (Advertising): 03-7784 8888 Fax: 03-7784 4424 Email: [email protected]