2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
HOME SPONSOR:
Laura Mounter Real Estate
Established in 1999, of the local marketplace, and selling Real Estate with
Laura Mounter Real integrity. Our agents have all been hand selected for their
Estate is a locally professional talents and their dedication to put client’s
owned independent needs above their own. They understand the importance
Real Estate company of keeping client’s personal information confidential.
serving North We provide you with guidance, support, and personal
Central Washington. communication each step of the way.
Offering the most We have agents who specialize in all aspects of Real Estate.
professional, ethical, and knowledgeable Real Estate Residential, new homes, land, development land, commercial
services in and around the Wenatchee Valley. and industrial property, condominiums, retirement living,
As an independent Firm, we are not tied to any national investment property, and recreational property. The LMRE
brands, and are able to adapt instantly to changes in our team knows Real Estate in the Greater Wenatchee Valley and
local marketplace. We are continually investing in the best we are well positioned to facilitate our clients in gaining their
technology the industry offers, and as members of both objectives.
our local North Central Washington MLS and Northwest MLS Voted the “World’s Best” Real Estate office by our
(predominantly used in the Greater Puget Sound area), LMRE community for the past 5 years, a recipient of North Central
listings are privy to a vast platform viewed by thousands of Washington Home Builders Association Company of the
Real Estate agents, and our buyers have access to all listings Year and recipient of the Wenatchee Valley Chamber of
on the most widely used MLS’s in and around our valley. Commerce Chelan County Business of the Year, as well as
Our exceptional reputation has been gained through many the recipient of numerous individual agent awards, LMRE is
years of continued hard work, having a deep understanding the trusted leader. Let us show you the difference!
Buying a home is probably
the most expensive purchase
you will ever make.
Home Inspections
Structural Pest
Inspections
Foundation “My promise to you is to conduct
Certifications a thorough professional In-
IR Thermography
spection with a comprehensive,
easy-to-understand written
report of my findings”
Don Hester (509) 670-9572
www.ncwhomeinspections.com
51
8 Sadler Construction
Main Floor Bedrooms SHOP & THE HOME
GARAGE
1,798 sq. ft. 3 This Northwest Mountain Modern Designed
............ ............ DRIVEWAY home is nestled neatly 19 miles up the Entiat
River Valley in a private development. Designed
Garage Bathrooms by Syndicate Smith, this home boasts an open
floorplan in a serene mountain setting next
741 sq. ft. 2 to the Entiat River. With exposed wood and
............ steel beams, this home combines natural and
industrial in a unique presentation of structure
Workshop and art. An open living floorplan surrounded
by floor-to-ceiling wood clad windows brings
960 sq. ft. full natural light into the home. With a simple
and clean design in mind, the master suite
GARAGE provides luxury and privacy with a beautiful on-
suite bathroom and a private deck. The heated
HOUSE concrete floors and the natural stone fireplace
add warmth to the cool feel of this home to pair
nicely with the clear cedar ceilings and dark alder
cabinets.
h Exposed Wood (glue lam) Beams
h Hydronic heated ground concrete floors
h Floor to Ceiling Wood Clad Windows
h Steel Plate & Stone Fireplace
h Combined Cedar and Steel Siding
h Clear Cedar ceilings and soffits
h Metal Roofs and Facias
h Knotty Alder 2 Panel Doors
h Knotty Alder Trim Throughout
h Beautiful Custom Dark Alder Cabinets
h Custom Reclaimed Wood Barn Door
h Huge Walk-in Shower in Master Bathroom
h Open Floorplan
h Unique Metal Beam Structural Accent
h Large Garage – Shop Combo
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
THE BUILDER Steve Sadler
Sadler Construction, Inc. was founded in 1980 Sadler
by owner Steve Sadler. Steve and his team focus Construction
on providing clients with quality workmanship, 509-669-1582
exceptional performance, and solid relationships.
Sadler Construction, Inc. has earned a solid Steve Sadler
reputation for keeping promises and delivering [email protected]
results – meeting and exceeding the individual www.SadlerLuxuryHomes.
needs of a wide variety of residential and com
commercial clients.
Contractor #: SADLEI*991BZ
From concept to completion, Sadler Construction,
Inc. provides a full range of services to assist
clients during the planning, design, and
construction phase of residential or commercial projects. Valuable relationships
with designers, regulatory agencies, subcontractors, and suppliers provide
another advantage to Sadler’s Clients.
Sadler Construction, Inc. utilizes a management approach that enhances
communication, reduces interim financing costs, and assures high quality
craftsmanship.
53
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Protecting Your Family From Harmful Lead Dust
Although the Anytime you cut into surfaces painted To learn more about any one of these
Renovation, Repair with lead paint, even if the paint is suggested safeguards, or to source a
and Painting Rule covered by layers of newer paint, you certified RRP contractor or inspector,
does not apply risk creating hazardous lead dust. You contact BNCW at (509) 293-5840, or
to homeowners can reduce the risk of lead exposure online at www.buildingncw.org.
renovating, repairing, in your home by hiring a certified lead
or painting their inspector to check to see if there is lead
own homes, do-it-yourself projects paint in the area of your work. If there
can easily create dangerous lead dust. is lead, then you may want to have a
Protect your family and home – set up trained and certified lead abatement
safely, control the dust, and clean up contractor perform an abatement to
completely. remove the lead from the area before
you begin work.
Follow these safeguards to prevent lead
dust from spreading throughout your CONSIDER HIRING A CERTIFIED
home: RRP CONTRACTOR
When you think you may have lead
• Work safely paint, it may be best to hire a trained
• Get the right equipment lead-safe certified RRP contractor.
• Follow good work practices These contractors have been trained
• Consider hiring a Certified Lead in special methods to minimize dust
and clean up thoroughly to reduce the
Abatement Contractor or Inspector chance of lead contamination.
Fire Extinguishers everyone has exited the building; the fire department has
been called or is being called; and the room is not filled with
A portable fire extinguisher can save lives and property smoke.
by putting out a small fire or containing it until the fire • For the home, select a multi-purpose extinguisher (can be
department arrives; but portable extinguishers have used on all types of home fires) that is large enough to put
limitations. Because fire grows and spreads so rapidly, the out a small fire, but not so heavy as to be difficult to handle.
number one priority for residents is to get out safely. • Choose a fire extinguisher that carries the label of an
independent testing laboratory.
SAFETY TIPS • Read the instructions that come with the fire extinguisher
and become familiar with its parts and operation before a
• To operate a fire extinguisher, remember the word PASS: fire breaks out. Local fire departments or fire equipment
distributors often offer hands-on fire extinguisher trainings.
x Pull the pin. Hold the extinguisher with the nozzle • Install fire extinguishers close to an exit and keep your back
to a clear exit when you use the device so you can make an
pointing away from you, and release the locking easy escape if the fire cannot be controlled. If the room fills
mechanism. with smoke, leave immediately.
• Know when to go. Fire extinguishers are one element of a
x Aim low. Point the extinguisher at the base of the fire. fire response plan, but the primary element is safe escape.
x Squeeze the lever slowly and evenly. Every household should have a home fire escape plan and
x Sweep the nozzle from side-to-side. working smoke alarms.
• Use a portable fire extinguisher when the fire is confined Source: NFPA.org
to a small area, such as a wastebasket, and is not growing;
54
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Understanding Home Avoiding Copyright
Financing Infringement
If you’re thinking about buying, refinancing, building or The key to avoiding copyright infringement is to understand
remodeling a home, a trusted lender will help you choose the that copying any part of another designer’s or builder’s plan
right type of financing to help you accomplish your goals is illegal. If you ask your designer, architect or builder to
while meeting your budget. Your lender will tailor a solution design or construct the same exact feature found in another
specific to you through loans for custom construction, builder’s home, it is a violation of copyright.
renovation, lot construction, first-time home buyers or many
government assistance programs. Many people believe that if you alter a plan by a certain
It’s very important to find a home loan expert that combines percentage, you are not in violation of copyright laws.
years of experience and dedication to guide you through However, even using another designer’s plan as a starting
the financing process from start to finish. Consequently, point could place you in violation of their copyright.
the first step in securing financing begins with finding the
right loan officer. Your loan officer will provide you with a It is not unusual to draw inspiration from a plan in a plan
checklist of essential documents you’ll need to take the next book, internet plan room or another house. Ask your builder
step, which is completing the loan application. or designer if they used someone else’s original drawing as
While you’re completing the application, your loan officer a starting point or "inspiration". If the drawing or home that
will be hard at work initiating credit checks, verifying served as inspiration for the homeowner, builder or designer
employment and deposit account history, and securing
credit approval. Once the application has been submitted, ©is "substantially similar" to the new drawing or home, the
your loan officer works in concert with your Realtor ™ (if
applicable) to ensure all the necessary property information new drawing may be a "derivative work”. Unauthorized use of
has been secured. At the same time, your loan officer works a derivative work to build a house is copyright infringement.
hand-in-hand with their experienced loan underwriter,
who verifies that all of the submitted documents meet the MARK YOUR CALENDARS FOR THE 2021 HOME SHOW
conditions of the loan. They also pay close attention to each
detail of your specific loan type to make sure the loan meets FEBRUARY 12TH, 13TH & 14TH
the complex regulatory requirements needed for conditional
approval. INTERESTED IN BECOMING A VENDOR? CALL THE BNCW OFFICE
The next sequence of events marks the final stage
of securing financing for your purchase, refinance, TODAY...THIS SHOW ALWAYS SELLS OUT FAST! 509-293-5840
construction or remodel project. As the loan processor
completes their final application checks and ensures all Committed to your satisfaction...
conditions of the loan are met, the lender requests the
closing documents. Behind the scenes, the loan closing Dedicated to your safety PROUD MEMBER
team or title company escrow officer ensures titles are
created or cleared, arranges for payoff statements (if Approved
needed for your loan type) and puts the final touches on Auto Body
preparing the closing statements.
Once all the necessary documentation is prepared, your loan Free Estimates
officer will coordinate an appointment that is convenient for
you to sign closing documents at the title company. When all Lifetime Warranty
the loan documentation is in order, deeds are recorded and
funds are dispersed, making your home goals a reality. Laser Measuring System
Source: Brette Sangster, NMLS#507149 Vice President, Banner Bank www.FirstChoicecc.com
Allen & Kim Tangeman, Owners
601 N. Wenatchee Ave. • 509-663-7008
55
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
If You Need to Evacuate Your Home
There may be conditions under which you will decide to get • Take your emergency supply kit unless you have reason to
away or there may be situations when you are ordered to leave. believe it has been contaminated.
Follow these guidelines for evacuation: • Listen to a battery-powered radio and follow local evacuation
instructions.
• Plan places where your family will meet, both within and • Take your pets with you, but understand that only service
outside of your immediate neighborhood. Use the Family animals may be permitted in public shelters. Plan how you will
Emergency Plan to decide these locations before a disaster. care for your pets in an emergency.
• If you have a car, keep a full tank of gas in it if an evacuation
seems likely. Keep a half tank of gas in it at all times in case of IF TIME ALLOWS:
an unexpected need to evacuate. Gas stations may be closed
during emergencies and unable to pump gas during power • Call or email the out-of-state contact in your family
outages. Plan to take one car per family to reduce congestion communications plan. Tell them where you are going.
and delay. • Secure your home by closing and locking doors and windows.
• Become familiar with any alternate routes and other means • Unplug electrical equipment such as radios, televisions and
of transportation out of your area. Choose several potential small appliances. Leave freezers and refrigerators plugged
destinations in different directions so you have options in an in unless there is a risk of flooding. If there is damage to your
emergency. home and you are instructed to do so, shut off water, gas and
• Leave early enough to avoid being trapped by severe weather. electricity before leaving.
• Follow recommended evacuation routes. Do not take • Leave a note telling others when you left and where you are
shortcuts; they may be blocked. going.
• Be alert for road hazards such as washed-out roads or bridges • Wear sturdy shoes and clothing that provides some protection
and downed power lines. Do not drive into flooded areas. such as long pants, long-sleeved shirts and a cap.
• If you do not have a car, plan how you will leave if you have • Check with neighbors who may need a ride.
to. Make arrangements with family, friends or your local
government.
5 Steps to Perform When Closing A Pool
#1 Clean Your Pool and Balance Your Water Most pool owners in our area begin opening their pools early to
Chemistry mid-April.
Vacuum the floor and brush the sides and tile line around the #4 Add a Winter Algaecide and Shock
entire pool.
Make sure that your pH, alkalinity and calcium levels are We use a special winter blend algaecide called “Wintertrine”,
balanced. We recommend that the pH should be between 7.4 which prevents the growth of green, black and mustard algae,
and 7.6, Alkalinity should be between 125-150 and Calcium and follow with Liquid Chlorine which oxidizes and clarifies the
between 250-400 PPM. pool water over the winter months. We especially recommend
using Orenda Pool Enzymes to cleanse the water through
#2 Chlorine Matters winter and at the spring start-up.
Be sure to hold a chlorine residual of at least 3 ppm BEFORE you #5 Closing Procedures Steps
add any closing chemicals. In fact, don’t be shy about adding
chlorine. More is better than less in this case. *remember your • Once the water is balanced and cleaned, the pool is ready
pool will be non-operational for 5 to 6 months. for the next winterizing steps. These steps include:
We ask a lot of our chemicals during the long winter months, so
make sure there’s enough in your pool to do the job. • Clearing out the water lines using a special blower
• Adding pool antifreeze to the plumbing lines
#3 Cold, Stagnant Water Needs Enzyme • Disassembling and draining equipment such as the pump,
An enzyme like Orenda CV-600 helps keep the water clear. filter and heater
Enzymes breaks down organic compounds that can build up in • Winterizing water lines using special plugs, and seals
stagnant water over the winter. Give it an added boost by lifting • Covering the pool with a heavy duty pool safety cover or
the cover up in March and adding a second bottle.
automatic pool cover
• Turn power off to the equipment and lock gates and doors
to pool and equipment
Source: Michael Berggren - Berggren Pool and Spa Services LLC
56
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Home Maintenance Tips
This checklist contains tasks you should complete at least
on an annual basis to keep your home operating efficiently
and to protect your investment.
ANYTIME DURING THE YEAR:
R Check all connections to your electrical system for
possible hazards.
R Check cords and plugs of all electrical appliances for
fraying or signs of wear. Repair or replace as necessary.
Do not overload extension cords.
R Test your smoke detectors, carbon monoxide detector IN THE SPRING:
and radon detector for proper operation. Clean the units
with a vacuum or cotton swab and replace batteries and R Check the condition of glazing compound, caulking and
light bulbs if needed.
exterior paint. Replace or paint as needed.
R Have your heating and air conditioning system(s)
R Exchange glass and screens in storm doors and/or
inspected and cleaned. If your system(s) has a filter,
replace it every three months to keep your unit working windows (also in autumn).
efficiently.
R Inspect the roof for snow damage.
R Inspect all doors and windows for proper operation and R Check for evidence of termites such as sagging floors
a tight fit. Clean the window tracks, clean and adjust the
door thresholds and check that the weather-stripping and ceilings or dry, brown tunnels in the ground near the
hasn’t cracked or torn. Preventing unwanted outside air home’s foundation.
from leaking into your home will reduce your energy bills.
R Seed and feed the lawn and plant annuals, cut back
R Check interior paint and touch up or repaint as needed.
perennials that need pre-growth pruning.
R Inspect the attic insulation. Make sure the entire ceiling
IN THE FALL:
area is covered. Check that the insulation has not blocked
vents in the eaves to prevent buildup of condensation R Mulch perennials that need protection from winter weather
and to allow proper air circulation. Insulation should also
not be touching the underside of the roof sheathing. and prune those that should be cut back in the fall.
R Oil motors of appliances as directed in instruction R Rake and compost leaves.
R Remove hose connections and store hoses to avoid
manuals.
freezing.
R Periodically check storage areas, closets, and the Lic#JLSCSCW840OH NEW CONSTRUCTION
REMODELS
basement to make sure no oily rags, gas cans, painting
supplies or flammable cleaning materials have been LIGHT COMMERCIAL
stored and forgotten. These items could be a fire hazard
and should be discarded.
R Check that the alarm and circuits of your security system Jeff Stephens
are in working order, inspect the sensors one by one, and 509-886-3020
check primary and backup batteries monthly.
jlscustomconstruction.com
R Inspect your stairs, steps and ladders for damage or
BATHROOMS, CUSTOM DECKS & MORE!
broken pieces that could cause someone to fall. Make
sure handrails and railings are sturdy and securely 57
attached.
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Fire Resistance
Fire occurrence in North Central Landscape Zone 1: 0-5 feet if the structure has one-hour
flame-resistant siding OR 0-10 feet if the structure has non-
Washington flame-resistant siding. In this zone, the goal is to prevent
ignitions on or near a structure.
On average, wildland fires occur in Chelan and Douglas
counties between every six and 30 years. Wildland fire has • Plant no trees or shrubs.
been a part of the North Central Washington ecosystem • Use only inorganic mulch. (Rubber mulch is not
since the retreat of the Continental glaciers more than
10,000 year ago. Wildland fire is an essential part of the acceptable for use.)
environment in this area. Fire serves as a key component in
maintaining a healthy and productive ecosystem. To reduce • Plant fire-resistant plants with high moisture content.
fire damage in the fire-prone wildland urban interface of
North Central Washington, home owners can site buildings, Landscape Zone 2: 5-30 feet. In this zone, the goal is
tboLuaprnnrdfieirsnecvgatehpneaetmtZmaobannyeeybr2ses:pi5og-rnr3ei0otaeftdedhefeotr.orfImniagtbhnfuiisirrtnzeioionntnghe,eastmhtoebumegrroacsayeolrsibso.ettohiepgrrneigvinteeintitdoanfnrsyoosumprrceeasd. of a
Fire occurrence inuse appropriate construction materials, and select fire-
uenrrternaDNlcWeoefrieatnhnsshCibeinnletgrSatploaWncaeshingtoneetohtdddaineirwfnlnCeifafnriitntenerermvhreeensed-ierssrasrtaoe.sefrifotinTiansnrcrcoihltemesatcaWfeit-nhuaiaeWfrhaefrOTtsastamptrniaeeohaialaglsrhhcreonnxsnrwtoeeaDarbTabfshmadsaeifeospoesbamoinieeehiptstatpnccunfwahuutonaarhsi.fieelha.moknsnbesgliefyyeeyvcepWrattCivdmrrreriierenendslestCeeienineiieinnoolicabshittyoiooansfaossrabclrgehmefh3sgeosel,adeimiteiwousecnnnoorbntftumaintrf0htfgrnoe,altsniooeepttnaiitfirotirnsstaoefiagmlaeeynlovlmnbennmeniiirleassddnatah,t,rsennNmdonnrfai,aedeyhpnetwwaiindpioansntoitphangeebnllpydonmoorctepfoaftfbpiiehsoeshuovisolnildiesNeerahoartgdndrremanr.abmaunttlttheoeoemtntttenoraWtetellyaltregcsefdeaayaaenththtnemweirrnnwrfpdtr,nldetsnnckipsi.taemleotlmieotovieunhutedoddratiCoeaahngwsieatnDpeiriwrimffelsnsilnronCernraiofanfdenmalemenrbeiitfotosontctoaSdheenerermvrhtdtnslerhtineteaabsenncancserdupw-ioiaoitehirirdosserpazosernae.httnnmaioenmaaeeopg.rsemfreinfeHonrnptomeinTioeanstmNnhtrpdcaralepricoolihslticeeemaeeabnflasadotsenocpaoiWlovitfmeoreitt-ncensnasfnhrruatisrouasehptsmWprermnesfriitaeatlarheentnnstconisrcrutaerpcftiselrmspmrsoirnierereattornhooiatneheooatsoctfar.eotnonbevghprtwsiCfaiuuirosmeorinatCeivetneeCoanaplizebatsohaa.tcatnnunnnhengekmcmntwwewoueWnhfehntcepehitnieteotttaertdnfiratianteoriihaeiiilhlneepmenillsisoossdlitatancendocngnlkeacttlgah,aaden,etieoedffseerllpfyoaaonnoessoteatbwnfpnvahanr.lntuahaNelrogotnanbnpassueraCemlptretnrcsyahcoctsi1stdyhnratesontdnererlnWtot,dtaarpcfvidealres.0hitotovioiunsturvvduodoh.rngahnrbtDoeaAailwf,fatsipeer.mrucieen0FtmmadltipbheiotvuonmacisfftcWrtetdesstnihemc0nipauncihupriaeaetewtrhdoezrtCgeartcneiee0oremetgprieekeiesip.eio.tlitoepsnnisNnhotdollpnrdi.ensyaDeeyadhnsldswfhssTtonaeogornnCfrersnsclr.efteg.uooamootmfaetaisraoeifteAttiesrrcnmooarmpcTtsvmnlrteervonfvmohnowcielseaeotafrrneme.ehteeitlauenirdslsdtpvpaDCoybaliiearnin.cscntioneevsbmotlwyieWuhotoeeatkftinentteiesrlsneeirihfneineeninrresosni,eeencgrirctlaasutehsbdfssnt.rotaseniognannaaaapra,aNlrcsHnbwlsianlkekgevcbiafn1wyhbrsdoebftnWeeaaeocios0etioiitiurtlrden.lsenrnetlrietw,atmtdmtuiee0lFohrephfamtfslfbatasiemc0ifefomhraeyeerrpapnCeaetee0ipwieokisai.rrngranefnlofcdteueosyweeroiwhcTnnrLLglnhseoeeoentdoetraaottieryaaioaat(vetdlrlvonvbnoiltcamiahreesnnyesenlatnaellirrervsesdduugfuuuuuuydkiseresseeccnMMEPEPKCaatllelleliiaahaeippmmrennniaaaeenpiiittnttmnntecLtZZsssmaouaaLd••••••••ilhiiaooizonna ttpnarreneennbnsgguyewdduuuuguuuuedeeygllclMPEPKCEMgbdeeabeserosreearll23llsclnuKEPPMCMEdiaiioeaaaetsontnalcmmlleellel::plcrfiidiaahadieounnapmmu-nrienitiea53pnniaagmersreiiirennpnttinetnennfauttiin0-tmppunnnrtues3daZsstssssadi-unaauubaaae(dizshifiihhoe01iiii/znnitttutp.nttonecnnprsenteseenebl0rehggZeeuefs.edruuwggduteygdelllc0wba.gduKeeoadelhe,srlcorllebase3s+tadeeoreefcatnftsnenle.og:tatplsrfrodhhdudae-atitesr.3lfoastenrsrcreirnlurieuediepenfup0Idr-puonhmreettundtseee-un3nrsbaey(rfuie1n/rwigfeutonetcfpsuesnps)dtr:l0uhnuu.bees.eduu.ehturesa0wn3aa/.KfIdebld,deseruusnn+itlssuoeftnce0s.tllsgit,alrhnaeuestfssrfhueiedtgncra-.zreieuhtip.eonhr.eetrl1sadoneK,eriysegaudnfnwoi0ctfpstt)ndesan.ug.letetgrhreoaw0aIeaddeeearucoznrtlswimtleli,s+,noerndopnestwfitgauhet.tleeehmudncnenerhfebgfdnwoilscldnepsaedllueeoeblryos-aaaoe,zstwrdew.sdesmtesnowgtwtdualpetlle,lhdnrciefeso1d.nntarleslagefuadleol.hsI0-aeceali,tsnno.srserlwottl’dgepreodehcdrsfl1idadtreofrsoeearao0hecuaolt(w.alopom’getirntsetimsfnoldwshofraeteadluoliet.raspereslpszenmeutlal.daltr-alhotiarrnssctrs.ouestia.seendtghstctwpvutodereedtingeteaurd1.re,geireyenrd.0cStWADtolredr).ilERotTeuhI.o’NTEuusfauHAaESfdcencuI?nEneNsrnPee.CdodegpsTyOtiH.tTomtlh.VoaEhssHEeugRRra.peERahtrOCelrcOhhFetEietMeseaSeEesaMHtsd:aREd.NUI.tSBDToSEHDfEORDRaEEAFTERCNEOES
ble Spacemotewpinaenceretstiroo.hnHneoibfnimnesntppfoateoronndirrolnurteroeeveoocotevdiwtfatdenuueueailrnotnrnycnnbecefgnseptioydariiarlsrntnmeyoiasvwnydtgf,eeepeeignwlacvdaig.rontniheofCsleigsdtrdrtohrtertlfeeearoh’amisaunsracmatsiedbcntetipeaoittisvdnssnelpunei,ndegthigrebtsypeheeoniyadtgtaatlymfsaesrpror.stoeaoftieArsnoemhsbmosdsnnc.epev)e,tlasprbwieiinbiodetsbuhnitnlaipalisenrtersdm,rnlyogsehs.tittonooneapaHscekgdvsahataapeeicftreivfrnhbneeeitlieoypanhbaaisddvnsegere.ewogHtwpgfauoroiaerhlevtnddororaisendetletaaisegofdrnaeecnaauddnthndceasetdefshfeiebnbeaonldegsesweiinbernseglielpmwsdhsasoofhpcdim.aroiecefeieaes’sdrbey
most important and effective steps one can take to protect
thbeeartewa ebeetnweaenbua rstnruinctgursetarnudcatnuornecoamnidngwwilidldlfairne d(orvbeegtweeteantiaobnu)rnwinhgere
STEP THREE: IS THERE A CONTINUOUS STEP THREE: IS THER
DENSE COVER OF SHRUBS OR TREES PRESENT DENSE COVER OF SHRUBS OR
WITHIN THE RECOMMENDED D
AREA?
Sometimes wildland plants can occur as an
rupted layer of vegetation as opposed to being
widely spaced individual plants. The more con
Firebrands (Sparks or Embers)WITHIN THE RECOMMENDED DEFENSIBLE SPACE
AREA?
snatndrudvcehtguoremetaeatsniodfBrneofa)omnrwe ohcnaectraeosmntrdpeeaioctiknoapgrbhwyicivlwdefiglidreeftia(roeti.roDbneehftewansesbeibenAleefatnesbrmpuaorcndeipoinndfsiainsgdeplantsddpeactiko shrubs and landscaping and dense the vegetation, the greater the wildfi
gravel If this situation is present within your defensibl
(no plants) area, you should “break-it-up” by providing a s
between plants or small groups of plants.
WildfireRtehprleacaetethnesdrhaowimngeosnipnagthe r5eweithwtahiyssd:rdawirinegc.t contact by flames, radiated heat,
and firebrands (burning embers). More homes burn due to firebrands than
s intensity and ability to spread. Having a defensible space due to any other cause. When fire conditions are right, firebrands can be lofted
omes, it also helps protect those who are defending homesgravel by
ss and egress. (no plants) high intIon bthroeadalieraaf envdertgrreaennsspeoctrioten dthemfoonrtesiztehavanrieas.mItinleeefdrsotmo btehceonmsisateinnt.fire. Firebrands
also canSbtaertincgarorniepdagbe y33wind and fire whirls. If firebrands land in easily ignitable
plants and landscaping materials such as dried grass, fallen leaves, wood shake roofs, leaf- or needle-filled
ifggirunetbitteiroarsnn,dapson. teewnStDfiiaErTNel oESeEnaPCsaiOnlTyVdHEcRiamRnOmFsEteSaEHdr:tRi.aUIHStBeToSHlymEORaReEdAoTjaRwCcEOEneSNneTtrPIsNRtoEcUSaOtEnhUNeSTtahkoemarwceuitpdtiteoeoSldyonclmsapotyeaoetTmcirmeYrodbeefPsivdnaEwedtSugiilveidcOitnldaeatucFniaootdlDnhppmaEllesaaAinnonttDpssgp.coVaTsnheEdeoGcmtcoE
LHHaoonmmdeesIcgIagnpintieiotniZoZononnZeeosanndeLaannddscape ZonFeisrebFrBiaruenbilrddanisnds(gS(SMppaaartkreskroisar ElosmrbeErms) bers)ies Wildfire Fuel EcologyslyingonWildfire Fuel Species Wildfire Fuel Ecology
The Home Ignition Zone begins at the home and extends outubs,leaves, and denDseEtAheDveFgeUtaEtioLn,TthYe PgrEeater the
If this situation is present within your de
s can area, ySouTAshNouDlIdN“GbreDakE-AitD-upT”RbEyEprovid
as far as 100 to 200 feet depending on the characteristics ofWildfire threatens homes in three ways: direct contact by flames, radiated heat,can between plants or small groups of plants
Wildfire threatens homes in three ways: direct contact byswhere
adjacent lands. Maintaining the Home Ignition Zone lean, cleanand firebrands (burning embers). More homes burn due to firebrands thanopies.
flames, radiated heat, and firebrands (burning embers). Morerywhen
and green reduces ignition risk and the fire spread potential.due to any other cause. When fire conditions are right, firebrands can be loftedng
homes burn due to firebrands than due to any other cause.urface
Within the Home Ignition Zone, a fire-resistant landscape can When fire conditions are right, firebrands can be lofted highahlisgohcianntobtehceaarirrieadndbytrwaninsdpoarnteddfimreowrehitrhlsa.nIfafirmebilerafnrodms lathnedminaeinasfiilrye.igFnirietabbralendser
be created by reducing flammable fuels. These Landscapeels.
into the air and transported more than a mile from the mainmaterials such as dried grass, fallen leaves, wood shake roofs, leaf- or needle-filledderfuels,
The flammability of individual trees Taewhnviiedtshrgifsulroeebwelesencvranamuersioeeedissmltdeusoerepsatercennoedmneitnoedpgrnoleentod-,flsnleeaaasnwmdpvhpmeelaacdanittabs llleypatio The most important thing you can do is create WITHIN THE RECOMMENDED DEFENSIBLE SPACE
type they are. In general, trees with dsduievrfiredoneussndihbrdeulbefisneasgnndpslyaaibnocdlsueecar,psiohnpgroaamceesa.infWetotiyldtwzfioroenzeeox, nipmeemsr:tesdiately AREA?
than broadleaved deciduous trees.
evergreens typically (1) have leaves 1. The Intensive Zone, 0-30 ft around buildings.
2. ThegEraxvteelnsive Zone, 30-100 ft around buildings.
(no plants)
Most Firewise work should be concentrated in the intensive zone,
with work proceeding outwards into the larger extensive zone. There
The Home Ignition AZoftneer begins at the home and extends out as far as 100 to 200during drought, and (2) have sap containing flammable resins.
deck ReplacTehtheehdormaweindgesoingnp,algoeca5tiwointh, cthoinssdtrrauwctiniogn. materials, and access aDllOiWnfNluDeEnAcDeTiRtsEE
In northeastern Minnesota, the two most flammable tree species
feet depending on the characteristics of adjacent lands. Maintaining the Homeare balsam fir and black spruce (see table below). Jack pine and
Ignition Zone lean, clean and green reduces ignition risk and the fire spreadand white cedar (arbor vitae) are somewhat less flammable. survivability during a wildland fire. The most exposed portion of your home
white spruce are also quite flammable, while white pine, red pine,
potential. Within the Home Ignit n Zone, fire-resistant landscape can begravel is the roof. A Class A roofing offers fire re istance and greatly improves the
In broaldiklelaihf eovoedrgorfetehnessetcrtuiocntuthreesfuonrvt isviiznegva rwieisld. lIat nedefdirse.toThbe ucosensoisftfeirnet.-resistant
created by reducing flam(nmo plaantbs) le fuels. These Laanredsixsbcasaicpsteeps tZo corenatinegsa wwell-imthaniangedtdhefeensiHbleospmace:e building materials such as cement board siding, dual-pane windDoEAwDs,SbHoRUxeBSd in
Ignition ZDoenfeensciabnlebSepaucseedZownhees nplasntes alned lacndtsicanpingg fire-res1ci.rsTohwtinna,)Pnorrutrneemvuopevetogco10enifftter(abtruteteinoso. Mtnmakoeirensuthreafnicrr1o/ew3 no-sfplaivrreeoatne
environments. Startingeaovnepsa, agned33metal screen (1/8” or less) covering vents reduces the probability of
least 10 feet apart (intensive zone suggestion is at least 20 ignition of one’s home. Make sure decks and fencing are in goodWDRrIILeEDpDFaLGOirRWaAnESRSdSESfrAeeND
osorhietfoshpkcuealtsurroeatf!tyltCaeormoufaenrmnnshdicadoebdemslereaebtinh.tredieSsm.eduReseseecwmmkowsaefDSyfwmmTrEAso.TAfbeeNmiYrrteDDeavPrIyw,leNEFoigSGfUaiusaiOseEtDrtreF.LiEhoessADorTcaDgaEemYtnAptTfPaRdeoDtEcE.oroEVhLrataEedohwGddfeEnfirtitTornifAeouyoTbnronInraOua-ilftNnrlisRRuanpehdaEmArmfcoseooCeNvu,maOearDdrmsnaeMalaeeldR.asb,cDtEMat(BDDpolnOtiCeREEdEoorEOiNiAAAaTnsmnAsNgDDMtNYeTpdiaaDDHoCeNNMaPabtaHEEnerdEEnoEEDEtEEsFGrtrNSuSDDieioRUaane,LLtPDsfOnlEEOcCsfEREyrSSUdrOoDtFeoL,,mANNoaLLuwPCDDEEEsTirAAtRS)TehEYiVVIAndACEEtCPhSSEeDT,,EdIeCVfeE
feet between crowns or 30 feet between clusters of trees)
Zones within the Home Ignition Zone can be used whenassive
fire. Firebrands also can be carried by wind and fire whirls.gutters, a new fire easily can start. Home owners can take action to reduce thenedfor
Landscape Zone 1: 0-5 feet if the structure has on2. Reem-hoveoaull urndfelrsatomry laedd-err feueslsi(ssmtaallnbatlsasmi)ding
nition Zone andselecting fire-resistant vegetation in fire-prone environments. If firebrands land in easily ignitable materials such as driedfigirnebitiroanndpso. tential on and immediately adjacent to the home to combat incoming58t,the
and
tial
OgoRa0l -i1s 0tofeperteivfetnhteigstnruitciotunrseohnaosrnnoena-rflaamsteru-rcets(43ut..hiRCisrcerkeemtapao.tievnneenaontnned-escdmoilemidnsb,imudiseniztaeibdgsleub.rbrfaaoIncrncdeheferustse)ahlsroiusndzthoe ne, the
pe Zones Building MaterialsZone begins at the home and extends out as far as 100 to 200hnvitiedtashrigifnsulroienebweglesencfvrlaanamuemrsioeeemdissmaltdeubsoerlepesatercrenenoesdmnienitnoedsgrn.leeto-,flnleeauuuaswmpvhmeeacdPPUaita1bll0s0laalleyf3et.0nnft.ott EnnfIxintlrtoeeynenssit-viivernreeeZZoooesnnreiseddTsgsuhietovareafirerndonmnesiutcshond13i0b0p0smdreffttlt.uel.finaeiumbsgnnplspsctya.iosbhocrluew.etar(,sRniohpttrouhatambchh7e0iesbnftia..iggenfWethryotoimylmdtuwzfuiocrooelaniczsneehotx,dunipmioesreb65m.ea.sriWMnss:teeaascooctindefortrtayieaaoinnnauatdyrtetocbkeeueulcyreilnddpeiengtfgpera.sns.sts(i3bamletoobsw5pleafedtcfesrhofeomvoretbrr(yu1-iyl2ude”ian)srg)e.) Remove all doBwRnAdeNadCtHreEesSw, iAthiNn tDhe TdWefeInGsibSle sp
building materials and conDsOtrWuNctDioEnADstTaRnEdE ards.
area if they hSa(TOveATrHeNcEeDnRtlyITNfHalGlAenNaDnOdENaAreDTnHotTEyReGtEeRmEOb
into the ground. Downed trees that are embedded
soil and which cannot be removed without soil distu
should be lefDtFinOIRpEWlaWceN.OROeDmDoEvAAe NaDllDeTxOpRoTsEeHdEEbRranch
SSTTEEPPTTHHRREEEE:: llRaaennmddsesccmaabppeeer..: “Lean, clean, and green” are the essentials to a fire-resistantDWAERDAWINTEERHAISNTEI?EHANSI?ECNTOCHTOVEHEVERREERROCEOOCFOMFSMMHSMHRENRUEISNUBDISTBDSEHTSDEHEODREODRREDREEAEFTAFETRCENRIabECfNOreEESeOttESSNhIawBSNI,i2BTesLPyTIeLPEs0NoRInEiNRutESUupE2SUSsPaOlSPhEaOAt0EAionUNoCUNutCSnsTESlTEBdoisr“NpbsmrreeCasarwaIaelrwaIkuflnrWufnni-epitdgdptitddhathteree,wdi-eSdiolSsdulsyedy&eoyuiopsnostnlmlpsmihasis”uastptpseyuiyeeueaSbnsaeateatottchicyirhtrhtmmyfeioeiAeoeooodpodupeefnfnvvrulssliidNvoveaenniriwwssgegevndd“dggeeiiiitppGbllvvedstteerrddraa.fiitteieeldtaldtaenSssaiaaitutuonoegeninkiaoannonnsdd-Tlalnti,nit,btpppptwtw-sahaEhlllulleseaasieaaieptpnntnnohRohsg”gttattpipsspirssnrrbnp.epa.eaccyaoyacoMayTtaTtsiotenseponheoehuerrurdeondOerootrcthmtvcdhmtcdoecoieeTuoeduofbwrrfbiwerreeenOneaieinailgsincsldsncsdiogRfaabiogfanibnlrpnisntelrpeieaSteurteniausotpetnncsuthptnapciuhphporanirhlVeoryancuartaeyaecuettscoateiresvI.ooe-trr.e-nrRfnltaTmexUmceaAsbwrrdsleeiiwrrdteLimpsvoeelitidlmpsevulpoatfNdlrecuvrsioaTbfNreegroicvieanbvreteiofiOnegaelanltotcfaannrgeansloeemtctaUrhlianseoemyteomrsholauxsn,ytaRmrsaobicaturo,bCuhaweseabamtnlresbhanoesseisyO.minltteinaveinhesvdyaninieetenrFvmteogpdtaetiieerstermuneesgptahoetremlaleHrueiueosssalttrre.moplialoefoossuetprOArh.onpiuosofolpielrmaAgwshosnsoMsntihoiflomi,gewtostsl,tenyhthofidmdeEin.ttsl,teeoeyhtemcairpentStoohteenoaesmcdnerptylsroohrasoaisidbenebpapdylrlaseolleeeaisbbpsprd.nnl,eeleeeetaWdksrc.nnme,eehetheWdksaicpemsgetehnaehehssairrpeosgyitnaaeihslltrrosoyiaillt
Maintenance practices forAREA?
fire-reMMsaiasiitnnattenennt aalannncceedpspcrraaccptteiiccseessffoorrbaertewa,eyeonupslahnotusldor“bsmreaalkl-gitr-ouupp”sboyfpprloavnitdsi.ng a separation
between plants or small groups of plants.
to prevent excesvsievge seotilaetrioosinon.
EaarimarklsklssbsoeorrrsEE)mmbbeerrss)) fRoercSohmffRfrioiumerrreecbSeo--srrhnmeeardssumniiebssdedttsnaaSaSdnnmneettdpadllaaSalSlSnnmrmeCeaddpapoatssalialcnlcolrarCaiCanafpopteotieDnieornossisniifnsfeeDtrDarsisisnstctaaennsnohdkednatahetdgupdam-aeesrildthbfprutnerkal,ierlauuuoaynoeeanhdfotiacirmscmhnfrnerfosoectatoeteleeldoau,eifmcgaeywrsbosodmmstmsnoi,fntirtiiafsneeimondlhaooearebaf,caonnideeedstiiappcrolltnfi,edabloefootprorrryi-sios-owarefsmmnanrsiroioatolvpcedrefprsyiuaernalbeaebos,iuaabra.tinnsiddabinagserenrFthoteuottbstsenrnbiahauoeriiixcoidtaniacnenelnetdtmeehifnelcabctdhtsldlyayootderberiehteoftnamf-iloorsanetafeuneifetsilrde,nldeesgdd drF••••••••Ts•••e pohiscrreStStWTCMWRCPRtoehhaaheerlleapamaaoeeneraeppmikdretsaanwccmilaaiseamhoenntanontrrisrieinnwriiaagviciainnnnwsunnditgtir egn nggiigdcdygi/nnrit gtgW na ed horu ggub t opt“ebdpe irrebspoLeoaaejee nhreaelnnfdnuadasrcsnasd cisund tdtnEdaehahiybt vefna,nr sep euaseobCt dtsv nriefhrolpun oeoedgilaofrspsgrpfauelr tts ooa aneishi mtzcnneutr rtoaaelednartsynlner altshlol seydtdectrc feada u i soaGnpslpoblbnrpiylreen aieteho fsghmnleaeesooerttniiwaw gns ttl”sie hrih.ng plemadett eaoeslyaaasctfn n,iena tyantd•• • •rdhhbnat erseerecf etinSUcWPdnetrerelpeowre saoeeiwu.sit acnpseceninoaceemlecndgoiisms ennneti tteson o hseggmaestsng hetr stte lo ttehltoyinerhfc e tudarissaonehclsenaopomttden pu tr3oidowsgger0fee.vha ti apSscfoent e epas oilre rhceaetaft hcrddmt tuiaeihudfoiburicceerno le archsu nhhtfenhud ridegeu lhbsMMlBMa•• uaauniiildlnncdstthieecneanngspaaMnneccsaeetepriraalcstices for fire-resistant RS•••••••••••••h ercuobmsmanedndSemdaSlleCpoanraifteiorsn Distances forMwwUEdoAeHAORDaRNgnufDDsoSeEEPrbaeOAFCMUrchLCAOs)OyitoiEEyBAOcRsirSeicshtmSotEotEcAeNeaESeTEOeSSSs,,tlEoaoDULLhohro)rFtTkOwnsADnsEMBwosHNeAUNeLeaoODaRtsNrlOCoNDSeEESdoreFrMvrr.chLTcCARia,,yii:tDEEycs:NarSishnRmRlsRwaaRdiriasRaRcRsaOfiSoeSzEDtedtbNeNTaEanSEgeaSSdsennvErrDoUhoErpohTkOEenesAuEsiMLLhmNwdmeeeeesHNNeYbnrirteUoaodehDaAatrhOtcIetsDsnSdlooreeDvoarlTciaRa,,tnSoieBEEiaEmmmmdAdO:AEnDEosm:NalnRtimedhposBetTzDwEDvsedtNcngtaaadffjoummlCTagOAPcriTywTscLMaadiousafoRsftgwllaMrusTvriDdNciaPErvucuAAEeeTEvinLLhmSN)admNenieaaYRfrUooooadeearhTSaocRstAde,oCrE.tioorhlii.aIeaDTsWlkhoNDheaiiaiclecHweolabnccdootnSdffaahhhireueBEEndOAsEsrribernEoonrvvvvnimDVVdmHedposBtTonnDuwaEDiidstIfaiwntecedaEaaIrfHcejowsgT,i.l.ccoNeaiaPesneervnralEtOreeeeaAAOdgrgrTSntcSut)lwmnnjodRcgifaeeetcmgarfTSRsaedo,bnrEdd.odityoatniDiDiTEnWrEEalcddRtIiidHgVwhEttehlantnehLvtrntikkhtislDgeeyonb-nnciEwnrtimrwDaIabacVVaDRHaeereo)aaaaGehED.dratovgIuiwoaehwicoadEIHcenreeE.nfSSsoosolfeufs.enrernEecrOistnrttmphrssSehteenWPbMeE,sisrRmssageinfaallllsatEoandeorigithieoeGneseioEoncepEEycnRrIuclllldVnhhdElttchndnoeditiLeotgAstrrdFiSRDeehfT,,Eos.eeccrgoamRirrh“caaerwG,sn.nra.goduoi.tbomnrckauweennvaGdddsEnfiSSfsEf-ciiee,lderatriyilasdxiRnatnettoohdEfR,sedRciocsaseinidisIsSEaatedednffictauenCGaannserdenteNlen,esftoeeumrdEMdvboedaom,sstoArottFaidlSdhybhaETe,,eeyosuWDDSDDD(DB(CBFs.ss5isrgmrc(poaarsend.,iOkatoOidiEmciwo.ivbGbaaelcwinEcneippasdnndtrrntrOOtoxEtgfRaSnan1dntafsvdnRnirrerdlCussnirmmIIeunhvlydfl,aosCT.ennicdfeOaNRRoetfleacddidaseOEEREl,uSdtsuoesnnaNtaerfuaITrdbieEi/oRtnge”ssnsefopgeielEUepRetierltrnaisOBtm.OyeEgrrrEAeubt“IppbeicetneeiOnnnnuaeiidNTeciniEofSAAAtdadenieaf8repteoltcDntrsAAArT,arIhoeL.eslalinsnleruouerrnnanTlneiimterhilLEMo.durPecrdliaW.stetdudSttNcANooIasTschoio.luEisaHshneaetoIflrNentaoUsfcrgyemhNftrfEgg:eBDgerxnorywaonfhitmarsaesnNe”dn-adRenuPDDDeneiMhdnigToWncldeoveayNNtaeTabcfYrutnthcrAteeTe,irhodnDtgafof,oeeveorLocowrf“PedTmi.sucaDort.BeSepnvNtuetpE,EsioeuieslSveddDetUIentFroasooanNolhtfeEefDuifnwIolsgtnhylaornDidakavltrrLetNdsdReben-hscnnlvSTeodeHrddaehssedrtaacnTuPbnapCCPhihp.sRueertinegdNNOSodU)gOeagooLvfwpMOdeemnnyobrbncDrluorestpieGssEicdoEbasildSrfteU-maAeneIrawaanao(eIatnashonkgessreedlko,eOsgdalttdilHHireaope-fdsnHEEeSddscrn“amNeEUtmNfhtRynb,afPohfpprdenDttjSrldfuOe)gOCnhdgatNEEeiFarnemnorOiTipknatutplvbeanbimsrRdeEeaheelsaa,tm-aAeeeivninpdLRssiRrwsaiRaaRRlfscOaaRwelvleneSEdareteombspbdrrerSTrlaEouetbDlEEailefmounnreWrorufRsEEdrdoToaeUbtNhoyatncohpHbGrwenoEfGplsumdreratedreeeeeuieeUbtrnibtroanCnou,tNehac’sdrfdteednereoothakoahmatcArdeateresro,ldiDntrackNeolseesan,oSSiciatramotiearRciafRuissdOLaRasRlRRwsaDDIoctduSasEdmmmmAamsesniblaAoearerimTUlaarEuumahlshteuwhcnnre,sumhwvosoonatsusafiorcyulnsnohpcraytaaoABndfcOouRusuerolplhmedseeeeelceeewtirrbnerrrtanefoonuckhuedofsieewctofsevEeaeteasaheptctfieEenretctSooooasdilont,,eroconteeooicCevaewohioacapcitDtrLLln.un)oceitaaEdmmmmesA,elenehPrnDoihoNosuheoaiecrtmDfd-oesBmanlclsbtdeeoiahprcesAdmwhsvesivLbonnrOsflccivvvvralaalgnRedftiuNurouohinoohdvciatc,ueraffiou,eucdunSeisEEeagmecowfemvdgFee,ed.hglnaawwLaldCAep,ieitrel,ecteooooaoocnytterrloOweeeeaccrdhtCefltllstrErEln.ppucuealtbgaerevflhfbotfeSlhoeetNaraeatecbwdt-edhedtysiRdeoiatnElDdsaeus)rirbnNnahSetoshairyvvvvlSSdlieghdmhEnrnmhetoooeaabeasugessUtllgfiu,ewniodeimdTsreefrionrwaaIibaOemrswfsehDmgc,n.eglA)aaaaaeshov,soaneweNntypseOweeeeard.faaairroru,nifanDlitsfanteiseoreeufgllr.ebofaesnipttsOinrb,rtDrddteiyMsDtfSot.nnsieDamfos.tolfterstiaietnTdttlllliraRod,,aaenadnnmgroimuihtenernemhutevtpoAoigeasDpotmwy.eohomrcullllwhmhsrhlNrtnorwaaIbadwditlDb”gensdt)aaaadtelhehRaooonogewlhDeiottgmnsieiNem,ntih“tfapawstoteteenuif.Dsre.ieyelDetanasirbttknirrutwernfpsEeidddsrMieibhtonaiafamofsEdelbooirssnTinelErs,llllrLLasnoNaenardwioseosiiabcahYedfafs,edacisobehixnpeywimodAiculllloeSuh.alttotdudirtltwadogsnnadndsnl,dehRatooapliet.ee,rcdsPhsooeeCeeeeEoMetdvdDa.dhh“aetioarwsilan.soyehstateyiBeEEetaycrbuDD(DDDSWDBC(BFokOsyuAlEpernemnhEddsdideibetiantreapo.afpceccelcadrhbrdulmoaidls,langioiroe.Tiiaachwdyfs,lewkfdaccifasaaesonneidinrOOeootSinrtanaTtdsTwtManunfovnsennasfsniNdeltClieP,londslm,oeeoeieehdieIoEaManvdtAAedaydbatsllTooeR.elicSdsfaO)boyslThsaRRotepeeiaoRydduDDD(DSWDDBCB(Fsgis.sOEEREduaieTdnnafioaiR,poecnpesoneerahnpcedcvdtlrRetpgeo”idldcndpi.dpinraanDnohETglwWrRcuecer,asusofannsdrmOOoyetnse,grnaEngAemutIdppsnenfrvrctnanuffieOnolCynnirlm-,deNTdhelIiahnsnimybiAAAneIaslToec.VVeiocaadicHfOeasRRoDspidaE-euDeAAoddIwanrInoeIcsL.slseEROEEaoandurieentfhoaoiirterAanTlgEmtndlsHEfMeotfsRdutpgb”emindlrmsnpWrtnannisparetdloodE(orRAeofortascrheatttumEyeifaHtsgrhErveASeahudIpprNertnaoeOirranmhdNoiyvtnirrgc-cdpoaCNTuDiais.onitwbpashaAAAktomordesoamhaedtsdtateDspDDD-eAAoenwMnrrIieEL.dusldoWnabEEnspnreeovtrIeyNNotanVTllrumtmvclYrEEMepefsdunemcdclotmneWtaodnnDacetostediroote,oseAo,asrecrhoECsyauwEeoittaHsfhoedaTpkrnreaNvduhcsaoeidrBereGgmshyNoivyuetteEegegdvnsiDeengiknodiwvtedDhtomitebnseFuasudoNdsaeSSeDDDEaeefDenifnMsoiRsoWonernlnrasovtDlribayNNootavletvcYrn.punfebcxlteciae.encdosdsfDclefvdedbHeroRdb,-ocosesetirnnewuooPnbCCsa,lwii,.sffEdTpRreeteuocorsaooiNNSsrBeeGrgodvTUeyuetuELtvifwipeMOeteee.n.vediDdairneiobobFun,doelsuuNesiGalfoDsnfnanoncseeSoerntlrbahrdeDl1tfabatbaesavIr,,vato.tewabeardbia(aaeeaesacnleavsdHdbogsaensserdinrpadnldoaPni,bOCCasal,diutdHHi.grsmtoseRiedniHEEeidNNSGa“npnmNEdUirClawIuLlRvyfnwpMOeootfeegrdanlnoeDbineS,oteefsnenseigrGns5ldeaaaeaeEEeRlcisetanbchFrufttssrInnrrOriTiaspFn.twiaaalib(edtadebmlnisrstner“Rspgeednsiagredldhoaosiee,bOCalrtdHHireewolvleEtdatiHEEemerdteote“nnmNErdnpaditlcRaStyronsnouoblueDglEEsrgofmdtotnbsDriWoRStEEtdfrsTtnedegronwfrscdaeaseaEEtteHGnrd-rfEFGehblpnlenrmOdiTirpFnseratnisnblUObratebnmEsrdtiRdreanarfceuatuhhoeebdvanrieaosefmarowArlv,leeeEtssldDsettaeknNhspdEnnuSSyaSarep.obteobuDulEEohtofmtepDDgItbsdrlWieraRtrEEmdsricpsTteseilaAoieaifatceiHioUaGwrfEkGenhloentxmcdlroererastpeneiboUt,tdotinsneireeuliannpndracenAB”dnelOoRteasohraceaefnmaislAreerTernarldcDcntnkaeeekNheiiebsnweHanSSaoaheEaetaousogueDDImdiEedUenl”raSpmsilisa,,ngrilaAeaeoeisoioUvaaowoo.eschmanDpLLtnnonxdcfoitemccutonePr.tDiscedersulsspndDd-stBBAhcutdnOaobRteddihtesAanadiltletLirfaamdnrocOcnnkceaeioenwalegReieuENeaneAteshinhddmvcilEienlt,ueSfuslha,,nocerbdsSpeaEEabogcnvaweooPedFtcreuctDLLtnnLddabeCAioiottemrmnemPrDtireesmDhNdt-oohlBdiehaentirsbkErEtppcsisAbdneullhfhLtlfeSriOtadclatcwsl-gRoeheurNen,RgtiheinanhEvullienhtda,ue)odNahySeyaoacasbdtradSaEESSbgeyihdF,celtEorLdeoCAtiwoertstuUlladaat”,rerebidTrehtiOhlcyscstmneErErTAppesougvbseanlcurhfstneSoNdsnstaesdtlatwsaah-ttiheuefiRnDiiieEulrltdat)eNaahySeeoaasrpsOSS,yihihDancEDDhlS.edoteenieieoeeiseetudtdlofUelletaatedbf,uTeeortbTRo,,tiOdnnnmsssnnetAavldovtspfanArDN.seosrioobhaeaohNnmiIinewfueifinDi”-iiterllnnloelgteroDisspsOt,nDNbetotDrhtS.ptntteetetlfofenetatefDT.otsasRak,,tdnnmcweepnltEao-rcinhltttopnrAaDEdab.eptouaOssriTfEchfLLh)eNmfaNwefrv”-iuaYd,nsoblghxnoDiiatatfAlneeeoNdbettogttrrtrwipttetbap..DermPshasaCewoetlpDEwicinhhttosraidafsEdeabetassTiniEgBhefEELLdcNerrOyAtEpr)eaurhYEauenssuh.bhxnievaibAyleeseaoaesstygiorwTiyrekflap.i.oefrmPheCeoecetriDaiaarlhTTtrdsieafseefNPirBeEEcNoeOyAtEo,pr)detadhAAEettn.RSsal)brlTapeaosR-fgiosdiTeeinynTedknfiRpeees,eehttessaelenreeoimacadrlRaROassaRRaRwscsLduraiiRfaTTddsDesehTgNWiPewcasusoesso,odtnadAAe,teigtnRebriSuslnnu)lTrypeoRrisadoidlnosmTdniRohcpipeeeeehicVVhsHeutocnddEpeDeIadeeeeemoIcmD-erhoTgrrbntieWthaieogArdsuElenoHsfonbne,eltegrtusorbdraaamuh(cttuiotrestltnunrmfomteiSeeeenocVVcsdiHaatedhdvEeDenaIocpooIacClaaeEmdmmm.Ao.thbtphanshgnAe.wEnenHfoombmrtlrtraeslredtanEnodh(EEnedbodIavVutmtcElufacenSnehatdaacdydofniaorutduvrnilcrpoaCdECcum.ettrbtpshoineeaucumhteoGrtRygpaivesEddsrsaEEnbdepreIhrVtubmeooooEeubaenolsSStEtcascoCeRiortitrrilr.EmCeunnadaettueoorlan..ealhhdosNfefheaGbcoRyc-ieeidsewsdedlkaicrhnEtbteheessiorubnorsGrSSEsTfsvvvvRsws(beeniiirlbngudelfll,.dsoffoefnnbeeReSncretirefdie1awerww,,lg,i.wrrdtlEHbedtaelof,aoralrd3GdrrTlndrnOeeeeae(adieedinugrminblndleooGgoialenIneeeefSeiteeodoeffe1abwem,,aloeddtbdyisemanlrtima53DepoRlmisrrltrnncakssituidsgm0siaogdheGri“nehtinleIlnmpsgeeoseeofCweleelraraaaetimntoD5oedei)naaaartRclehiseouFrttnlcvuptsstgwneso0saeonmdsuenwaf“cattrabeoawFTrprhfeorebsCr.ehsedlsOieratiemEtdttordfitcunotMhucvguniedmsroperifestesefollllwfcoaaanooematnaEucmoorfsirbeboenNcupeswlleosOedere.pEwydof,heceicullllffhuwsoNhltfhddiecvoniesalrgestronpeeseftoRosdnsereniEua.odncnbeeoaervprael“drdeiTpRndi.eetsiaibtdaafoobonekrosulruenebnvpeUeettpsdddrooniebTdeaasnrinldeurhgsann-lslnmerasencneoTtu.oeehtbdfiisoisbraeenasctlctADeedudhtedUidptacastemaneotucheacmsanaesiesangdeAntant,dccntstoeenu.eehlEohrMvespeasteccteroddcttlabeoiohraaenotnchohufareisNideeAirddtcnnxneauchdhsedmp!scidagcontir.,p.mhibeaaeata:ltvanhwacelehrmaasmNlndeeairlro.taltdannbdhenf-vang”ihecCdeocrstyc,alaneafThenhCocucyasarti.aedcettdflashaecoitoddta”ebmebndynecsiasgerTeoDegucuieSetergmdd”em.tnfepettzeeebsitmonRelrsabemoioagrEeIDepheeihnasetauddOelhclserdFr•Ts••••••••••rerdsomiabllaexttnecaooi.eIbriDpteityr-ieltrulsrnyrrnFrd••T•s••••••••asuOrnlpm)m(arhsdubpedllwmts.neideevurl os-ocasn.ordokpOahee,a)eurNato,lomstihmclelgi krl,noweimta,pmysadewdaseeoenrMerushnasyeoveaytteicrbi.ehkeceodaiscre,tNehoetrwstwuaod,tteeegr,svbeoscahraieeNnn.vyosdeeeodhewLasadfRRcRaRssaOaiisRlruRsWtWSRCCMRPStTeSdiefrsmoolrriDtateemnnnrrRiRRdasRaswiaRssLualfOacRbiteCWMWRCTSPRSttooasclevooidocphdeseirntdnutpeci.iseeeeenrrertnbirsfmooiolaneeohhshcopfwpMgfsatuhctpadbtveeeeeaoasnmtrirbn,ndoesrtoyoceenesohcohmiaheteeohratfoheraEmmdmmtcAaillethayannsaan(rotmieeyocaplitahetahehleoo,msraavlEmmmmmdfA.telleinheanoncvsedaoaamEedsfempumvdlutalRhyaadonecmoeeevrdioneucudcnaaafoearafveuonudaaeaaepdoecrtdseeooooeilnucutnpnipCeerelaevbemrtrla.imieepekaaooooseleeheoNdlsrhetaapcprwCeedleEmdurertla.emieukapdssienabrnlohoNdsbhDealcvvvvfsegpsatatdresaeotaaneessiswsbtnfrssnvvvvrelefcctmedwtgerast,i.wrrdtlaanr,nrwmsfarrineceneOeeeeagdfccewgrn,os.wrrdtlfblmalaerenae,eroegmniseinieekfuNOeeeeasdneebrtdadtlalyenaodtigsmiDshomesefarptetlbeieloadfadtgyhhhtiorintepmDhtnnhodrrtrlmpsgoeapntsirownlpngrertmhaadoriDnelhtnneeb)taaaahempshgeuFrtalnepppaewlownrearrtaemeDwafe)aaaarteehehFueartraFwiTlprrhwapsoeeolwomre.ieanehdltmsedietarsrstnrorFawiTprrhwavoweeMoirc.uehdlmsesipertireientreneeooPllllrrloaaDreoanaiMsoiisrunNcpmnsrnpbnrileoweeoollll.srwyoaardeooanoaicemlcullllfpoiiihNhilranrcNpdanceguanvglseoceiucywoRoeocecullllrhifthhNihsavloddiceaiueogacetgsfrvidbnoarRo“agoirRndiispd.osdeicataaeCoroivtbnnFbbpawFstrhhkrs“ueinnbnvRendreipsddd.esineethtploonwrsblsrkrssuuhrgruenlhbnvestebnddsdAneinthofuntepoanhwrdfsilsathtrsurhssgrcnlSeseehnDnehdnnrRotuidioEtulhadftimsitdaerrg)tcakihoDneseeaaesahrdresiihdeedietintat,tmirethrgoee akelEoenhrMaveseeesaiedeetioent,ho,rcrertleoe deoolEohhirMaoovserlseaeeeeinioPgoehumfreoscoovtlssandooohnaennxsel aoghuclfroedspsnndmoiggdidofigncinniixihe aps.iuvCcaagla:staesgdnwwdacidcegleascomadsyi,p.inDaara:gtrsoegtlcwddncenle.ansmdadeyeunfvnlnfeeitraotehtcnauiCtdnctaldaedpnmfv/hn)onihtcnuiCnyanrtncttarala,Ai.rrseii/huecbrd.oifoascSrciohryuhioarddwi.ecbdiffascbmcnedonesisddnooertoiebmd ndSentrgman”eenmstnnsnebggergtiiepteogttle Sebptrmgme”emtotRnepge.osWh teeabtebamemosRdgrewbEnerasWh ph,salebcneaesmh,utddotOgraeEneldacotb ph,e eTnaesaotuddmOinaelrhpxewdedithoagndomuriaaesehxhryxthDnpitoeinhySt lsrsgeehetu.slgrytniDprteyw srruebnltuc.slipmm(rynhmas.dubrrpePnltdhlpimhhmp(riCwmtsehncCWTtU3CSRMPRSStlWedeutbcupeedltondphwmttsmnnorceasshiauiedovosoicaashesea dourtNtatptrh)ahehtehasmser uiortNampt.getbhemslai,bmphnoawgetrxr“taetlgmi,sonrweaaeedstawedsmaseeeskorohenaefMdtwrdauseeebnaeeneMoveidarauyteipbfeneaticnrovbneahseytsfeecirctrbe heodaiu itthescmaoe0r,oodautpaiedircaeedrerehreo,maeotrlltweeRoesthtserobearpdlTwosttuebaottoseetegi,aeuvbyeaosottdseataeeghp,deavbiieepseaneahnh.vneisdeooeLndeoeoedehn.v:esdeeeieoicedoSdnheedmooipSnenlfsomgeohieoafsmlorrausDauosflnaartaDmne,ftreangtmabitereongpsbitclestsvojidscldevosjiedaiipprhioademnkdsenieaeeprnnetd msandi.ieaiseruie.icsisnCrfemiinlaurfmtdeilcaheesnsIweuefcswpMegmsetfwpuMgsthrtnpcdnbArvoandnebmvf,oaadfboroaensn)temy,dalsoecnsthnyesescsorynsesmiaovbnmwlde(hrnntfclehrntelnoftaeisnitauanga(faet(eefirtydirlydreaisbahdnlehno,leoaofarlc,mfpootaaeaClmiofnsoaateeinleoen..otvnseblpagduevhssegduEeedEeedeotsmemvdmftmavddaiatdlRdylRrnyenyhoeoererdasrndoneonndesedsfoannforaeunhimgoonondbd.aeaaernuggttcodtcsbdssontonpcninniiinpeerelaeleebbamCmrruttiiodtcnaaoeassrssddhpeedeeteeRssrranayedirrrweweddllnrreeldfEEmmouusuistdnunuohpdpedttbptenaenraere leo obbDlDslfscsfiegsaipstgEgspaiastadtasRwuslwiottndoteeneeesgisptssutssronrsosroiilurrelin ptm ldetmvideradts)tfierattehidsdernrcranraasanrbasrarercbireecctegllitgwenotsennbfomsaenreoubfmpeaeererennereonrenlTeshEdihnanekuNsEisk(tuNbn.seneeetatoreiebtaabned.egdsedhedlnahmsrshaamsoaptlneneiepltonalfrepetitlhioadfrehh1awhthpa.drtprgdlbosdrdprrayl,sopiryra1lespn3betrmtlpnadetemltt uebadreehlebdeuip,hpaiemllegrbenpapaevsillreaaevewafeeeeeelewheaafIrnsneeeenolggheatoemgoitfseanrolrgommideaenacfsnaWsdneeon,nadvswotkasfynon5ceiaae/v0wiaorl einirtcttRnerneosesiPrnrlonii,DrtnesssnetosPr0lsrraDrodeesrncrbsae“dirneo.srbedoSmlpeeog.ssrircderCocmldpuadeempir drceupcdutwuaetnnmhictoethhavuedeuaseue(othcihctthhfav%eudbaeseuaroacgotfolfdbidegera aagoubeoehCWiudtewcanunbCtt/cChorireierftedgneerhttlreahs essrneesphstthultbhAsendsdrhtthfet.tiyeurhfatebAsaeuthttsstthf.thieeehavresnRsathtetrissroeeoEflueehefcdars)nsReteiihovesEaluaraEhcdeaur e)bmsibhoeieoesggthaaritsohhepceeiinesiiethdituh,erennedesitieoiipigsesehfoi,noPoietdboooo.bviisslrfesDanshseeoipnoPigeesolooonvlsosfdanopnsmetoitaFifrbnnsolondilongCuvpglnlmrseiraFecifnrdewprnapossieosuCv,oglasDeuresncnwpvalbdsnno.ass“nsne,de aDyurlfaeeesetatelnantnn.nsfioeedsmllofe)uetnatetnanhtanrotste,Admsuar).tionnSorienhanrptohsotctw,Atdogu.ufr.tiohSeorioishneih.oonnotsowcrdkeleafdpshdndntsearnrinnebgaietLnoottlraeaoptdceotnthaneneb.gietthveientetatlsafepfdeowtbdhrrloc.tthe,tdohtttaarsefddmotbwbeyircspiTsrdlnch,tdosehtaberewdpiotagdbgenrspTansdchnhyuxehiiinhStewlpisagedhdeeguentiprsf(swhtafhyxahcinlibamianhStlmsas.eh.riPtihioriiCweeltccsieet,nudmhcaes.tenrriPatihiedhiivCeetsiacselssepteendhettncpror)ehitahtsgislelve,luresi.rbe shelatabehatt-ttpsrtl )”ehthgssh.tgieleg.aecsb heenekpaobhetfsdtoehtgieiaaeetsieetsenkonsosoesrfeate rtoeeiehrsimoaaeiroetanednircadnsoeaeswmaot rtRioterrihapdaslTmioashdtoeahendircaedsdtdiieyemotwdRao deatirrmeatpiedlThineshlteroneeoesteliieicydddo oudeaitnmelotgehhneEoueeoesuguredsfinacdne,fhtedzguoatnlgloghgapcssrusuonsfnaanne,ftezgepnetmdainegupeccssuonlurtadbntcenIueeprncetmedaiueuthercom csnAunfouubrrbdtcrlenIhuerscsryoseatvhbuwd(tht mculltAlonasfobrstur.lfghfcebseerysaaaovrlabrwasd(tslsbanatdlohaherpoaCtooulgf.tehblpaeeesa,orlareosaltasibatadreeeryh,poaeCrdoopnsla.ntblpaesesaaeueohimoltabri.tranurueetyhbtderdnsoanopncerinpraeuhimaCowuobrts.tanuodttcytnebaCthdatonopycdrsintplryosauCiwutdtsthdotdbpnttcyeenlealhtdCsnseagEydrestRlwlyotoeuriediphukstbpon naenlrurllenplmwtrtFsnesedas)gEfesseR,wltcastierearieiphhulshio naiuerllvtenhenpleopds)fmreoTosseitcnsasehh(b.areielhhloirii bbnn.eltboeedenlntorpoornnTnossenpstt(dbo.1iaewla.ioheordi bsybbnfd.ab,ledelna1rdehc3podtenctnesrencupdtted1sdea,gwmae.ibernecdsilyblgdeuaa,eeea1del3Irdteehctteereotfueeedr,meWbeencncdrsilkfe5aaee0oiaeloitltsRIsgn fntpieotfsah0eaoeergcaraWeee“cndknfe5Sae0eigabsloeiCdtteRdescemsas n dfntprdtwsthm0eatoonedcae(atceu“t%ubueSerguh siemCdideema admpwcdtwnnntttmce shtooerfodree(tcuhtash%hsuxspash ndhietirifeeuGrtuwhhcienntvtc sheosererfroeonrepfshelsahsslspstragEunetmsdhetbeeiorifephepcGuitphsideavtueerenroeneiteppfgestesfottslooantlErueodsemibmspgbeeeoouinmphepcoisttradeyntundneneitraacpegreifobhsetenoioreelrecnosrebbpdgeasannodanelmaeelostpitalnnefndulnohrahcateersebsieznsoyabrncencebosddclatnd.rataeesospni.ogtnecrfkeplodndsrrahniealseeiaotsrccyabeanonshvdicelt p.frtoEdisnie.oetpecrktesemdindasyircrisnsaayieaabioeteppceoncnhvieel taienafoddeehgellaestatneataomida yic.gssiswFurtneribeeph,ccenefcthectyeitdesehxeeeoawFTlprhrwastattllln,aaosr h.lisrat-uetlt”dt.ega,hncceftmheiyenspneestilleetesotllo,aesrllhncNapt-tltue”l.egledhcfhieootmceegchs.nedndhtlestlaees,yoolaooecoislodeearireRdeipedddlsooyoorsnitodeeplrriptmN(bttugrSnrcinfurnotliirnnawDhfreatarmonrtkatwseaeaet rtneiloihrgceydwoesrnsceeghr eeawotodot mxssepGsmlsgtuoreceonsocstp:”tspieeam lbtiddtpeatllihscue hartsptio”ihFttrwmlsuiee.boasncincgiaot e bmtwefhes eehhroohptrryelSromitohtwrtFmoeebma.rngaumshrebeerop iha,csehhuaespederleatoodmeeeortisnt:cmrnrttaeosnoh.hn tyecieauaeptd(srerhbfpepwmuaeraetucas.itcsngoldottaSoou amteiaseceohnmmstlelhyiheexaeiaenmecrsatwsoidruonraeua,Tmgfereisfhsanonepsesiaulmeicyhernxedhemattesonnrefopntte,easgharenanp asescioomdhlncSenwdtuienmh,mtdhperifsnernnasnncrit behoidegiir aadmlnpie”rtiofmtilssu,tsyeuanagshptieonadnoame tdantescneescodrmdaseFurtesirepdhrts••• • rirnyFawTprrhwayttdhlanasphchartbauemefldenntsregmhiestmdvdpbdrssieFutreornouaeionecNphleploe •••• erptsuooaFwTporrhwa icetdhldhgdehtdsneelsheue,ldnyoobeaisodehnieeairpabsieoeoenRddipsaraendscNpoolrusnrtleinduetopo cseteniepheeen1fsugeresnes,ayaonftsourrrtieescodrnsgsaafatsDrrhsrorecttatRamedip eikcyooetrearsnsrtinrbhreddeebpeeglohsriypdnesoesbbkuegrece0netrniienfenuaurgcSWUParherhecnwrdofdDhrxssestasymnr eehtckonpotpeecfr:ta)thireeetsaompeeildohrrcrrlydprooesdspcueeatttiiohseancurgUcSWPebchcnae.reuetppopdodeyanxsesuidlbsaafasccnerb%eechoepol:ntbmatpieaeheteadsmeorwarotntrRSremtde.,p.deeae eerbsmainhscfsurosolarsaharbomedptsroodrice,dcuwisueeolbereaisccmeeaoriwmuaobmtcptentrheseeoirwerothtearurStrmecttsn.chrygare etbsFmaupri(.auahsdhCabrbposepeiwomiataehtue, anesecuemneasdosamteeaohooiedwetmttona.ttbnctossmpnsdeerutrlctethsene.haymcrenriustwsap(.heehbwruipsmithnapiwmieh,tafrtuom eieaienchhnuneinpudomoumtniarooiPansaothseteocomtcepnssooeoltedlpolpcntitFee,eamsmeenarlsentwnsnaemotdheircuerncaSnwcinlen,ienfrmmesiosdhndenaiumaitgmrrntwron)nbritnaveeanrhteoio,rautcrieiotsSoodeopotetieri,iemishrsafmmilluanensesed)oudtnhgeaacnaeoSngwdnailoa etememdnetdscneedtoemnoeedgpirbnrndnrrit1nnedeoiooteenyieesdtnmshcrhhiiwriiaiudmefienoswmm iluhseuguatnsSstenssmsdvhuegnainodciioa emeed0mnstasconeeiiorsomitcnsoeitgddtndsdlsnn iaelsnevweosseinynhttihsgscheio hesaumefdnbeehsna hedsseggo%gtmuvhctstaeccmsuvdaesotenlepeenftstisioseacastodeieettnonsigsaoregdstnodsrceilahss tlgndiaeoorthctmronsorbtiredeadbgsnod hesrndespegsbraeyeeedsdggnmeae utaauhioenleeotn eheieeatsruostnltaastohtrapdtestr iufresfgsn)aheafssoprcdnrryeltoghpprsiuotrttoasrbteespedbecet.bdgsikanoeuuptpnlsgabeeeueebcmafne eahtnheuoln a mchbee ldoonra ntthRseetstrptrvb o nwderfrn)slehoaestelsrtpsdrrdgsrlhldpnrretsldgwoseotrtboammbteerbcr.hyoaulaueptapclanapeeietheaotbafsecteehyhicpnereolars ae libedaiuoaeaCgh eontR.redteneeehrrnfscsaomstdelnrohordtaedsrwath.ldcrteo ttdcrswoeodremtdrlrytltsacyruoaeiicsseaeehehup thaithscttageicimtniearuwnhutneeoauusCoiPorrdopstaeeo)irsneiehsooflaaasdaspmnsiyroFhoidtsrhsatuCv.cesebt nnntataspeirtchhsltbon.screhilosbnaanheeb e aetnmirth)bnvetanrtmipe,nunuhruioSeoan.iodeoPiohedbe1oswtahcnoelortieedtuoonelahdsnpengeiFheabslentcssilvCufeaseenteaasdibrrntrc1lderondsaotoeeeenadffnoaha0ehianmpwitgd)bRnveannrnthhd,lhinuSriosehSeoeoiaeamciShe0mtgsaehtcnoliirsedcsnpdautwetsnndesgedaileetev(wtsr%5setetothigsdbritnr1bhendnnhtac%otoeheteerc dnahshaohhhbpsppwiftgdgtnihuetireh leihientSsnnsih osirtreeihmcsigt0mtsaeoiarhrctmoiirsomsbtrcesadtndhect3irdieeeevoytuwidrsyesneatahgt9neeohogseteoeiebheeuotnnlhh%ohtsstrcdu efnaasdoutfopwfttcargihpsussgge oeioetcnnnd epertdrtdakaeuightsltnfraueorirbhcrmlocmouottbreuadmcbt3brorooydi0bhdseeastvbfwdneni.oeoteseolrkeaeinsgnuoatneleohrlessrbdueefmnahevreofholfw.larghpspvsigegoetetaoimieyshhseppearermtsdkaeuepbl aeghounrcbc.mubuitutiruoelmccsnoraaraw0.hsseets scavbfwddtsldrclaltsapyougiy(Seeehupeerlssbstecm,agerirrhowsfolete.la-ttltppvu.isoootrsainpen)yhhspearssataesb yiaehghuo.eubtnthpioscinb.rhahwoba neet bceetardv edrplpltgnapyouiaa.Seidhuposbss1csagie wufotee,puhebsenocsilorfeanppein)issoiattasdyrihhhleebftfnoa0epinastRsnnb.dheheoeb nabe etrrSrhg eeppcedptndpdtwaa.isado.(ttbr%1estte iguefitt,henbnentccsilefearehhahbspafogitnhetridrFohliersfferoa0feeiatRtnn dhemseeehhcoeaci ertuSryrhgeneetcaphedgodeodtpdtwdesaermu(t%ostetdtuniitcartsnnot cecntadrhedhahabgspatfgnnhfrletrirlouhbhieisbrerbeaodbtta ni.moseerekehhicnecsitnaetucoryerentahhgddufhveoetsdferemeteefmoistss.mdunoepncartnscoe hbiunctdrehldseiagaatn.frbslousruiTbeicbtbiya(odbeettn,i.oetgrrerkeseinsc-.ttltena.ceoresehdufhvefhrursentemhoismoeuiphnacthebiuvrelsig aal.bsussreectoiy( eeobptaii,trrrstec-ttlthh.cceosensh
works best for sagebrush. For shrubs which readily
uphill from the house.
Locate firewood and other combustible debris (wood
resprout, pruning to reduce height may be the best
scraps, grass clippings, leaf piles, etc.) at least 30 feet approach.
BNCW Directory BNCW proudly serves our small-business members
throughout North Central Washington, in part, by:
•
•
•
•
•
•
•
•
www.BuildingNCW.org
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
ACCOUNTING / The ADG Media Group, LLC ARCHITECTS, ASSOCIATIONS /
BOOKKEEPING Amy Gustin DRAFTING, DESIGN & ORGANIZATIONS
SERVICES PO Box 1886 ENGINEERING
Wenatchee, WA 98807 G.W.A.T.A.
Augustedge, PLLC (509) 264-1852 Complete Design, Inc. Jenny Rojanasthien
Tricia McCullough Fax (509) 888-2067 Ryan Kelso 14 N. Wenatchee Ave, Ste 114
521 S. Chelan Ave., Suite A [email protected] PO Box 1914 Wenatchee, WA 98801
Wenatchee, WA 98801 www.theadgmediagroup.com Wenatchee, WA 98807 (509) 661-9000
(509) 494-8500 (509) 662-3699 [email protected]
Fax (509) 494-8504 The Good Life [email protected] www.gwata.org
[email protected] Mike Cassidy www.completedesign.cc
www.august-edge.com 10 First St., #108 Lake Chelan Chamber of
Wenatchee, WA 98801 Forte Architects Commerce
Cordell, Neher & Company PLLC (509) 888-6527 Lenka Slapnicka 216 E. Woodin Ave.
Sean Patton, CPA [email protected] 240 N. Wenatchee Ave. Chelan, WA 98816
175 E. Penny Rd., Suite 1 www.ncwgoodlife.com Wenatchee, WA 98801 (509) 682-3503
Wenatchee, WA 98801 (509) 293-5566 [email protected]
(509) 663-1661 APARTMENT Fax (509) 664-6817 www.lakechelan.com
Fax (509) 662--5678 RENTALS [email protected]
[email protected] www.fortearchitects.com NCW Economic Development
www.cnccpa.com Poltz Rentals, LLC District
Beth Gordon Lopez Design, LLC Karen Francis-McWhite
Tidd Tax & Accounting LLC 307 S. Mission Street, Suite H Abe Lopez 1300 Fifth Street
Steve/Tina Tidd Wenatchee, WA 98801 PO Box 2674 Wenatchee, WA 98801
Wenatchee, WA 98801 (509) 662-9723 Wenatchee, WA 98807 (509) 682-6907
(509) 662-5951 Fax (509) 663-8072 (509) 398-0120 [email protected]
Fax (509) 888-0186 [email protected] Fax (509) 555-1212 www.ncwedd.com
[email protected] [email protected]
www.tiddtax.com Quality Pacific, Inc. www.lopez-design.com SMART Association
Paul Sunich Brian Ducey
Veritas Accounting Solutions 1595 NW Gilman Blvd. #13 ARTIFICIAL TURF / 1711 S. Jackson St.
PLLC Issaquah, WA 98027 SYNTHETIC LAWNS Seattle, WA 98144
Ceinwyn Rudnick (425) 746-4660 (206) 812-3819
200 Palouse St., Suite 101 Fax (425) 746-0603 MJ’s Odds & Ends, LLC dba Worry Fax (206) 285-1693
Wenatchee, WA 98801 [email protected] Free Lawns [email protected]
(509) 888-0543 Mat Nikolas www.smartwa.org
ceinwyn@ APPLIANCE SALES & Wenatchee, WA 98801
veritasaccountingsolutions.com SERVICE (509) 670-0407 The Wenatchee Downtown
www.veritasaccountingsolutions.com Fax (509) 662-8875 Association
Sav-Mart [email protected] Linda Haglund
ADVERTISING, 1729 N. Wenatchee Ave. 101 Palouse Street #35
MARKETING Wenatchee, WA 98801 ASBESTOS Wenatchee, WA 98801
(509) 663-1671 ABATEMENT / (509) 662-0059
Graybeal Signs, Inc. Fax (509) 662-3788 INSPECTION Fax (509) 665-9889
Monte Graybeal [email protected] [email protected]
1909 N. Wenatchee Ave. www.savmart.net A Central, LLC www.wendowntown.org
Wenatchee, WA 98802 Rob Witheridge
(509) 662-6926 APPRAISAL 1509 S. Wenatchee Ave. Wenatchee Valley Chamber of
Fax (509) 663-4583 Wenatchee, WA 98801 Commerce
[email protected] NCW Appraisal (509) 860-3519 Shiloh Burgess
www.graybealsigns.com Tony Thompson Fax (509) 888-5543 137 N. Wenatchee Ave.
610 N. Mission St., Suite 114 [email protected] Wenatchee, WA 98801
Rainmaker Digital Services Wenatchee, WA 98801 (509) 662-2116
Eddy Alonso (509) 387-6256 Fax (509) 663-2022
Wenatchee, WA 98801 Fax (509) 664-5115 [email protected]
(941) 735-0517 [email protected] www.wenatchee.org
[email protected] www.ncwappraisal.com
www.rainmakerdigital.com
61
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
ATTORNEYS Cascade Autocenter North Cascades Bank Midway Building Supply
Mark Ward Ann George Chris Wood
Davis, Arneil Law Firm LLP 148 Easy Street 614 N. Mission Street 132 Clarkson Mill Road
Danielle Marchant / Steve Smith Wenatchee, WA 98801 Wenatchee, WA 98801 Tonasket, WA 98855
617 Washington Street (509) 663-0011 (509) 682-7372 (509) 486-2888
Wenatchee, WA 98801 Fax (509) 663-8839 Fax (509) 888-6009 Fax (509) 486-1363
(509) 662-3551 [email protected] [email protected] [email protected]
Fax (509) 662-9074 www.cascadeautocenter.com www.northcascadesbank.com www.midwaybuilding.com
[email protected]
www.dadkp.com Sangster Motors, Inc. Numerica Credit Union Valley Supply Co.
Don Sangster Denise Gallucci Eric Cochran
Gatens Green Weidenbach PLLC 912 N. Miller St. 812 N. Wenatchee Ave. Central Washington
Ashley Weiler Wenatchee, WA 98801 Wenatchee, WA 98801 (509) 933-1800
Cashmere, WA 988 (509) 662-6134 (509) 667-7251 Fax (509) 933-1802
(509) 888-2144 Fax (509) 662-6137 Fax (509) 667-7221 [email protected]
[email protected] [email protected] [email protected] www.valleysupply.com
https://www.ggwlaw.com www.sangstermotors.com www.numericacu.com
Western Materials, Inc.
Jeffers, Danielson, Sonn & Town Chrysler Jeep Dodge Peoples Bank Andy Johnston
Aylward, P.S. Nissan Darel Ansley 5704 Nelpar Drive
H. Lee Lewis Mick Fabian 901 N. Mission St. East Wenatchee, WA 98802
2600 Chester Kimm Road 1001 N. Miller St. Wenatchee, WA 98801 (509) 886-5182
Wenatchee, WA 98801 Wenatchee, WA 98801 (509) 664-5311 Fax (509) 886-5184
(509) 662-3685 (509) 888-9595 Fax (509) 664-5315 [email protected]
Fax (509) 662-2452 Fax (509) 888-0737 [email protected] www.westernmaterials.com
[email protected] [email protected] www.peoplesbank-wa.com
www.jdsalaw.com www.townchryslerdodge.net Weyerhaeuser
Washington Trust Bank Arlyn Anderson
Ogden Murphy Wallace, PLLC AUTO BODY / Heidi Myers 220 Occidental Ave. S.
Julie K. Norton COLLISION REPAIR / 523 Valley Mall Pkwy. Seattle, WA 98104
1 Fifth Street, Suite 200 GLASS East Wenatchee, WA 98802 (206) 369-7667
Wenatchee, WA 98801 (509) 884-7111 [email protected]
(509) 662-1954 First Choice Collision Center, Inc. Fax (509) 884-9861 www.trusjoist.com
Fax (509) 663-1553 601 N. Wenatchee Ave. [email protected]
[email protected] Wenatchee, WA 98801 www.watrust.com CABINETS
www.omwlaw.com (509) 663-7008
Fax (509) 663-8299 BUILDING PRODUCT / Bagdon’s Inc.
AUDIO / VIDEO [email protected] LUMBER SUPPLIERS Larry & Sarah Bagdon
www.firstchoicecc.com 760 S. Wenatchee Ave.
Deep Water Home & Electronics Builders FirstSource Wenatchee, WA 98801
Ken Moore BANKS, CREDIT Greg Armstrong (509) 662-1411
131 E. Woodin Ave. UNIONS & FINANCIAL 3628 Chelan Hwy. North Fax (509) 662-1478
Chelan, WA 98816 INSTITUTIONS Wenatchee, WA 98801 [email protected]
(509) 682-4529 (509) 662-4407 www.bagdons.com
Fax (509) 888-2036 Banner Bank Fax (509) 662-1153
[email protected] Brette Sangster [email protected] Smith Custom Woodworking, Inc.
www.deepwaterelectronics.com 501 N. Mission St. www.buildersfirstsource.com Jared Smith
Wenatchee, WA 98801 3768 N. George St.
AUTO / TRUCK (509) 886-8282 Marson & Marson Lumber, East Wenatchee, WA 98802
DEALERS Fax (509) 663-7439 a division of TAL Holdings, LLC (509) 884-3781
[email protected] Rodney Bullion [email protected]
Apple Valley Honda www.bannerbank.com 11724 Riverbend Drive www.smithcustomwoodworking.com
Tod McLaughlin Leavenworth, WA 98826
400 Highline Dr. (509) 548-5829
East Wenatchee, WA 98802 [email protected]
(509) 662-1551 www.marsonandmarson.com
Fax (509) 662-5632
[email protected]
www.applevalleyhonda.com
Visit www.BuildingNCW.org for an up-to-date directory
62
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
CARPET & FLOOR Wenatchee Sand & Gravel CONTRACTOR Eider Construction, LLC
COVERINGS Bob Mikelson - RESIDENTIAL Chad Miller
1351 S. Wenatchee Ave. BUILDER PO Box 139
Inside Design Carpet One Wenatchee, WA 98801 Orondo, WA 98843
Joel McDonald (509) 663-5141 Beazley Construction (509) 699-1092
2101 N. Duncan Drive Fax (509) 662-6856 Sam Beazley [email protected]
Wenatchee, WA 98801 [email protected] PO Box 739 www.eiderbuilding.com
(509) 662-9500 www.wenatcheesandandgravel.com Manson, WA 98831
Fax (509) 663-1010 (509) 687-3805 G.L. White Construction, Inc.
[email protected] CLEANING SERVICES Fax (509) 687-3805 Greg White
www.insidedesignc1.com - RESIDENTIAL / [email protected] Wenatchee, WA 98801
COMMERCIAL (509) 663-7420
The Floor Factory, Inc. Berry Construction Fax (509) 667-9774
Vickie Sparks Karen’s Kleening, LLC 3014 GS Center Road [email protected]
13 S. Wenatchee Ave. Karen Holtorf Wenatchee, WA 98801 www.glwhiteconstruction.com
Wenatchee, WA 98801 East Wenatchee, WA 98802 (509) 888-1961
(509) 662-1421 (509) 884-5998 [email protected] Gann Construction, LLC
Fax (509) 662-0602 [email protected] www.berrycon.com Jake Gann
[email protected] Wenatchee, WA 98801
www.thefloorfactory.com COMMERCIAL BOA Construction Co. (509) 630-5262
REFRIGERATION Clark Cooke [email protected]
CARPET CLEANING East Wenatchee, WA 98802
North Valley Mechanical, Inc. (509) 886-7777 Ghiglia Homes LLC
Clean Air Connection Rodney Rumbolz Fax (509) 884-5790 Jim Ghiglia
Verl Sutton PO Box 1369 [email protected] Wenatchee, WA 98801
10 Fifth Street Okanogan, WA 98840 www.boaconstruction.net (509) 679-2505
Wenatchee, WA 98801 (509) 422-5544 [email protected]
(509) 663-9562 Fax (509) 422-5545 BTO Construction www.ghigliahomes.com
Fax (509) 662-3199 [email protected] Steve Varrelman
[email protected] PO Box 67 Gold Construction, Inc.
www.yourcleanconnection.com CONCRETE Pateros, WA 98846 Randy Gold
(509) 923-2802 PO Box 2507
CEMENT / CONCRETE Black Forest Finishing Fax (509) 923-0222 Wenatchee, WA 98807
/ ASPHALT John Black [email protected] (509) 663-4946
Wenatchee, WA 98801 Fax (509) 662-9694
Central Washington Concrete (509) 630-0660 C & C Investment Properties LLC [email protected]
Jake Holt [email protected] Chase Cooper www.goldconstruction.org
1351 S. Wenatchee Ave. http://blackforestfoundation.com PO Box 2874
Wenatchee, WA 98801 Wenatchee, WA 98807 Hanson Home Construction, LLC
(509) 662-6375 H2 Pre-Cast (509) 679-2891 Dave Hanson
Fax (509) 662-6856 Clay Prewitt [email protected] East Wenatchee, WA 98802
[email protected] 3835 N. Clemons St. www.ccinvestmentpropertiesllc.com (509) 670-1153
www.centralwashingtonconcrete.com East Wenatchee, WA 98802 [email protected]
(509) 884-6644 Carlisle Classic Homes www.hansonhomesllc.com
Godbey Red-E-Mix Fax (509) 884-4567 Chris Groby
David Freels [email protected] Leavenworth, WA 98826 Homes by JJ
505 SW Ansel www.h2precast.com (206) 782-7070 PO Box 2822
Brewster, WA 98812 [email protected] Chelan, WA 98816
(509) 689-2415 Industrial Cutting & Coring, Inc. www.cchbuilds.com (509) 423-0465
Fax (509) 689-2041 Pat Brown homesbyjj.business.site
[email protected] 101 S. Roland Ave. Custom Construction &
East Wenatchee, WA 98802 Cabinetry, LLP Jessup Home Design
SlabJack Geotechnical (509) 886-4114 Shane Covey Alan Jessup
Jerald Sargent Fax (509) 886-4111 Wenatchee/Chelan East Wenatchee, WA 98802
East Wenatchee, WA 98802 [email protected] (509) 885-0961 (509) 679-4030
(509) 888-4600 www.industcutcore.com [email protected] Fax (509) 884-0598
[email protected] www.wenatcheebuilt.com www. [email protected]
www.slabjackgeotechnical.com Murillos Concrete chelanbuilt.com
Jesus Murillo Lakewood Homes, LLC
Wenatchee, WA 98801 EDCO Builders LLC Troy Bean
(509) 293-1437 Steve Edmonson Manson, WA 98831
[email protected] Entiat, WA 98822 (425) 269-3021
(509) 784-0684 [email protected]
[email protected]
www.edcobuildersllc.com 63
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Lange Construction, LLC Pinnacle Custom Builders, Inc. Vertex Custom Building and DOORS / HARDWARE
Andrew Lange Travis Hofstetter Design / LOCKS
Wenatchee, WA 98801 630 Valley Mall Pkwy. #411 Jason Chase
(509) 860-3604 East Wenatchee, WA 98802 Wenatchee, WA 98801 Exterior Solutions
[email protected] (509) 884-1873 (509) 679-0044 150 1st Street SE
www.mylangehome.com Fax (509) 436-0024 [email protected] East Wenatchee, WA 98802
[email protected] (509) 886-8547
Lenssen Homes Village Life Fax (509) 886-1577
Kent Lenssen Real Homes Justin Osborne [email protected]
Malaga, WA 98828 Jon Port 788 Grant Road www.extsoldoorsandwindows.com
(509) 679-1996 1833 N. Wenatchee Ave. East Wenatchee, WA 98802
Fax (509) 888-6987 Wenatchee, WA 98801 (425) 531-2364 ELECTRICAL -
[email protected] (509) 886-8888 [email protected] COMMERCIAL
www.lenssenhomes.com Fax (509) 662-2449 www.villagelifehomes.com & RESIDENTIAL
[email protected] CONTRACTORS
Lexar Homes www.realhomes.info Wessman Construction, LLC
Rob Eldred Randy Wessman Ace Electric Inc.
147 Easy Way #104 Resch Renovation & Design LLC Cashmere, WA 98815 Ethan McGee
Wenatchee, WA 98801 Tim Resch (509) 264-9662 Wenatchee, WA 98801
(509) 663-1722 Wenatchee, WA 98801 [email protected] (509) 221-0597
Fax (509) 663-1717 (509) 860-2168 [email protected]
[email protected] [email protected] Yusi Construction, Inc.
www.lexarhomes.com Brent Yusi Don Kruse Electric, Inc.
Roberts Construction, LLC PO Box 1670 Kevin Diefenbach
McDonald Building, LLC Mac & Mike Roberts Okanogan, WA 98840 PO Box 2088
Tim McDonald East Wenatchee, WA 98802 (509) 422-3738 Omak, WA 98841
Entiat, WA 98822 (509) 669-3435 Fax (509) 422-5792 (509) 826-4301
(509) 784-1602 [email protected] [email protected] Fax (509) 826-2749
Fax (509) 271-0059 [email protected]
[email protected] Sadler Construction, Inc. COUNTERTOPS www.dkeinc.net
www.mcdonaldbuilding.com Steve Sadler
PO Box 2081 DC Custom Construction Inc G&S Electric LLC
Monteith Construction, LLC Wenatchee, WA 98807 Christina Arnall Gary Breiler
Michael Monteith (509) 669-1582 Serving North Central Washington (509) 293-6704
East Wenatchee, WA 98802 Fax (509) 663-4926 (509) 787-2044 [email protected]
(509) 387-1891 [email protected] [email protected]
[email protected] www.sadlerluxuryhomes.com www.dccustomconstruction.net/ Leavenworth Electric &
Excavation, Inc.
Olson’s Construction, Inc. Sage Homes, LLC Moonlight Tile & Stone Mike McComas
Rob Olson Rebecca Hackworth Stacy Carlile 15353 Hwy 2
PO Box 1653 PO Box 119 4932 Contractors Drive #B Leavenworth, WA 98826
Wenatchee, WA 98807 Wenatchee, WA 98807 East Wenatchee, WA 98802 (509) 763-2000
(509) 630-3317 (509) 899-9800 (509) 782-2464 [email protected]
Fax (509) 888-1956 Fax (509) 662-4465 Fax (509) 782-2455 leavenworthelectricandexcavation.com
[email protected] [email protected] [email protected]
www.olsonsconstruction.com www.sagehomellc.com www.moonlighttileandstone.com Stetner Electric Inc.
Travis Wittman
One-Way Construction NW Inc. Springwater Homes, LLC Precision Waterjet, Inc. 9224 Road S NW
Brandon Littrell Matt Bergey Troy Bassett Quincy, WA 98848
1115 Walla Walla Ave., Suite C Wenatchee, WA 98801 207 S. Columbia (509) 787-9109
Wenatchee, WA 98801 (509) 387-0805 Wenatchee, WA 98801 Fax (509) 797-9109
(509) 679-3256 [email protected] (509) 888-7954 [email protected]
[email protected] www.springwaterhomesllc.com Fax (509) 888-0581 www.stetnerelectric.com
www.onewayconstructionnw.com [email protected]
Stimac Construction, Inc. www.precisionwaterjetinc.com
Phenix Construction, Inc. Vince Stimac
Mel Shiley 630 Valley Mall Pkwy. #411 Vassar Electric, Inc.
Chelan, WA 98816 East Wenatchee, WA 98802 Danny Vassar
(509) 670-0270 (509) 884-1873 PO Box 394
[email protected] Fax (509) 886-5077 Tonasket, WA 98855
[email protected] (509) 486-1243
Fax (509) 486-0192
[email protected]
www.vassarelectric.com
64
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Wenatchee Electric LLC Grette Associates LLC Pipkin Inc. dba Pipkin FARM EQUIPMENT,
Jordan Dovich Ryan Walker Construction CHEMICALS, SEEDS &
Wenatchee, WA 98801 151 S. Worthen, Suite 101 Brian Parsons FEED
(509) 393-9800 Wenatchee, WA 98801 4801 Contractors Dr.
[email protected] (509) 663-6300 East Wenatchee, WA 98802 Rowe’s Tractor
Fax (509) 664-1882 (509) 884-2400 Corey Rowe
EMPLOYMENT [email protected] Fax 509-884-7099 3000 Rock Island Rd.
AGENCIES, JOB www.gretteassociates.com [email protected] East Wenatchee, WA 98802
TRAINING & www.pipkininc.com (509) 886-3200
PLACEMENT EQUIPMENT RENTAL / [email protected]
SERVICES LEASING Rains Contracting, Inc. www.rowestractor.com
Kurt Rains
Active Employment Solutions Star Rentals, Inc. 44 B & O Road FENCING / PERGOLAS
Sabrina Reister Ken Gilman Malott, WA 98829 / GAZEBOS
1325 N. Princeton Ave. 1115 Walla Walla St. (509) 422-2326
Wenatchee, WA 98801 Wenatchee, WA 98801 Fax (509) 422-3435 Eagle Fence Store
(509) 888-2105 (509) 663-0064 [email protected] Alex Lange
Fax (509) 888-3065 www.starrentals.com www.rainscontracting.com 735 N. Wenatchee Ave.
[email protected] Wenatchee, WA 98801
Valley Tractor & Rentals Rayfield Bros. Excavating, Inc. (509) 860-3603
People Ready Pete Burke David Rayfield Fax (509) 888-2418
Jami Roberts 4857 Contractors Drive 9810 Big Y Junction Road [email protected]
113 Palouse St. East Wenatchee, WA 98802 Peshastin, WA 98847 www.myeaglefence.com
Wenatchee, WA 98801 (509) 886-1566 (509) 548-5135
(509) 662-1404 Fax (509) 884-5464 Fax (509) 548-3102 Valencia Fencing, LLC
[email protected] [email protected] [email protected] Ismael Valencia
www.peopleready.com www.valleytractor.com East Wenatchee, WA 98802
Rudnick & Sons LLC (509) 668-7900
Work-Force Solutions, Inc. EVENT PLANNING Brandon Rudnick [email protected]
Debra Montgomery Wenatchee, WA 98801
645 Valley Mall Pkwy. Branching Out (509) 979-7423 FINISH CARPENTRY
East Wenatchee, WA 98802 Leona Wolk [email protected]
(509) 888-7779 (509) 393-4018 Pine Canyon Woodworking
Fax (509) 888-6664 [email protected] Sligar Excavation Darby James
[email protected] www.branchingout.today Matt Sligar PO Box 403
www.workforcewa.com PO Box 1151 Orondo, WA 98843
EXCAVATION Wenatchee, WA 98807 (509) 683-2833
ENGINEERS - CIVIL (509) 881-1351 [email protected]
/ ELECTRICAL / Allemandi Construction, Inc. [email protected]
STRUCTURAL / Mike Allemandi www.sligarexcavation.com FIRE SAFETY /
MARINE PO Box 4001 SPRINKLERS
Wenatchee, WA 98801 Smith Excavation
Torrence Engineering, LLC (509) 662-3529 Gregg Smith Inland Fire Protection, Inc.
John Torrence Fax (509) 662-0134 PO Box 284 Tom Wilson
6377 Kimber Rd. [email protected] Cashmere, WA 98815 3028 GS Center Road
Cashmere, WA 98815 www.allemandiconstruction.com (509) 782-0446 Wenatchee, WA 98801
(509) 782-1897 Fax (800) 811-0924 (509) 884-6717
Fax (509) 782-3436 J & K Earthworks, LLC [email protected] Fax (509) 667-1705
[email protected] Kurt Davis www.smithexcavation.com [email protected]
www.torrence-eng.com 5593 Nature Shore Dr. www.inlandfireprotection.com
East Wenatchee, WA 98802 Tonka Landshaping & Excavating
ENVIRONMENTAL (509) 886-5906 Dustin Christensen
CONSULTING Fax (509) 886-4817 PO Box 142
[email protected] Wenatchee, WA 98807
Black Rock Geosciences www.jkearthworks.com (509) 433-7070
Neil Kinnebrew [email protected]
Wenatchee, WA 98801
(509) 900-8683
[email protected]
http://www.BlackRockGeo.com
65
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
FOOD PRODUCTS GEOTECHNICAL HARDWARE Patriot Plumbing, Heating &
& BEVERAGES, ENGINEERING Cooling Inc.
WHOLESALE & SERVICES Kelly’s Ace Hardware Inc. Sherry Erickson
DISTRIBUTION Patrick J. Kelly 536 S. Chelan Ave.
Nelson Geotechnical Associates, 128 East Woodin Ave. Wenatchee, WA 98801
Costco Wholesale #112 Inc. Chelan, WA 98816 (509) 662-6262
Andy Kostenko Sofia Garibay (509) 682-2815 Fax (509) 662-6662
375 Highline Dr. S 5526 Industry Lane, #2 Fax (509) 682-0128 [email protected]
East Wenatchee, WA 98802 East Wenatchee, WA 98802 [email protected] www.CallPatriot.net
(509) 886-9507 (509) 665-7696 www.kellyshardware.com
Fax (509) 886-9406 Fax (509) 665-7692 HOME AUTOMATION
[email protected] [email protected] HARDWOOD
www.costco.com www.nelsongeotech.com FLOORING SUPPLIER Arseneault Automation, LLC
& INSTALLER David Arseneault
FOUNDATIONS GOLF COURSES & East Wenatchee, WA 98802
EQUIPMENT REPAIR Artisan Flooring, LLC (509) 679-9309
All American Waterproofing and Jason & Jenny Black [email protected]
Spray Inc. Highlander Golf Club Serving the Wenatchee Valley www.arseneaultautomation.com
LaNiece Fenton Joe Gordon (509) 782-0777
PO Box 3081 2920 8th Street SE Fax (509) 782-0777 HOME MAINTENANCE
Kirkland, WA 98083 East Wenatchee, WA 98802 [email protected]
(425) 488-0500 (509) 884-4653 www.artisanflooringllc.com Cascade Tub Repair, LLC
Fax (425) 272-4262 Fax (509) 884-9567 Dana Hazen
[email protected] [email protected] HEATING, Wenatchee, WA 98801
www.WaterproofMyHouse.com www.highlandergc.com VENTILATION & AIR (509) 664-2447
CONDITIONING Fax (509) 663-7517
JLW Custom Concrete, Inc. GOVERNMENT / [email protected]
Jon Wood PUBLIC AGENCIES Cascade Mechanical Contractors www.cascadetubrepair.com
East Wenatchee, WA 98802 Inc.
(509) 670-2937 Douglas Co. Transportation & Tim Nehls HOTELS /
Fax (509) 886-1836 Land Services 902 E. Woodin Ave. HOSPITALITY
[email protected] Mark Botello Chelan, WA 98816
140 19th Street NW, Ste. A (509) 682-5923 Love Leavenworth Vacation
Riverway Contractors, LLC East Wenatchee, WA 98802 Fax (509) 682-3558 Rentals
Dave Smith (509) 884-7173 [email protected] Sean Lynn
PO Box 809 [email protected] www.cascademechanical.com 1133 US Hwy 2 Suite F
Wenatchee, WA 98807 www.douglascountywa.net Leavenworth, WA 98826
(509) 886-7000 Climatek Heating & Air (509) 548-5683
Fax (509) 886-7002 Wenatchee Valley Technical Conditioning [email protected]
[email protected] Skills Center Charles & Rikki Filyaw www.loveleavenworth.com
Furniture - Indoor & Outdoor Peter Jelsing 966 Valley Mall Pkwy
327 E. Penny Road East Wenatchee, WA 98802 INSPECTION
MKW Furniture Wenatchee, WA 98801 (509) 881-5556 SERVICES
Craig Dixon (509) 662-8827 [email protected]
PO Box 223 Fax (590) 662-5993 www.climatek1.com NCW Home Inspections, LLC
Peshastin, WA 98847 [email protected] Don Hester
(425) 698-5045 www.wenatcheevalleytech.com Cozy Comfort Heating & AC Wenatchee, WA 98801
[email protected] Craig Brown (509) 670-9572
www.mkwfurniture.com HANDYMAN PO Box 2347 [email protected]
SERVICES Wenatchee, WA 98807 www.ncwhomeinspections.com
GARAGE DOORS / (509) 665-6859
OPENERS Quality Restoration & Repair LLC Fax (509) 664-1230 Three Cedars Home Inspection
Nicholas Dumas [email protected] Alan Erhardt
Perfection Garage Doors and PO Box 2974 Leavenworth, WA 98826
Service LLC Leavenworth, WA 98826 Dick’s Heating & A/C of (509) 881-4664
Doug Bruggman (509) 531-8164 Wenatchee [email protected]
Wenatchee, WA 98801 [email protected] 5533 Nelpar Drive www.threecedarshomeinspection.com
(509) 888-5253 East Wenatchee, WA 98802
[email protected] (509) 884-6444
Fax (509) 884-2361
[email protected]
www.dicksheatingwenatchee.com
66
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
INSULATION Libke Insurance Associates, Inc. LAND USE Vita Green, LLC
Jeff Rounds CONSULTING Mike Stancil
Gale Contractor Services 600 N. Chelan Ave. 3774 Iroquois Lane
Dustin Froeber Wenatchee, WA 98801 Dan Beardslee Consulting Wenatchee, WA 98801
400 S. Worthen (509) 662-1800 Dan Beardslee (509) 663-8670
Wenatchee, WA 98801 Fax (509) 662-1375 East Wenatchee, WA 98802 Fax (509) 663-8315
(509) 662-5171 [email protected] (509) 670-4318 [email protected]
Fax (509) 662-5173 www.libke.com [email protected] www.vitagreenllc.com
[email protected]
www.truteam.com Mitchell, Reed & Schmitten LANDSCAPING, MANAGEMENT
Insurance MATERIALS & LAWN CONSULTANTS
Intermountain West Insulation Craig Field CARE
Russ Foresman 124 E. Penny Rd., Suite 101 Alpha Sales Technologies, LLC
813 Benton Way Wenatchee, WA 98801 Anderson Landscaping Ken Mattson
Wenatchee, WA 98801 (509) 665-0500 Joe Anderson (509) 679-9659
(509) 929-0008 Fax (509) 664-4004 Wenatchee, WA 98801 Fax (866) 206-9226
Fax (509) 888-0868 [email protected] (509) 665-4916 [email protected]
[email protected] www.mrandsinsurance.com Fax (509) 663-0655 kennethmattson.wearelegalshield.com
www.iwinsulation.com [email protected]
INTERNET ACCESS & www.landscapebyanderson.com MEDIA - PRINT/RADIO
Paul’s Air F/X LTD SERVICES
Paul Smith Chuck Strawn Landscape Design Alpha Media Wenatchee
3714 West Nob Hill Blvd. LocalTel Communications Chuck Strawn 1124 N. Miller
Yakima, WA 98902 Debbie Purcell Wenatchee, WA 98801 Wenatchee, WA 98801
(509) 225-3420 341 Grant Road (509) 630-7617 (509) 663-5186
Fax (509) 452-6587 East Wenatchee, WA 98802 [email protected] Fax (509) 663-8779
[email protected] (509) 888-8888 [email protected]
www.paulsairfx.com Fax (509) 884-5197 Elysian Lawn & Landscape, LLC www.kkrv.com
[email protected] David Andrews
Pro Foam www.localtel.net East Wenatchee, WA 98802 METAL / STEEL WORK
John Barry (509) 630-4330
Wenatchee, WA 98801 Native Network [email protected] Columbia River Steel
(509) 679-3772 Carl Patterson facebook.com/ Steve Rimple / Doug Gardner
[email protected] 250 East Penny Road, Suite 200 ElysianLawnLandscape 284 Urban Industrial Ave.
www.profoam.com Wenatchee, WA 98801 East Wenatchee, WA 98802
844-558-2472 Premium Rock (509) 886-0180
INSURANCE [email protected] Dean Scott Fax (509) 886-8745
www.nativenetwork.com 4801 Contractors Drive [email protected]
Country Financial East Wenatchee, WA 98802 http://www.moseslakesteel.com/
Zane Bock IRRIGATION / SUPPLY (509) 884-2400 home/columbia-river-steel-supply.
224 S. Mission St. / SERVICES Fax (509) 884-7099 html
Wenatchee, WA 98801 [email protected]
(509) 888-5433 H.D. Fowler www.premiumrock.com Micah’s Custom Works
Fax (509) 888-0899 Joseph Lewin Micah England
[email protected] 5544 Nelpar Drive Standard Pallet Co. 3390 Malaga Alcoa Highway
https://representatives. East Wenatchee, WA 98802 Jim Brock Malaga, WA 98828
countryfinancial.com/zane.bock/ (509) 886-8804 5604 Nature Shore Dr. (509) 665-9631
Fax (509) 886-0304 Rock Island, WA 98850 Fax (509) 662-7022
Draggoo Financial Group [email protected] (509) 670-0632 [email protected]
Braden Draggoo www.hdfowler.com Fax (509) 886-8844
1301 Walla Walla Ave., Suite A [email protected] MORTGAGE
Wenatchee, WA 98801 KITCHEN & BATH COMPANIES
(509) 888-4345 SHOWROOM TC Slingers, LLC
Fax (509) 663-9034 Todd Carter American Pacific Mortgage
[email protected] Basins & Spouts (509) 393-1244 Janice Brown
www.draggoofinancial.com Rachel Tilton [email protected] 285 Technology Center Way, STE 138
8 Benton St. Wenatchee, WA 98801
Wenatchee, WA 98801 (509) 888-6700
(509) 888-0526 Fax (509) 888-6701
[email protected] [email protected]
www.wenatcheehomeloans.com
67
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Caliber Home Loans OFFICE EQUIPMENT, PETROLEUM / Plumb Perfect
Patrick Davidson SUPPLIES & PROPANE Matt Bruggman
1111 N. Mission St., Ste. B SERVICES Wenatchee, WA 98801
Wenatchee, WA 98801 Ag Supply Company (509) 663-3602
(509) 860-4955 Kelley Connect Kerry McCauley Fax (509) 663-6752
Fax (844) 670-9091 Greg Bruggman 1101 N. Wenatchee Ave. [email protected]
[email protected] 226 Methow Street Wenatchee, WA 98801 www.plumbperfectwenatchee.com
https://www.caliberhomeloans.com Wenatchee, WA 98801 (509) 888-3399
/loan-consultant/washington/ (509) 663-6311 Fax (509) 663-6614 POLE BUILDINGS /
ellensburg/pdavidson Fax (509) 662-3231 [email protected] STEEL STRUCTURES
[email protected] www.ag-supply.net
Cashmere Valley Mortgage www.kelleyimaging.com Steel Structures America, Inc.
Kyle Lewis Okanogan County Energy, Inc. CJ Lindquist
127 Easy St., Mortgage Dept. ORGANIZATIONS, Lynn Northcott 3635 E. Covington Ave.
Wenatchee, WA 98801 CLUBS, & FRATERNAL PO Box 69 Post Falls, ID 83854
(509) 662-7722 ORGANIZATIONS Winthrop, WA 98862 (208) 777-7290
Fax (509) 662-4184 (509) 996-2228 Fax (208) 457-8470
[email protected] The Blue Book Network Fax (509) 996-2241 [email protected]
www.cashmerevalleybank.com Jenny Steiner [email protected] www.findssa.net
800 Eastman St. www.okanoganelectriccoop.com
Guild Mortgage Company Jefferson Valley, New York 10535 Western Ranch Buildings LLC
Traci Dry (206) 499-5480 PHOTOGRAPHERS & Tanya Davis
925 Fifth Street, Suite B [email protected] PHOTOGRAPHY 4968 Contractors Drive
Wenatchee, WA 98801 www.thebluebook.com East Wenatchee, WA 98802
(509) 293-9280 Travis Knoop Photography (509) 884-0555
[email protected] PAINTERS - Travis Knoop Fax (509) 884-0563
www.guildmortgage.com COMMERCIAL & Wenatchee, WA 98801 [email protected]
RESIDENTIAL (509) 860-4321 www.westernbuildings.com
NEWSPAPERS & [email protected]
MAGAZINES CW Painting LLC www.travisknoopphotography.com POOL & SPA /
Cesar Nieto CUSTOM CONCRETE
NCW Media, Inc. 1511 N. Miller St. PLASTERING /
Bill Forhan Wenatchee, WA 98801 STUCCO Prestigious Patios, LLC
215 14th Street (509) 888-2439 Jesus de La Cruz
Leavenworth, WA 98826 [email protected] Stucco by Alex, Inc. East Wenatchee, WA 98802
(509) 548-5286 http://cwpaintingllc.com/ Rhonda Reyes (509) 679-0131
Fax (509) 548-4789 15037 SR 97A [email protected]
[email protected] NC Painting Inc. Entiat, WA 98822 www.prestigiouspatios.com
www.ncwbusiness.com Noe Cornelio (509) 888-3503
PO Box 4722 Fax (509) 888-3504 Berggren Pool & Spa Services
The Wenatchee World Wenatchee, WA 98807 [email protected] LLC
Sean Flaherty (509) 860-2387 Michael Berggren
14 N. Mission St. [email protected] PLUMBING 630 Valley Mall Pkwy #348
Wenatchee, WA 98801 www.ncpaintinginc.com CONTRACTORS, East Wenatchee, WA 98802
(509) 663-5161 FIXTURES & PARTS (509) 699-9685
Fax (509) 663-9110 Pinnacle Painting [email protected]
[email protected] Ron Marotta Allied Plumbing & Pumps LLC www.Berggrenpoolandspa.com
www.wenatcheeworld.com East Wenatchee, WA 98802 2131 N. Wenatchee Ave.
(509) 630-2929 Wenatchee, WA 98801 Boyer Mountain Pool Inc.
NONPROFIT [email protected] (509) 662-6622 Dale McElroy
[email protected] Cashmere, WA 98815
Habitat for Humanity of the PARTY SUPPLIES www.alliedplumbingandpumps.com (509) 670-3555
Greater Wenatchee Area Fax (509) 782-2013
Natalie Narby Trinity Inflatables Dave’s Plumbing Inc. [email protected]
Wenatchee, WA 98801 Shane Rinker David Stufflebeam www.boyermountaindoorandpool.com
(509) 663-1889 PO Box 3 4944 B Contractors Dr.
Fax (509) 662-9879 Cashmere, WA 98815 East Wenatchee, WA 98801 Hot Tub Warehouse
[email protected] (509) 782-9973 (509) 884-5860 David Clark / Amanda Kent
www.wenatcheehfh.org [email protected] Fax (509) 884-5037 3310 Luyung Dr.
www.trinityinflatables.com [email protected] Rancho Cordova, CA 95742
(916) 852-1140
Fax (916) 852-9240
[email protected]
www.hardcoverspas.com
68
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Pool to Spa Services Berkshire Hathaway Home Windermere Real Estate/NCW RESTAURANTS
Rick Specht Services - Jessup Real Estate Becky Long
160 S. Worthen St. NormaJean Jessup 517 N. Wenatchee Ave. Wok About Grill
Wenatchee, WA 98801 503 Grant Road Wenatchee, WA 98801 Shon Smith
(509) 662-1590 East Wenatchee, WA 98802 (509) 662-7184 110 N. Wenatchee Ave.
Fax (509) 665-0902 (509) 470-8244 Fax (509) 662-2656 Wenatchee, WA 98801
[email protected] [email protected] [email protected] (509) 662-1154
www.pooltospaservices.com www.normajessup.com www.windermerewenatchee.com Fax (509) 665-7461
[email protected]
PORTABLE TOILETS Christine Douglas, Broker, REMODELING / www.wokaboutgrill.com
Realtor @ Laura Mounter Real ADDITIONS
Apple Valley Pumping Service Estate & Co. RESTORATION - FIRE
Greg Howland Christine Douglas E.D.Y. Construction Corp. / FLOOD / WIND
34 N. Venture Rd. 175 East Penny Rd., Suite B Ed Gardner DAMAGE
East Wenatchee, WA 98802 Wenatchee, WA 98801 1250 N. Wenatchee Ave., Suite H-178
(509) 884-7960 (509) 264-7411 Wenatchee, WA 98801 Anytime Restoration LLC
Fax (509) 886-0549 [email protected] (509) 293-2921 Ben Knierim
[email protected] wenatcheevalleyrealestate.com [email protected] East Wenatchee, WA 98802
www.applevalleypumpingsvc.com www.edyconstruction.com (509) 881-8819
Coldwell Banker Cascade Real Fax (509) 470-7443
POWDER COATING Estate Jerry’s Custom Homes, LLC [email protected]
135 N. Mission St. Jerry Martinez
Cascade Powder Coating Wenatchee, WA 98801 Wenatchee, WA 98801 Homesley Construction
Josh Potter (509) 888-8887 (509) 393-4892 46 Rock Island Road
11 Bridge Street Fax (509) 662-2112 [email protected] East Wenatchee, WA 98802
Wenatchee, WA 98801 [email protected] (509) 884-0224
(509) 663-9080 www.cbwenatchee.com JLS Custom Woodcraft & www.homesley.com
Fax (509) 663-9130 Construction, LLC
[email protected] Laura Mounter Real Estate & Co. Jeff Stephens ROOFING
www.cascadepowdercoating.com Laura Mounter PO Box 2234 CONTRACTOR
175 E. Penny Rd., Suite B Wenatchee, WA 98807
PUMPS Wenatchee, WA 98801 (509) 886-3020 Apex Quality Roofing LLC
(509) 665-9200 [email protected] Samuel Aranda
Irrigation Technology & Control, Fax (509) 665-9100 www.jlscustomconstruction.com Wenatchee, WA 98801
Inc. [email protected] (509) 630-3445
Julie Hamon www.lauramounter.com Lince Family Construction @apexqualityroofingllc
4956 Contractors Drive Aaron Lince
East Wenatchee, WA 98802 NCW Association of Realtors Quincy, WA 98848 Select Roofing
(509) 886-4100 Callie Klein (509) 699-0953 Erick Lozano
Fax (509) 886-4141 610 N. Mission St., Suite 208 [email protected] PO Box 211
[email protected] Wenatchee, WA 98801 www.lincefamilyconstruction.com Rock Island, WA 98850
www.irrigationtech.net (509) 663-1211 (509) 679-5489
Fax (509) 662-0819 P & P Remodeling Services LLC [email protected]
RADIO STATIONS [email protected] Rene Perez
www.ncwar.realtor PO Box 556 Summitt Construction
Icicle Broadcasting, Inc. Dryden, WA 98821 Keith Bennett
Gary Taylor The John’s Real Estate (509) 264-4976 Leavenworth, WA 98826
32 N. Mission St. Corporation [email protected] (509) 548-7065
Wenatchee, WA 98801 130 Riverview Drive Fax (509) 548-7506
(509) 667-2400 East Wenatchee, WA 98802 Story Construction, LLC [email protected]
Fax (509) 663-9497 (509) 886-4000 Jeffrey Story
[email protected] Fax (509) 886-5400 Wenatchee, WA 98801 Titan Roofing CW LLC
www.KOHO101.com www.johnsrealestate.com (509) 782-1317 Lindsey Morrow
[email protected] Wenatchee, WA 98801
REAL ESTATE Wendy Jones, Realtor - Berkshire facebook.com/storyconstructionllc (509) 470-7943
SERVICES Hathaway Home Services - [email protected]
Jessup Real Estate www.titanroofingcw.com
Augustedge Real Estate Wendy Jones
Tricia McCullough 503 Grant Rd
521 S. Chelan Ave. East Wenatchee, WA 98802
Wenatchee, WA 98801 (509) 293-3628
(509) 494-8500 [email protected]
[email protected]
69
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
SAND / GRAVEL SURVEYORS UPHOLSTERY - Community Glass Company, Inc.
MARINE / AUTO / Travis Turner
Two Rivers Sand & Gravel, Inc. Erlandsen & Associates, Inc. HOME 606 N. Wenatchee Ave.
Roy Dickinson Kris Erlandsen Wenatchee, WA 98801
22750 Lake Wenatchee Hwy. PO Box 739 Wenatchee Upholstery (509) 662-8039
Leavenworth, WA 98826 Brewster, WA 98812 Joe Holmes Fax (509) 662-5719
(509) 763-3280 (509) 689-2529 353 Malaga Alcoa Hwy [email protected]
Fax (509) 763-3248 Fax (509) 689-2520 Wenatchee, WA 98801 www.communityglass.com
[email protected] [email protected] (425) 876-7303
www.tworiverssandandgravel.com www.erlandsen.com [email protected] THE GLASS WORKS LLC
Jeremy Nichols
SECURITY SYSTEMS - Northwest Geodimensions, Inc. WELL DRILLING By Appointment Only
BURGLAR & FIRE Norm Nelson Cashmere, WA 98815
15 N. Chelan Ave. Tumwater Drilling & Pump, Inc. (509) 860-5345
Keyhole Security Inc. Wenatchee, WA 98801 Lance Ballew Fax (509) 662-7405
David Langlois (509) 663-8660 PO Box 249 [email protected]
708 S. Wenatchee Ave. Fax (509) 663-6278 Dryden, WA 98821 www.theglassworks.info
Wenatchee, WA 98801 [email protected] (509) 548-5361
(509) 663-5610 www.nwgsurveys.com Fax (509) 548-1100 Wenatchee Valley Glass, LLC
Fax (509) 662-8652 [email protected] Robert Guerin
[email protected] TIRES www.tumwaterdrilling.com 5930 Sunburst Lane, Unit N
www.keyholesecurity.com Cashmere, WA 98815
Les Schwab Tire Center WHOLESALE (509) 293-0270
STORAGE SHEDS / Kirk Moser Fax (888) 485-1182
BUILDINGS 301 Grant Road Consolidated Supply Company [email protected]
East Wenatchee, WA 98802 Jeff Burchett www.wenatcheevalleyglass.com
Rent-Me Storage, LLC (509) 884-2414 1100 Walla Walla Ave.
Julie Hamon Fax (509) 884-4186 Wenatchee, WA 98801
4968 Contractors Drive [email protected] (509) 662-7128
East Wenatchee, WA 98802 www.lesschwab.com Fax (509) 663-2279
(509) 661-7368 [email protected]
Fax (509) 884-0563 TITLE / ESCROW www.consolidatedsupply.com
[email protected] COMPANIES
www.rentmestorage.com WINDOWS / GLASS
North Meridian Title & Escrow / MIRRORS -
Rock Steel Structures, Inc. Jim Blair IV INSTALLATION
Scott Rock 701 N. Chelan Ave.
1412 Fairway Drive NE Wenatchee, WA 98801 Renewal by Anderson
Moses Lake, WA 98837 (509) 662-4721 Nathan Largin
(509) 764-9700 Fax (509) 663-3758 210 E. Montgomery Ave.
Fax (509) 764-9500 [email protected] Spokane, WA 99207
[email protected] www.northmeridiantitle.com (509) 340-7706
www.rocksteel.com [email protected]
TRUSSES www.renewalwindowswa.com
STORAGE SYSTEMS
Louws Truss Inc. WINDOWS / GLASS /
Cascade Woodcrafters, Inc. Jeremiah Murphy MIRRORS - SALES
Tim Ewing 5485 Mill Road
1080 Washington St. Cashmere, WA 98815 Chelan Glass and Door
Manson, WA 98831 (509) 300-1100 Robert Guerin
(509) 881-4730 Fax (360) 384.8800 56 Chelan Falls Road
Fax (509) 687-3970 [email protected] Chelan, WA 98816
[email protected] www.louwstruss.com (509) 682-2634
www.chelanclosets.com Fax (509) 682-2645
Noble Truss & Lumber, Inc. [email protected]
Sarah Erickson www.chelanglass.com
355 Malaga Alcoa Hwy.
Wenatchee, WA 98801
(509) 662-1877
Fax (509) 662-5950
[email protected]
www.nobletrusswa.com
70
BBNNCCBWWNCHWHeaHeltaehaltlCthhhCCohihocieoceice
AA HHeeaaltlhthInIsnAusrHuaenraalcthenIcSnesoulSruatoniocleunSttioholaunttiojtunhstahtatmtjjauuksstetmsmaskeaensksseeesnsseense
Why settWlehfyosreottnleefor one
WHheayltsheItntHlseeuarflatohnrIcnoesunqrueanoctee,quote,
HwfreohamelntthyhoeIunmfwrscohaaumenlnrlt?yahcoenhumoccoaealsnlq?ecuhoootsee ,
when you can choose
frBoumildtihnegmBNuioaldrlitln?hg North
Central CWenatsrhailnWgatsohnington
offers itsomffeerms ibtsermsembers
BciunosimuldpraeintnictgeiicnvorNsemauhprotaeeerntsaicttlfeithrvhroeamhteesalftrhom
Cseevnetrraal ilnsWseuveraraasnlhicneisunrgantcoe n
ocfaferrriserist.scmarreiemrs.bers
competitive health
inCsaullroaunrcoCefafrlilcaoetuetrosodfffaircyoe fmtoodray for
semvoerreailnifnomrsomureariatninfooncrm!eation!
c5a0r9ri-e2r9s3.-550894-0293-5840
PROPERTY ASSESSMENT CHECKLIST Source: Complete Design, Inc.
When looking at new property to build on, take into account the following questions to help you
assess if the parcel will suit your needs and budget.
Land characteristics
Define in terms of grading and excavation, foundation requirements.
Earthquake faults: How close and how risky?
Elevations: Is the property level? Hilly? Marked by canyons? Are there rock
formations that will hamper grading?
Flood plain: Near enough to provide a hazard?
Is a Geo‐Tech evaluation required?
Is parcel large enough for your new structure?
Riparian areas located on site?
Soil type: Is it sandy, rocky, full of clay?
Subdivision restrictions i.e. conveniences?
Vegetation: Are there trees you can incorporate as a noise or sight buffer, or as an
open space corridor for common use? Or will you clear everything to provide landscaping?
Water: Lakes, lagoons, rivers, streams or ponds?
Water table, percolation rate: Will these affect foundations and drainage?
Will Snow load affect design of future structure?
Wind or Sun exposure?
Zoning limitations?
Other ______________________
Services
Check those already in place. If not, how much will it cost to provide them, if required?
Name of Provider
Cable _______________________________
Electricity _______________________________
Fiber _______________________________
Gas _______________________________
Recycling Disposal _______________________________
Sewers, storm drains _______________________________
Telephone _______________________________
Trash disposal _______________________________
Water _______________________________
Other _______________________________
Improvements
How much will it cost to install services and improvements?
What will I have to build?
What will I be assessed for?
Power lines or transmission towers: Where are they? Will they interfere with my plans?
Roads: Location? Are they adequate to handle increased traffic generated by my project?
Traffic loads on major streets and highways?
Existing buildings: Will I need to demolish them?
Transportation infrastructure: Proximity of railroad lines, ports, freeways?
Is a fire sprinkler system required?
Purchase price vs. requirements to prepare site for new structure?
Other _______________________
Amenities
Which of the following are conveniently located or accessible?
Grade school
Middle school
High school
Fire protection
Law enforcement
Recreation
2020 BNCW & SANGSTER MOTORS VIRTUAL TOUR OF HOMES
Advertiser Index
18 Anderson Landscaping
17 Apple Valley Pumping
45 Artisan Flooring, LLC
7 Banner Bank
23 Berggren’s Backyard Oasis
38 Cascade Powder Coating
29 Cashmere Valley Mortgage
25 C&C Investment Properties, LLC
11 Christine Douglas – Laura Mounter Real Estate
31 Chelan Glass & Door
15 Community Glass Co.
13 Complete Design, Inc.
21 D.C. Custom Construction Inc.
15 Deep Water Home & Electronics, LLC
55 First Choice Collision Center, Inc.
38 Forte Architects
9 Icicle Broadcasting, Inc.
57 JLS Custom Woodcraft & Construction
41 Lake Chelan Building Supply
51 LocalTel Communications
33 Lopez Design, LLC
8 & 41 Marson & Marson Lumber, Inc.
47 Moonlight Tile & Stone
42 & 49 Native Network
57 NCW Home Inspections, LLC
66 North Meridian Title & Home
43 Northwest Geodimensions, Inc.
20 Patriot Plumbing, Heating & Cooling, Inc.
3 Pinnacle Custom Builders Inc
5 Sangster Motors, Inc.
12 Sav-Mart
24 The Good Life
32 Travis Knoop Photography
47 Trinity Inflatables
35 Valencia Fencing, LLC
75 Village Life
76 Vita Green, LLC
31 Wenatchee Valley Glass
20 Western Materials, Inc.
74
Village Life Homes offers everything
you dream of in a new home
Explore Wenatchee Valley Living
Whether it’s enjoying nature, a round of golf, browsing Pybus Public Market
or roaming the apple orchards, you’ll love living here!
Burch Mountain Mountain Springs
Wenatchee East Wenatchee
Wendy Jones Peggy Lord
509.293.3628 509.885.8148
[email protected] [email protected]
Pybus Public Market
Highlander Golf Course
Gorgeous Scenery Apple Capital of the World
Learn more at VillageLifeHomes.com