The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.

Free Entertainment Book

Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by price_christy, 2020-10-20 12:50:27

Tidbits_2019

Free Entertainment Book

Keywords: Fort Collins,Ads,Games,Puzzles,Editorial,Entertainment

TRICBKE-SRA-TFREEATIN’ a pile of fertile bird poop far away. Some bird CHECK ENGINE
LIGHT SCAN
Display until November 17th, 2020 seed manufacturers add capsaicin to their bird with this coupon
Implant,Synthetic Oil Change
seed to deter squirrels.
® Abutment and Crown
• There are about 350 species of hummingbirds, $59.9$92,391*New filter and up to 5 quarts of motor oil. Some oils extra.
all of which live in the Americas. The smallest is Valid for upper biscuspidsNot valid with any other offers. Must present coupon to
the calliope hummingbird, which weighs about
redeem. One per household. Valid Through 12/31/19 Not
as much as two paperclips. Hummingbird eggs
FREEvalid with any other offer. One coupon per customer.
of Fort Collins, Wellington & LaPorte Not valid with any other offer.
AUTO SERVICE YOU CAN TRUST ALL RIGHTS*RDEoSeEsRnVotEinDcl©ud2e0to2o0th
FAMILY OWNED & OPERATED 970-377-3333Issue 2019SCHEDrUeLferErermeAdoNvsapAle,PcbPiaoOlntyeINpgrTroaMcfte,EdoNurrTes

The Neatest Little Paper Ever Read™

Implant,Bucket List and Things, LLC TO ADVERTISE: CALL (970) 744-0558 www.fortcollinstidbits.com221 E. Troutman Pkwy Fort Collins, CO 80525 | WestonAutoService.com
TTUURSRSONONOIOINNNNGG??6655TOMUcetRSdoibONceaOIrrNe1NGsAt?tnh6nru5ooaourrl..og....rEh.y.yl.oPoPeDuauSaSycryryuueoPiicpctnpnuaSucupigpgryrourllereirtetcpneoeonmmumpngonoreetltremmtPnnbMMeomttuunoeeeePPccetddrhhmllrnaaiiMicctnfnfuoaaoo7ePcrrrrddeethlhaicnfaorre Abutment and Crown
TIDBITTSID®BGITEST®S AFADMMIILRIEASR WITH
2New patients $2,891*
BABIES & GROUPSBIRDS
bybJyaKnaetthySpWeonlfceer welcome daily! Valid for lower front and
CThoemree’saalocnegrtwaiinthvToicdabbiutslaarsy wdeesaigdnmatiered upper/lower molars
for the babies abnirddgs!roups of certain
AEWOGTAOTEGWeAOTEGWxpuuexepuulepxepuuparlepepraelerproppraSeerreopSareeriharroepStpinhneetpanrnorihrctoerttpnrvctntnmeevoonmereiroctsteiecvnsenmeeecenoee,deie,sdesneescnOnnenOuet,liuJdettliJnsosstnlnossnOltaaulwtaatlliwiJFi&tiFn1i&osnlsn1lcnlnRcle0tRlae0algwegE1eiFkmisM&E1EkmsM1Enln5cn5tRlaVneE0taVEgaWeearWKE1enrikmrKsMnEriPojrt.a5ojrdt.andodtaoVdotEHotrlHhrtlauWtielrurKilronreiiocemigcmygojoryaetr.aaFerdcFscdossauostoauHoorlnloleetareeuarilrruirraouiretia,tctm,ngetdrnyodreoaeerFvcCvsrCPorsPota:autoaoliaoitaoseetasrSeShernhn9luiralrtri,litlndroirilerlpcRpecRne7nvCarasPostadsdseeeieao0tssbsb,,..SehnlrCcCciSSl-lliiirleepcdRdOOenuu2iiasaaiidsette88ee2sbe,e.ll00iCic1Snlni2525ssedOu0220i-tttta36i631t8eel01in25s402tt361•B•d aoiIasrnRlmt“ihTcdArnyh(jhsBnecafhauoa1es-D“oeusiaahaoilrv5rmtot,stnascceJtmarbevcieohfiknsfhotmitaFcynuefhopcn,fiiniiutnlAllhiarcalahcailBRico2geenseanlsalariulaioC”0wrladsdrpgrsttidolbdbgtll“TseeeaewcawlbssioamabmynrSdcs,mrnwiodtsi”fibtenaeoirit,dkms)oemids“ahoatrtlaun,olhnpssasomsneureb.wdeosorts.eixsatenlreftitewepbl.erTueetcsrgTaosevhlei,Fbomnanortasmhaerootceoeniuskuhsresrn“bifaage,laneoasr.frstlsluvsgehesolroyulA”tebinie,qlewntncww.e“aahcbi”ibuaftrcsroattblrnhiodiiimeukoYaortotoiteuspsiecsrmaetolnnltustaraomclsasbgreTuett.r8t,aniomneotqemics’6hh0bsTdrfdggonuetansehe%opooittbkissorrote.vabo,rrce”aLfypinuieentaooc“hae8povrrsdTtnadwfislrtPotineusihoheainntyrhnhebonoesaeerstgommcseaorf,waccseue:sueWhkrsaoaenbreniotssnreglhcnoenyaollr!osgeisyetdwhrd”roab.ndey”sftl--- Not valid with other offers.

*Does not include tooth
removal, bone graft, or
referred specialty procedures

Mark Kollar, DDS Implant,

Abutment and Crown

970.689.3282 $3,291*

Valid for upper front and
Steven Vascellarolower bicuspids
2032 Lowe St., Suite 202 Not valid with any other offer.
Fort Collins, CO 80525
Services*Does not include tooth
Handyman removal, bone graft, or
referred specialty procedures
briardccs oionnclsu.dWe hmeonstthdeoymleeastvice tshpeeicriemsosthuechr aats
PPhhoonnjaeec:k: @99a77m00e--ri22qu22o11te--in11s11ur44an11ce.com cahbicokuetntsh, retuerkyeeyas,rsanodf adguec,ktsh;egya’lml jeoinbiardgsrolikuep 303.903.0862
www.ameriquoteinsurance.com
[email protected]@..aaaammmmeeeerrrriiiiqqqquuuuooootttteeeeiiiinnnnssssuuuurrrraaaannnncccceeee....ccccoooommmm pkhneoawsannatssaandcopnagrtrreidggaetsio; na.nDd obnig’t bciordnsfuliskee os-
FC-GCI0389028-02 trthiceh caonndgermegua. tion with a bask or a float, svascellaro27.wixsite.com/mygo2guy
FC-GCI0389028-02

FC-GCI0389028-02 • Cwahpicsahicisinaisgthroeuspubosftacnrocecothdailtemsa. kAesbaspsikcyocf hili

pcerpopceordsilheost.aIrne hounmtahnes,laanddiwluhtiiolen aoffltoeant poaf rts PPAARRNNTTAASSTTII&&OONNSSWWEEIIRRDDEVEVIICCEE
pcerrocmsillaioren ionf tchaepwsaaicteinr.will send sensations of WWAARRRRAANNTTYY

33 YYeeaarrss oorr 3366,,000000 MMiilleess

• pAaibnaabnydadlpisatrceassotrolltahembaraisinc.aBlluetdbiardcsrilaa,ck the Save on your
• nowascptoAftweaeooefeirepdhrnrgmctvpdtiehiemholceeearetraohmaiahlerleoldlfeteiapieittfoseuciracneonrfebcaupfltenpophrebfprpwoaartteoesoeitaciclalihfterritnShfasiuecsecgobpprhrit.iienuhsnsialeeAarrtga,dnsaepnintlanicetttrsaoeparnoeehtdndhoacdiaggcdirosrwlblniiaieiunpastylacloittigto.ievahtnofrbhneradpaotnuisrtrsnusifhsfdsaoaoyagiosisrtwfsrnhchrfpanisedbiantnre2neqhaeyhgnd0at.ueabosu.,reyySdal0nlTa.yntotb0hhtintAsofmeeaal0adyninerirs,yntpdewebbgaaaeaiionnrdrrirtddddnss next visit.

steoegdetthoedrettoercslaqiumirraellsa.rge area of land, they FREE
• atThpadhlelirreeeeorcndefwa’awtilattltoihhreoeriirnpcsraheittkbholihilorrlvueiiunaemetgl.im3nmA55it0nobh0g%noebtush,Apitrsaemd9nca,0edife%rwtiesachraooipcbsffoh.ichroTthwuhrhem,eeiemiwmgstammiihtnhhsauglncableuebirsbodtsusis,t
assysmteucmh aansdtwdoisepaaspeertcalkipins.gHouumt tmhiengrebmirdaiengdgesr. CHECK ENGINE
BABIES & GROUPS (continued): ➜
WE HAVE MOVEDLIGHT SCAN
wwiitthh tthhiiss ccoouuppoonn
OUR STORSEynTtOhetic Oil Change

A NEW LOC$AT5IO9N.99
%NNeeww ffiilltteerr aanndd uupp ttoo 55 qquuaarrttss ooff mmoottoorr ooiill.. SSoommee ooiillss eexxttrraa..

725 S. Lemay Ave 10rNNreeooddtteevveeaammlliid.d. OOwwnniietethhppaaeennrryyhhooootutuhhsseeeerrhhoooofflldfdfee..rrssVV..aaMMlliidudussTTtthhpprrrrooeeuussggeenhnhtt112c2co//o33uu11pp//o1o199nnNNttoooott

Suite C3 OFFvvaalliidd wwiitthh aannyy ootthheerr ooffffeerr.. OOnnee ccoouuppoonn ppeerr ccuussttoommeerr..

WANT TO PUBLISH A IN YOUR AREA? Fort Collins, 80524AAUUTTOO SSEERRVVIICCEE YYOOUU CCAANN TTRRUUSSTT

We provide the opportunity for success! (NFFAAoMMrIILLtYhY OOoWWf NNSEEaDDfe&&wOOPPaEEyRR,AAnTTEeEDDar WeSSnCCdHHyEE’DDs)UULLEE AANN AAPPPPOOIINNTTMMEENNTT

Call 1.800.523.3096 (US) 970-377-3333

(970) 223 -7327222211 EE.. TTrroouuttmmaann PPkkwwyy FFoorrtt CCoolllliinnss,, CCOO 8800552255 || WWeessttoonnAAuuttooSSeerrvviiccee..ccoomm

Computer Repair by Michael www.fcmuffler.com

Michael Makes House Calls ASE Certified
Technicians
Tune-ups • Tutoring 36 month 36,000
Virus Removal Mile Warranty

970C.a8l2l N5o.9w472 ➧ FREE Customer Shuttle • Ignition Systems ‘Read our Online Reviews’
• General • Oil Changes • Steering
TV & Smart Phone Help Too! Maintenance • Suspension • Starting and • Manual
• Cooling Drivetrain
• Mufflers • Exhaust Charging
• Brake Repair • Fuel System • Fluid • Automatic
• Diesel Repair/ • Heating & Air Transmission
Maintenance
Maintenance Conditioning • Axles & Driveline • Fleet Services
• Alignment
Get Social!

flg

19 970-325-6703$ 97

OIL CHANGEStandard
Call to make an appointment!

Includes 5 Qts. Oil & filter (Synthetic Serving Fort Collins For Over 40 Years
extra.) Check Fluids: Transmission,
Coolant & Power Steering, Battery, 2001 S College Ave • Fort Collins, 80525

Fuel & Air Intake, Belts & Hoses, Two blocks South of Dairy Queen on S College Ave
Air, Fuel & Cabin Filters Mon – F: 7:30am to 5:30pm • Closed - Sat & Sun
Most vehicles. Some restrictions & extra
fees/costs may apply. Not valid with
any other offers. Limited time only. CAR PROBLEMS? WE FIX EVERYTHING!

MOBILE HOME PARTS-R-US!

Northern Colorado’s #1 Hardware Store for:

Visit Our • Furnaces • Faucets • Water Heaters
Showroom • Skylights
• Electrical • Sinks • Doors
Today!
• Skirting • Windows & Much
Google • Door Knobs More!!!
• Bath Tubs • Plumbing
• Surrounds

MobileHomePartsRUs.com • 210 N U.S. HWY 287 • Ft Collins, CO 80524 • 970-222-2731

Page 2 TO ADVERTISE: CALL (970) 744-0558 www.fortcollinstidbits.com

• When we think of the word “flock,” we typically think of birds, but did you Lab Finds Tiny Amount uloma.) While the lungs are the most
know that a group of camels is also called a flock? These unusual animals of Blood in Her Urine common site for sarcoidosis, it can
can travel up to 100 miles (161 km) without drinking water. The 80 lbs. (36 kg) affect the kidney, causing hematuria.
of fat stored in the camel’s hump is converted to water when needed. After DEAR DR. ROACH: My question
a long period without water – sometimes up to weeks or even months – the is about microscopic hematuria. I Sarcoidosis also can cause kidney
camel will drink about 30 gallons of water to replenish itself. see a rheumatologist for sarcoidosis. damage, resulting in a high creatinine,
Last year I had various lab tests, so that should be tested. Severe kidney
• And speaking of flocks, not every group of birds is called a flock. including a urinalysis. That test and disease from sarcoidosis may be treat-
Birdwatchers tells us there are “unique and distinctive names” for many several since then have shown micro- ed with prednisone, but you should see
species of flying creatures. A group of crows is a murder or a muster, while scopic hematuria. The rheumatol- an expert (nephrologist) to consider
a group of cranes is a sedge. Finches and hummingbirds gather in a charm, ogist sent me to a urologist, who did this diagnosis.
while hawks and falcons have three different labels – cast, cauldron, and scans and a scope of the bladder up
kettle. Buzzards form a wake and eagles band together in a convocation. through the right kidney. There’s a The majority of people with small
Magpies gather in a group known as a tiding, starlings are a murmuration, slight stricture of the right ureter. My amounts of blood in the urine with no
and an assemblage of nightingales are called a watch. biopsies were negative. documented reason for it, including
the cystoscopy and scans you had, will
• Who decided that a group of loons would be known as an asylum? Some Tests and scans continue to be OK not have serious disease. However, it is
birdwatchers call the group a water dance. except for the microscopic hematu- probably still prudent to keep an eye on
ria. I am a 60-year-old woman. Is the kidneys and bladder periodically.
• Under the sea, you might encounter a flotilla of swordfish, a fever of stingrays, the hematuria a cause for concern?
a risk of lobsters, a party of female dolphins, an alliance of male dolphins, — K.E. ***
or a turmoil of porpoises. Try to avoid the shiver of sharks and the battery DEAR DR. ROACH: I was just
of barracudas! While most jellyfish stings are not deadly, stay away from a ANSWER: “Hematuria” means told that I have brittle veins. I have
smack of the ones that are, such as the sea wasp, one with a sting that can “blood in the urine.” “Gross” hema- exhausted every place I can think
cause anaphylaxis, which can be fatal. turia means there is so much blood of to find out more about this con-
that it changes the urine color, while dition. What is it? What causes it?
• Porcupines are well-known for their sharp prickly quills that protect them “microscopic” hematuria is recogniz- What should I do? — T.M.G.
against predators. So it’s no wonder a group of these rodents is known as a able only in the laboratory. Blood in ANSWER: There isn’t a condition
prickle! Porcupines take their name from the Latin, meaning “quill pig.” The the urine can come from anywhere in called “brittle veins”: Whoever told
quills, or spines, are actually hairs coated with thick plates of the fibrous the urinary system, and there is a long you that was trying to explain a symp-
protein keratin. The quills of the African crested porcupine are nearly a foot list of possibilities. Although the cause tom you have. They may have meant
long! And the babies of these spiny fellows are called porcupettes. is sometimes never found, your phy- that your capillaries (the smallest type
sician should consider urinary tract of blood vessel) break easily. That’s
• A whole lot of kangaroos form a mob or troop. The baby kangaroo is known infection, kidney or bladder stones, a cause of easy bruising. They may
as a joey, but so are the young offspring of koalas, opossums, and wombats. and, in the right age group, cancer of have meant that you have stiff blood
the kidney and bladder. CT scans and vessels, from calcium or cholesterol.
• Some animals are known by different names depending on what they’re cystoscopy are commonly performed That’s a cause of high blood pressure.
doing. For example, when penguins are in the water, their group is called tests, and the negative result in your They may have been trying to draw
a raft. An assemblage of penguins on land can be a colony, a rookery, or case is reassuring. blood or put in an IV and found that
a waddle. The group swims and hunts together to crease their chance of your vein “blew,” meaning the needle
getting more food. There’s also a special term for penguin chicks that stay You have one more reason to have went through the vein entirely and you
together in a group – a crèche. A group of Emperor penguins that gathers hematuria than others, and that is the had bleeding under the skin.
together in cold temperatures to conserve body heat is known as a huddle. sarcoidosis. Sarcoidosis is a condition There are also some rare blood disor-
When a group of geese is on the ground, we call it a gaggle, but if they’re in that can affect any tissue in the body ders causing blood vessels to become
flight, they’re in a skein, unless, of course, they are in a V-formation, when with abnormal clumps of cells called fragile, and sometimes inflamed.
they are known as a wedge. granulomata. (Just one is called a gran- These can be quite serious, but I doubt
you have one of these.You would have
• How about bringing politics into the animal world? Owls gathering together been referred to a specialist.
are known as a parliament, while a group of baboons are, perhaps accurately, While I understand why medical pro-
referred to as a congress! fessionals will use nonspecific terms
like these, they can lead to confusion.
• Baby cockroaches, cicadas, grasshoppers, and mosquitoes are all referred to
as nymphs. ***
Dr. Roach regrets that he is unable
• In the reptile kingdom, if you come across a lot of cobras together, you’ve to answer individual questions, but
BABIES & GROUPS (continued page 3): ➜ will incorporate them in the column
whenever possible. Readers may email
questions to [email protected]
med.cornell.edu.

© 2020 North America Synd., Inc.
All Rights Reserved

www.fortcollinstidbits.com TO ADVERTISE: CALL (970) 744-0558 Page 3

WINDOW & SIDING SAVINGS! 10 Windows

$4,948

up to 1000 UI

Limited time only • Call for details

Vinyl Replacement Windows: Lifetime Warranties • Energy Star Rated WINODOuWt&lSeIDtING

• Lower Energy Bills • Monthly Payments to Fit Your Budget

WINODOuWt&leSItDING WE OFFER 10 Squares
FACTORY
www.WindowAndSidingOutlet.com WHOLESALE $o4f ,S9idi4ng8
PRICES!
Call Now For A FREE Estimate! Limited time only • Call for details
Come Visit
970.663.7433 Our Showroom!

3167 East Eisenhower Blvd • Unit C • Loveland, CO Hundreds of References

aopfnadsysaeesleanel nnn,bgiipmareidtar,qslpbutohieigvnadeet,torhe.onexIrfiwspkittleena’sdnontrtewaetoxetefttrliveesnenscprtn,aaiakwnseksi1teeshn.9sgp1yee4orr.hupaispgeseeoo,nntslhy.altTohgceuroisrtusdptrooipspppkiinnngogwsitnnfooaursrsishaheerehdrunemunmbtirabe.efrYoso.reuIts’tsms.bigDeheutneaetlosstoiomvwaearte-hndudntehtiranitgn4,to0th%ae 11.. WWhhaatt ivnisnttraugmeenatlbduimd threulmdpethteer
•• wIonfaaTa1gsdnhr9mdeam5iiognd8rbare,eeitfCaliieionzchnniehta.idp”oiyrlneTmtuoahmaorda,nfartk“i’gMsvoileelsaia.nttoeShgpneZir1mteeastpmdittliayaooilrrnlnalirgyoo”p,nwiposflsrfaiop“nCmapathorrivinrinaaoegatxwienotisdsntse,ewchcwrtoiolmoaiuwtnrlhedf.oedtOfrhsrtepenaheleiayrgctufraipsloaaifntulemelcypnreboftoohouefeyrgvpaehtchernagyeatmrccsapppooiuanaclroirkptgrrosoaonwftsweeioeeniatnddhoteerf6tadhaa0netn,dtg0iriraiad0nevc0gseltacirpnfiabreegogonomertapiastoltttepseef.an4dTilrtiehiispdoecpoenoeiusvnnanecktdnrierstdentoh(ta1cobot.r8lusaupnnektagrgry)e- rDecoocrdSefovrerminossetnwreeeaklslyonwBaniltlbtooarpdla’sy
awlbhuemn hcehawrat?s young?
rotwoscaricmtusaollny egaatthperirminarailygirnosuepctsf,itntiontgglyrakinn.oWwnithasnoasfplaamrrobwoysaanrcoeun. dAntoaesastebmugbsl,ythoef gbiuragfsfehsadisfrseueitraebinlytoreefaetrrtheed
crtoopas,saandtotwheerr,essuinltcinegafnamaidnueltkigllieradffaebmouitg3h0t rmeailcliohnapheeoipglhe.t of 18.7 feet (5.7 m). And a group of zebras with 22.. NNaammee tthheefigrisrtl cgormouppansytatrotedsigbny
• Duthrienigr dWaozrzldlinWg abrlaIIc,kaapnladnwe hlaitnedcedoloonrinthge?isTohlaetye’dreisklannodwonf aGsuaamd,awzzhleer!e there were thriving populations of birds EMlviciskPi Hreasrlreiys., Shirley Owens, Beverly
• anTdhneowsonradke“ssutorfbeeit”foisundde.fiHnoewdeavser“,aint’solivkeerlyabthuantdaasnint gslueppprleygonraentxcberosws”notrreaensn“aekxetresmcaepienddufrlogmentche cinargo onto L3e.e aWndhDicohrissoCnogleym. entions Camp
thseoismlaentdh,inwgh.”eBreuitttfhoeunwdonrdo analstouralpepnlieemsiteos aangdroaupleonftsifkuul nsukpsp! lySoofmbeirtdims.eTsodcaylleGdupaomlehcaastsa,ntheesti1m1astepdec3i,e0s00of Gr3a.nWadhai?ch duo released “Easy Lov-
er4”.?WHhiontw: TerheetyhceaEmdediteogCeltahyetroanfStekriaf-n
brsokwunnktrseerasnngaekeisnpceorlosqr ufraorme mthile,fanmdilitaenr boluatcokf athned1w2hsitpeectoiebs roofwbnirdosr tchraetaumse-dcotoloirnehda.biAt thfeemisalalendskaurnekexgtiivnecst. filnefoGrmroaulpjamandsesRsoiorny. Storm and the
Hu4r.riWcahnaets?female singer told Dick
Wbitirhtohutothae lbititredrso, fth2etpoo1p0ulkaittiso,naosf tshpeidbearsbiseksyraorcekecteadlle, da,nwd ithheereacahrewneoiwgh4in0gtibmeetws emeonre3s2piadnedrs3o5ngGraumams.tThahne C5la. rNkaomne“tAhme seorincganthBatancdosnttaaninds” tthhiast
thkeirtesaarreeobnonrenigwhibthooriuntgcioslaatnsd, sb.uTthaerfeoraelsrtesaodfyGsutarimpeadreatinbdirethcl,inseinbceecathueseptahteterernaries ninotbhierdirsstokinsppreigamd ethnetasteieodns.. lsyhreicw: a“nItecdanto’trubleelitehveewyoorlud’?ve got a
he5a.rtNoafmsteonthee, Is’voengsetehnatyocuornttaeainrss ftahlils
REMmItAudRsoKkeAssnpB’rtLatEyakPferEolOmonPtghLeEfoirrsacesknut ngklatnoddse. velop its distinctive odor – at just 8 days old, they can release their wlWiynhgroeircfnko: iyr“nwoSguaatrvtidhlinotthoguegAhnshaiuntcpnsykpwodlieeueosrrn,wts’istemasrveheisiann.”lgeo,ndLeim.o”oeks-,
FL• OYTDalkCaOboLLuINt aSn apt description! A group of spiders is called a skittering, while a whole lot of mice are taelasFnpltreaBehthelrriyard231eaysn132reaamedrayo...hig...tdiffMcdlnoeS“risPooeeTkosJ“ugdSJsuryrrhwpaonnHhohetmenmooitlahoteoh,dfevlhae”rnvrwoniRrnfaayeCiltnSeerslnftnncrtEneaogrohonthhiytyarctn“a.rtecl’ieaaog’owlaTtrCrsoPsMsismceeRtroln1hhlhoaahdolrGt“lnsCAol9biehrr,easnHdeg,ksCrt6Wocoe,ArgnsehoeheTtet3nfi,otPcaiesnrneliofhseoGlaVwtlinroo,nocshneeo”n,n1dadqrteihonesiia9ecostgMnut41roHue&lyfst5rhoaees99oHlorga.iee4uosltng05brlhcFdlTli.idmgiol7otth.sSiwAontosadwtrs.uoiah,imaleal.”emteTdni1olyheFptlina,d9whheayn,ekiPatba5ceJHsPtPasw1kurkyh8o.bShhr9erite.hlakadeotilag8uhrnanlelnsw’,Itio4po”irstr---tdps--t,.
• Wdheesncariblaerdgeascaavemwisacshifeofu.nd in Kentucky, at first it was important only because of its reserves of saltpeter, used in lTethteersfornogmnseutmtemd ear Gcarmamp.my nom and
of this cave, finding it so large that w4o.nTahnosMeTwVeraewthaerdtwino1g9r8o5u.ps Ringo
the manufacture of gunpowder. In the miMd-1O80V0sI,Ea caFvAe eVxpOlorRerImTaEppSed:much St4a.rrMpaladyoendnwa,iitnh 1b9e8fo4r.e he joined the
Be5a.t“leBsl.uSetaBrarywoaus,”bboyrnRRoyicOharrbdisSotnari-n
BEN-HURit was dubbed “Mammoth Cave.” When the saltpeter reserves ran out, it was promoted as a tourist attraction instead. k1e9y6a3n. dLwinadsaknRoownnstadstRfiotclhloiewuendtiwl hiteh
jhoeinr esdigRnoartyurSetocromve. r version in 1977.
• aItnostctheaeashdeayinril.nyIcTn1o9h1m09ee01Ttsso7,ht,wtoiohshreuoryfwieosvmoueenfretdooBkawt,henweTneoai-ddnrHedtbhaueairtrbtfsuoehlnozcatmraoasevonedbc,m,eena.asenTmdhnieinanaCcgocopientlsloCisntprsthyoufseaatlamanflyiraClycooalftivnvsaeee.ndaBusbnumietonbaituecrwbrteyao,tsfthahedniniesdftfriaFc1elun9oplctytietdhcos Ctatcoaocetcllhlneeiens.tsscuwaarvnayeds.gdfeuewaterratomnuitrneieestdds T5h.e “sDonogn’wt aRsuusshedMine,”sevbeyraTl amyloovr-
• ca“mBee.nF-Hlouydr”cwoanstinfuiresdt ptoubseliasrhcehdfoinr athbeeUttenritceadveS.tates in 1880 by Lew Wallace, a Civil War Union General Dieasy, ninec, l1u9d8in8g. D“TeshpeitMe haanvWinghosiFxeTllotpo
• sFqlocauyenedndetzuCGerooyiln.vlitenTosrh.neOboerfnigrosaJfatntnmhumeaoervNtyhieeo3wda0id,cMaa1epl9lyxt2aicet5ioxo,pntThloewerriar3nistg7o-rryeeyevl,aeearar-nyosdledndboeeoixnckpa1loom9fr0eetr7h,tewhfoeicglalgnovluweemdewbdihnebotroysoeaannoelpoobenpengeisnentirg-nsvgeweltralhisnasigotbnhwiegio’nderk1nb9ooe2uef5gnfih.cwtfiooorrnkhionifmgthotoant 1E0arstihn”gl(e1s9a7n7d), thstraereriGngraDmamvyidnBomows,-
• exTphaendminogstfowr ewlle-ekknso.wWnitahdnaopthtaintigonbuwt askethroese1n9e59lanfitlemrnsatanrdrinagroCphea, rhletodnroHpepsetdonin,tporaemskiienrninygtuonneNl aonvdemslibtheerre1d8 hie,r amnudsitchecaSrteeeprhweonuKndindgohwonrraonrdfslihcek
thorofutghhatayenarr,onweadrolywsnewvaernd-syleoaprinsgacftheirmint ewyausnftirlshteaennnteoruendcaedla. rIgt’se tuhnedesrtgorroyuonfdarowoema.ltWhyhJeenwhishlapnrtienrcnebaengadn t“uDrnreedamtocaactctihnegr”an(2d0s0o3n)g. writing.

tomspeurtctehra, nhteinheJaedreudsaoluetm. B,uJtuadsahhe Bweonrk-eHdurh,iswwhoayisthbroeutrgahyethde btiyghat Rpaosmsaagne,frtiheencdeailinndgfcoorlclaepdseindt.oOsnlaevelarryg.eWrohcekn ©©22002109KKiinnggFFeeaattuurreessSSyynndd.,.,IInncc..
laBndeend-Hounrhriesgleagins,swhhisilefregeradvoeml a,nhdesraentudrfnilslefdorinrethveenspgaec.es around his legs. He was trapped.

•• It Ftoiolmkimngorien tRhaonmae dbaeygafonr baeffroiernedthoef hsicsrtioptfiwgaursefionuist hwehde.reThhee wshaosoatnindgwsicghgeledudloewwnaisntobrtuhtealc,awveithcl1o2se-herntoou1g4h-
tohyredll,aycos,nfsirixmidnagytshaat wFleoeydk wlaasstintrgapfrpoemd.MHaeytooofk1t9h5e8neuwnstilbJaacnkutoarFylo1y9d5’s9f.aSmixilym. Folonythdswoafse6d0itinfegetfo(1ll8owme)db.eMloowre
othfttehhasaeucnortifmf1afi.c1nee,,mtwhaieilttlhitophhnreoisfejeenleecdgtt so(w3ftar4aas0pc,fp0liane0uids0s.htrmeodp) ,hootfhbfeiilcmfi1nw4a0al -fsfiolmsoht io(n4tc,3laumndd)edttwh1ies9tie,n0dg0it0tournfsen’eeftli,r(sl5yt,ic8nug0t0ownmah)siosmfbfoailrmcek 4in½anhooupresnilnogngth.eBsyize
and was 213 minutes
• Floloyndg’s. brother Homer wriggled into the cave to assess the situation. He brought food that he hand-fed Floyd, and
ttOtrohidmMe-encudocooFraaetrrioneesvbtgedrttuwhhietgahaaintrhennhtyriianmfa31inl0,mdcmo0aaeu’si,yltsnl.sdineoe.WiiwtsnnRschaseupwped-sranmseoioiprpnHienegsnoru.ebmotrwUueepeispptrlccitowo,eharnmraasteestrree.rqdirroucssgtrierpaoridainwfccgi1klneee0od.dd,n0eiien0ftet0oumaptetih,elxleiiatogrncnahdatspvhswoeooueuoanrrnnseddlpsahcetioearoefrmp,dplhee,leawotshfuoitrtteohuwrnn,7gdi4,the501d0,a000t0on0oe0otfwhrctesshupoecbaamtiopcvweeufrensbsefeorttoidlnkrogytfgointlahugftaimhllteidbtwrheeeeedarnsasat,ntrcfaoododuoaindusdt,m-




• anDdacnaemsei rBarso.tOhevresr,4a,0R0o0mcaanrscbheaarriiontgm1a0k,0e0r,0bpueilto1p8lecchroawridoetsd, tehaecchavweeeignhtrianngce9,0a0wlbasiti.n(g41n0ewkgs.).RCeshcaureltrosnstrung
eleHcetrsictolnigthotsokallththreeew-haoyudrocwhnartoioFt ldoryidvi.ng lessons every day after arriving in Rome.

•• OTnhFeebcrhuaarriyot2s,cFelnoyedw’sacsatvhee-efxiplmlo’srinfogcbaul dpdoyinmt,atadkeinitgdpolwacnethine wtuhnanet lw, asndthoerngathneizebdiggaegsrtomupovwiehosewt reavpepred a
rocpoenasrtorucntdedFl.oCydovaenrdintgrie1d8toacpruelsl ,hitmheoaurt.eOnan wFeabsruaadryup3l,icaabteucokfeat nbraigcatudael hRaoumledantosntsaodfiusmtonoeustsoiudteofJtehreuscavleem,

butht anot wmaasttefirvehoswtomrieucshtarollchkotuhseyinrgema o2v,e0d00fr-oftm-loanrogu(n6d10Fl-omy)d,trmacokre. Frocrktyfethllotoustakneditos npslaocfe.wOhinteFesbarnudarwye4re, the
reipmoprtoerteredtufrrnoemd MtoeCxoiclloinstowoitvhearlajayctkh,espseunrfdaincge.hTohuers ctroysint goftocorenmstorvuecttihoenowvearsb$ur1demni.lliOon iFneb1r9u5a8ry. 5, a cave-in
• cuAt osftfaafflloafc1ce0s0s wtoaFrdloryodb.e fabricators began working on the costumes for the movie a year before the filming
• OenvFeenbrsutaarryte6d,, tihneoNrdaetirotnoalcGomuaprldetsetamrteodredtihgaginng10a0s,h0a0f0t. cOonstFuembreusarayn1d61,,0th0e0y fsinuaitlslyopfeanremtroart.edCothsetucmavee open-

liingImgthatau,liknaodinrnegcrsonhwmeoaapestahmnaFainoloknieynsdrhtseiCprwn.ooaTllhrtinikeosern.edaBwolyeantvshbeenonnoothstasiegs’andlneobdafetlsehifhneeo.rtreFwalsopo.yprSdkeeidlhkrasfwodhrada1sine7iddm-dptpaoeoyorrshlt,eaedopdfsitfwetrhomhrmeicsehTidn1ha2atyhislheaeanUaddrnl,biietweere,idtnahKlwoWinniteehgsodatuonGtdmfeoi,nrowmdthh,aeiwlnedyaatrekr,.
BEN-HUR (continued page 6): ➜

RADIO Ron Ross
The Voice of
Tidbits Radio

Tune in Sundays at 10 AM
1310 KFKA-AM or 1310kfka.com

$2,891* (970)
Page 4 TO ADVERTISE:Valid for lower front and CALL 744- 0558 www.fortcollinstidbits.com
upper/lower molars

Not valid with other offers.

New patients *Does not include tooth
removal, bone graft, or
welcome daily! referred specialty procedures

Mark Kollar, DDS Implant,

970.689.3282 Abutment and Crown

2032 Lowe St., Suite 202 $3,291*
Fort Collins, CO 80525
Valid for upper front and
lower bicuspids

Not valid with any other offer.

*Does not include tooth
removal, bone graft, or
referred specialty procedures

Implant,

Abutment and Crown

$2,391*

Valid for upper biscuspids
Not valid with any other offer.

*Does not include tooth
removal, bone graft, or
referred specialty procedures

New patients Implant,
welcome daily!
Abutment and Crown

$2,891*

Valid for lower front and
upper/lower molars

Not valid with other offers.

*Does not include tooth
removal, bone graft, or
referred specialty procedures

Mark Kollar, DDS Implant,

970.689.3282 Abutment and Crown

2032 Lowe St., Suite 202 $3,291*
Fort Collins, CO 80525
Valid for upper front and
lower bicuspids

Not valid with any other offer.

*Does not include tooth
removal, bone graft, or
referred specialty procedures

wFNerleecwoempaeCtdieoaninltsy!sultation TIDBITS® ADMIRES

$ 00Mark Kollar, DDS BIRDS

500970.689.3282 OFF* by Janet Spencer 2
Come along with Tidbits as we admire
wNe2F0lo3e*c2rNtwoLCotoovRwmlalpNeilniedSsae,twg.eC,ittSOhiduwCueo8iatlt0erhna5e2io2pr0r5tlo2wsyfafIe!mrnts.isCpealnllafotnrsdtetails.
MNarekwKwpoaeltlilaecrn,otDsmDweSelcdoamileyd!aily! birds!

970.M68a9rk.32K8o2llar, DDS BIRD FACTS

2032 Lowe St., Suite 202 • As Jim Robbins explains in his book, “The Won- Steven Vascellaro
der of Birds,” there are two categories of new-
970.689.3282Fort Collins, CO 80525 ly-hatched birds. Those that require weeks of Handyman Services
careful attention from their parents are called
2032 Lowe S20t 3• 2SuLiotew2e02S•t.F, oSrut iCteol2li0n2s, CO 80525 “altricial” meaning “requiring nourishment.” 303.903.0862
Fort Collins, CO 80525 This includes most song birds and raptors: rob-
ins, sparrows, owls, eagles etc. Then there are svascellaro27.wixsite.com/mygo2guy
those that are able to function as soon as they
hatch, called “precocial” from the Latin words
meaning “mature before its time.” Precocial
birds include most domestic species such as
chickens, turkeys, and ducks; game birds like
pheasants and partridges; and big birds like os-
trich and emu.

• Capsaicin is the substance that makes spicy chili

peppers hot. In humans, a dilution of ten parts NATIONWIDE
per million of capsaicin will send sensations of
PARTS & SERVICE
WARRANTY

3 Years or 36,000 Miles

pain and distress to the brain. But birds lack the Save on your
nerve receptors that register this sensation, and next visit.
can eat capsaicin in dilutions of 20,000 parts

per million without noticing anything. The seeds DIGFITARL &EOEFFSET PRINTING
of the pepper plant are thus spread far and
wide after being eaten by birds and landing in BPUCLwOBSitIHShRIGNTOtEhCEHiCsSACHcTSRoKUuDCpSRASoEEnCR|SDNBA|OSFGNOL| YLIKNEALRBEESETLSS
a pile of fertile bird poop far away. Some bird
seed manufacturers add capsaicin to their bird $59.99SynGtRhAePtHicICODilECSIhGaNnge

ENHANCEseed to deter squirrels. WIDE FORMAT PRINTING
BANNERS | POSTERSNew filter and up to 5 quarts of motor oil. Some oils extra.
• There are about 350 species of hummingbirds,
all of which live in the Americas. The smallest is Not valid with any other offers. Must present coupon to

PRINTING|COPYINGthe calliope hummingbird, which weighs about VEHICLE GRAPHICSredeem. One per household. Valid Through 12/31/19 Not

as much as two paperclips. Hummingbird eggs valid with any other offer. One coupon per customer.
& MUCH MORE...
AUTO SERVICE YOU CAN TRUST

970.282.1891 | 1833 E. HARMONY RD. UNIT F8A,MFILTY OCWONLEDLI&NOSP,ER8A0T5E2D8 | ENHANCEPRINTING.COM

www.fortcollinstidbits.com TO ADVERTISE: CALL (970) 744-0558 Page 5

HPeualmHthpykeiMnaaBlkrteeohavdyer FrenP1cumhenpvekTloipneoPunaufldasvdoirtendggePlaitein October 19, 2020
lsiwst(hostalhTiiwettmluarhl1-nertamsfarakatuattesYSFutlestesgddphyycdoiytgf-ptueruoooOoadiicpgfoermdgos.eatrnuun!wu(gtnyiuadraplgdtonlyaapOwicaruncwqavnn’,dkclhauvedhenhyenertiaidwcacsdtsltesi)-iketlainoylstnlnomlsnbhifeoki.tgar’rhaelmsienhmiaseeSroacdtscsen3odbdcdhrutimta.hogrlhs.g—in)Gooobb.rlriwloalPNetiilveeeolabmnnnssnoedeletssdieolguoasirsn-nsncbuooortsdeeeeffrlgaelf,iroetatrviiuswovtnehsr’olsani3a11lrn/¼½olt1441laiilhfgwttyteacccctgcpcpiatan-uuuuraainifhbesewippppkifrcntalanikssafseaenfgmiaenlslcmhtietralgpttiae-trkipenhoovahlfehdfagmkroav(adarnfrnyobmoidtsaciuetroslo-ionlt(icrcatm4lec1gertaowk/arpts2iw.,nucehunioausksridctoateptivdhdipnfhripscatinnekincigleanin)lgrdpsgeaesu-m:l)admanbrd-s
slkcauiu31nrgpga//pepr2144iueergmegipxwu)hmllctitpaaeeuksarrinpggs((npeesoto)eepougglmonggpw- vw-afhanitit1le5(las1%pcopeaiuuennmx,)mcpetoiksrrxmin(1a(h)n½aioclltcftkusoopflsai)d3-pp0ua-mockpuknicne-
2
1

1/4 cup canola oSil alt 1. In small saucepan, sprinkle gela-
Q: How do florists make thQei:r Wmohnyeyth?e buzzard cross t1h/e31roactedua?pspl28oowon-favtapntslieallliaianceysxeotprgsauocrttfoirnms mwaht1irnmogeivlnaeeuntrel-yiwtoonvsheeorfet1oe/an2rgctueblpatmuinit.lktC;eoleortksotavnedr
grrooossoeedsss21!pAa..uNcWr:eracaBchhmpkaeaultcesereatc.eduhtrhsaameesreetidghsreregbodciy?uvhpeicnkotefonaadn42135biipibip4lpebpcohsAbcsBId.....eapnmnotxoogoiyoouuiofnHm31114F1•321aiWsndWbencgvodtomcTWwhWtumsetk////....o½ar4kdsi’eeeyeEr1kea41222tlyasra1hIe,trhlohdbdrHacprIoen1rhsPdoahccp6tii“oftnactmealni.vlkak4nssc/taurlyeonientouTyrwmoeciimscdseousetlotmprti2;oinDceaihhsh5s,laa,hHkmsireunomfanlpcctttttouesht-eheudehspkpooifgagatkisooneeeeee1rlaroenrnigikuutfmlkmtttpr.reb1•2F3srpounnrcspnaaaaaadiam.ot,6,seiomaioavet,ppoeegyieioisLgrrignlmasptey“?ftokcsssssiatt5anwy1pbnflvuinreowae.le..oCwuiiilaEpppppp5doptthnauutiawas?vihmoiggektaxg?ekto7(wnlhtooonlmneltnsoooooe0tieeghwohtarll0itnwlnin.tb.mhrarD,e/.tri,lanltgmdsHedcntluooooonnasoomoag5,chune-erTmnoy,obrmpfrfiewgboeio.s;©prnnnnnAsetosltvlosree.eswtilbscoereaoon:rsaomiitfusc5tsoseeeiomionirt6wuaoavlrdMe,a;rggbls-bosiitwlnkaaeliAbrr,lnhilovtkvdteynwc/pmtebga3slpe,idowrrayaftnrmxh2ssbumhpnfpxnsig,aayewilutaooayaal5o.blnlletkithua,yitiowtiiwai”Mbhothlokiad0aiontk(inrehproiuudnetkoe0onfnietostrcemetrnnsxfasemeianlnbelalgedsgaiirnni2eu2dgainueigroeraouoddrentiuan.ttfesuglbtgspnF-nue.,eddnuit’h-phcetema?onopuur0ssttgrassopeenefig.rldrr.irdro2famtrrid1rtlsfrentf1rehctnrgfdfatee1)bsmokowrSll5ebinpo,lpee-ieaeltvs4cmvpi,HuoenuewttplmaolMl0iuotmnnlgwdoudep2hfhaiot,o0aangiseegwtutnnoa,urA,0p.rucowranowajiwadrmlgelealaseeg,aiarruttadebwraammeertarridnaarndxcto,iffeeywadd.siuireaesapyealselpnn,w21345aamtrttSdirebbvotcgtgiwels/.rpchdlnruatgarbFldd.tnnyg......ridwlnyeaaauaohgfro8hooolkrcarsr-srtsWAWNWvshrbufniouenk,kncstpmeeeadrpoi:omonarmeihesctedwetriiiittertooiah1iiiclnayceeaautsmltfeeageawrilnner“ombfhhhsAueaneddhoiIa/tkcaiCnknatalFmsrssrst.ra2ggoefcavr,sehimsoaaad---------ne;c..,.,.Abnl/ernltpcmsrio.btobootttieuetu.sbifae,ewgne?2wnselfdpanrnlnri4ugfmcoseftorwleldpcdiafnohabrthsoeeero0wr.s1l4heh.oersoem”Csnremoo1w”nFocer,)s,ausgth,,Itebncps2nwrRslpmiShadSmacpthmlueto0rc6/eopooigineysPoii(aiefkmettrud,rueeia3iuouserwppnd2tper3F452•vdeu-okihrwl2tfuaiieneeotte?tuder1nteneapkamttugnobroxnDaimrfgr...od.hehiidssgitmg.noE?edivf5nkiicbtlerirmogisplreo-iotuscmt,rpHunTh3gieaesenaFipobS2lmnturo.alyeopseemaarop6vpuIdovbgontaeihfoflnmkiiRddneeoiqvurk6gddkernneerctfefamclbtimnisxfcsee,1tt0fsear.leiienaegaottneinshscaprhiulaoaostieat.eilseoparotsnooacg3ut,ve,smlvace,loekbt.dtoguumiralswneir,ateitesanints0is-om,feestytndocponstsmoee.etIfeuwrmlarombsrphbeiirfocuoeuaesltiapplewtdci)R-rdiraavet.mtaswntovviymmigneirnWolr.ph.itnimv.paeohgaarbdaehetc1nsrieputevurtcehltnmsg3rl,Usirgebehlkngot9oapr,tnnaaF0enoaTnstiitrlseliiig-.efldiodihh8ti5nnouywtpa-iemplYDdcnaltmtsstb.,enoont-lfaenshaihrris,opeecttt.io6ggrwteorpaflsbtscsroepnkbglre1logloloago,ballgiCiihtehdecgy:moomk,oniucmbialeojs–dcwoexislhtotuwsrntoutiaiecuaacloahso3nmetmIpAnubeehgbtwhtgteor)mu/cirgctenaicoheeebispsafobydtrone7ttaifrftrxmfssiotnraatiicasrughabhrotraovpnidlnlmreean,lnhtemoi5,pehctrlea,broa,eendrctonrmeabaoootceol4ipupt,secnem1iatnnirilwubleaesslone1rwfwrtdrygdsbttmslulFbdeg.eaprfioirbheittsinweoaumtnweeeee.ptnopteartgshs.irhoto-rehfaosarnyeni,salswtoifforicdesrthirlaoidwwe,iislihnlotSltieclssfiute3toeownecpeurmrrtnedmtruyypithxufget.ntfeobhleoiaha,aiHodepsah-bost4paicor.lluatyp,pshgwuannsrgtieueehntklcvowm.oasrm,sr-adoi5teo3koeio,teelienriiImessano9tapteucgtloSwatolcyykeaenclems,lyuhttnatdiaaitcechttaeggdaiepreon.hs,coepahshtkemrit-?kwtblnedddsts1hhknodgp(dhneeosaecbairitndontonss3a-----cdasoett.,xi/..9,,.,o/dinagrlreeaeftuliegl.tt72viirdccsfocnoiauePyll-faiaodgafprunerovspoion5oycariSpcwrritaaassrrgssteaapncnuaricmiuoi3ncimckomeiaetm.nielesmmmsuun1idcaisadoddoom/osieancbaerfstplaecty4nppgg0hs-ets-ie-rf-----r-ttd;d..,..edaiuinbodocanlallragiousenngtenraoh?atnn.get,,gefeggao
A: By petaling their

1. What percent of all
2. What percent of

G A L A I Mmen?

© 2020 Hearst Communications, Inc. © 2020 Hearst Communications, Inc.
All rights reserved All rights reserved

Vanilla is harvested from Boracbhyidhoflrosweserasr,e not called ponies! A pony
which only open once for 2c-a3nhboeurasnayndage. They just have shorter Chuck Berry 10/18/1926
Katy Perry 10/25/84

require hand pollination tloegpsroadnudcewaider bodies than full-sized John Lithgow 10/19/1945 Keith Urban 10/26/67
Kelly1O.sMboauirnnee 10/27/84
vanilla bean. horses. A horse that is younger than one Sylvia Browne 10/19/1936 Bill G2at.eIst was the10f/i2rs8t/5to5 bloo
year old is called a foal. A colt is male Viggo Mortensen 10/20/1958 WinonabRoymdber 10/29/71
and a filly is female. Kim Kardashian 10/21/1980
Johnny Carson 10/22/1925 Ivank3a. TTruulmipp 10/30/81

Nancy Grace 10/23/1959 Rob S4c.hRnoesideehrips 10/31/63

5. Pansy

10/18 Alaska Day 10/25 When introduced in the earAlyme1r9i6c0asn,s 1t,h0r0o0w out enough recyclable glass

10/19 Elevate Your Life Day 10/26 NNNMaaaovtttiihyooennDraa-allinyDC-haLoyacwooflDattaheyeDalaDballeuusyp.mmloTiinnyoeuuddmmay,bbetehvvreoerruaaggghee icmcaanpnsrsowvweediebTginohghdotehetduslreiggelsahecnbesy,seovcnu1eletr,it0hnyr50gagm50nyoosfnajtvuhisnttogosfniltelougrpluaanssgabia1on0ttt4W0lse-tkwheryeasesctQutkrlalutips4gaehi3rnrt.

10/20 I Love Yarn Day 10/27 World Psoriasis Day35 lbs. This is a significant rebduulcbtifoonr ifnourarwhours. It takes about 4,000 years
Speak Up for ServicemDataeyrial use and in waste to befroercyacglelads. s bottle to completely decompose
10/21 National Apple Day 10/28
Halloween
10/22 Eat A Pretzel Day 10/29

10/23 Canning Day 10/30

10/24 Mother-In-Law Day 10/31

MAGNOLIA HIPPOPOTAMUS 1. 64%
2. 75%

Swedish botanist Carl LinnTaehueswdiosrcdov“ebreesdytnheast”cewrtaasinlifsltoewdeirns aop1e4n8a6t bspoeockifiacsttihmeeps reoapcherdtaeyr,manfdorthcehraefroarcetecrainstbicesuosfedfetroretetsll.tIitmwe.aTs hlaetUer
where Linnaeus was a profaesgsoror,ucpreoaftefderare“tfsloiws ekrncolwocnk”asbasbedusoynntehsis,paribnucsipinlee.ss or fesynes. The babies are kits.

Page 6 TO ADVERTISE: CALL (970) 744-0558 www.fortcollinstidbits.com

Adjustable Base!

GRRREAT NIGHTS SLEEP at affordable prices...

WITH THIS COUPON...

Get $25.00 off any purchase of $250 or more

with this promo code (TIGER)

50-80% OFF Retail Store Prices!

(970) 310-0051 • FortCollinsMattressStore.com

328 S. Link Lane • #1A • Fort Collins, CO

contributing the armor. Woolens were manufactured and costumes embroidered in the United
Kingdom, and lace came from France. Italian women donated more than 400 lbs. (180 kg) of
hair to produce wigs and beards.

• Six months into the filming, producer Sam Zimbalist complained of chest pains on the set, and
left for the day. He passed away 40 minutes later from a heart attack.

• The budget was originally set at $7 million, then raised to $10 million three months before
shooting began, escalating to $15.175 million by the time they started, the most expensive
film ever produced to date. Its initial theater run yielded $147 million in revenue, saving MGM
Studios, which was teetering on the brink of bankruptcy. Nominated for 12 Academy Awards,
the film nabbed 11 of them, making it the most Oscars ever won by a single film. The record
still holds today, although it has been tied by “Titanic” and “The Lord of the Rings.”

CONTACT LENSES
Because October is Contact Lens Safety Month, Tidbits is
offering up facts and history on these little visual aids.

• Along with an early concept of a helicopter, water-powered mills, and his extensive study of anatomy,
Leonardo da Vinci is also credited with the initial concept of contact lenses. In 1508, da Vinci
conceived the idea of altering corneal power by submerging the head in a bowl of water or wearing a
water-filled glass hemisphere over the eye. About 130 years later, French scientist Rene Descartes
tried a glass tube filled with liquid placed in direct contact with the cornea, hence, the term “contact”
lenses. Although it seemed to enhance vision to a certain degree, its awkward size and shape
prevented the wearer from blinking.
• In 1887, a German glass-blower named F.E. Muller, who was in
the business of making glass eyes, created the first eye covering
that could be tolerated by the wearer, and the following year, Close your home
Swiss ophthalmologist Adolf Fick fitted the first blown-glass
contact lens worn over the entire eye, and able to be worn for a
few hours.
• In 1929, glass contact lenses that conformed to the actual purchase in as little as

shape of an individual eye were invented. With a few years, the
development of new plastic materials paved the way to lighter-
weight, unbreakable contact lenses. However, the lenses still 14 DAYS!
covered the entire eye, depriving the eye of oxygen, so that they
could only be worn for a few hours at a time. In 1948, lenses that
only covered the cornea were developed, extending comfort and
wear time.
• Contacts stay in your eye because they stick to the tear film that
covers the front of the eye, as well as by pressure produced by
blinking. CALL TODAY
• Soft contact lenses made their debut in 1971, after two Czech
chemists sold the rights to their invention to Bausch & Lomb. (970) 282-8000
The FDA issued approval for extended overnight wear contacts
in 1981.
• Conditions such as myopia (nearsightedness), hyperopia
(farsightedness), and astigmatism (errors in the shape of the
cornea) are all greatly benefited by contact lenses. These DYNAMIC
conditions cause vision to be blurred or impaired because light is MORTGAGE
not properly focused on the retina. The contact lens functions as CONCEPTS
an aid for picking up light.
• An estimated 150 million people around the world wear contacts.
About 45 million Americans wear contacts, with 65% of that
number female. About 8% are under 18, 17% are 18 to 24, and
the remainder are 25 and older. Ninety-percent of users wear
soft contact lenses.
• In October of 1964, President Lyndon Baines Johnson made
history by becoming the first U.S. President to appear in public
wearing contact lenses.
• Colored contact lenses can completely cover the eye’s iris,
radically changing eye color. Others are lightly tinted, making the
user’s natural eye color more vivid NMLS #480957
• Proper care of contact lenses is imperative to avoid serious eye
infections. Anywhere between 40% and 90% of wearers don’t
follow the care instructions, leading to upwards of one million COLORADO A+
doctor and hospital visits per year in the U.S., at a cost of $175
million. Infections that can lead to blindness affect 1 out every Department of rating
500 users every year. ■ Regulatory Agencies
Regulated by the Division of Real Estate

www.fortcollinstidbits.com TO ADVERTISE: CALL (970) 744-0558 Page 7 er 12, 2020

• On Oct. 27, 1659, William Robin- VDAataBBooresatschAIdmapptaicvtes NFeobvreumabreyr 34,, 22002109
son and Marmaduke Stevenson, two S4p6o,r0t0s0PVroegterraamns
Quakers who came from England in October 19, 2020
1656 to escape religious persecution, SAomdaetaobfreuaschhoavcceubrreeednatwthaeitDinegpafrot-r
are executed in the Massachusetts Bay thmise:ntTohf eVetDereapnasrAtmffeanirts wofhenVethteieravness
Colony for their religious beliefs. The gdatmcAA(haposftonanrirTerfuteesieatofrusfImltraacnohtnlafettfhbiusitvdaceuatimeoceteisrlwroidshnddeensdgiapwulaatddeadeaornyttrpiFiyoeirthtnstcdnvltwrhshoduelaaieftgevemger,hpgrslavttct,eorfVessehbooiaaearrmerarAaonetntsntswaFehtdhwog.mapdt.naice.iasignoT1tvacsTootaejwarrlthe2hmnuhkaohtrdnr,0sseheanesactaecmtpctoltkhodtmdipmo’eaacaleuerswerrmiilganydnefvontariasndesdiSeugetlentntwoleiipyemtornoctiteaoagrrorzhaatyhovrbkmyhotpafltelheeig,eiyeteiscosapaetirtrivrneeoo.tsnalraoetddtssnmyeawghTftov$oiesfclamrnCfeho1slurcahgltigtaeuee4hbteanfnieohnenosvnlr.aletr.d8aeeeesss-r--tt,
colony had banned Quakers under eelsv)eanrtueailnlyablle5w0osrtkaeteds,opultuws hDe.nCt.haonsde
penalty of death. PpureorvtoideRrsicogo, tarnedplawciellmesenrtvpeay1m1,e0n0t0s
pfarrotmiciptahnets.VA. However, while the
• On Nov. 1, 1765, despite wide- tThoievseese wwehreat’rsoagmoing oarno,ugnod ionnltihne
spread opposition in the American tocomwpwuwte.rvsa.tghoevy/aadlsaoptigvoetspthoertsp.ersLoonoakl
colonies, Parliament enacts the Stamp foinrfothrme aNtiaotnioonfalsoVmeteer4a6n,s00W0 hveetelcrahnasir,
Act, designed to raise revenue for Brit- GinamcluesdinfogrSothcoiasel Sweciuthritsytrnoukme,bearms.pu-
ish military in America. The Stamp spGS(ttvhaTnckaneseipItoecmxoogrtenifoATelaoswxpomodryarNi,hnsettwnaelosposrwlanon,gae,buirsCtyEsfenoohrierosonhAlexdkmeapinucaoapinngtgoiniearcfocponiesenf,cdlhoimseeaene.w.5euldlcDwsdGftLis5r?tRiolo,eieiwlliansligk,aedSittmcoajswErnhhmeouthbnaidebao,ex.regllseitvsieylupncetome,o.edhtekoaslglfitfitrbmdbfIthoosh?Vi’feoaeeeesvreuvernTrnueier,tyetssudnactebheraatolnken.rreoeon.tuea)nemmohrfononaPaepeerkaeteocnwsgrlariivnhorfsrl.WkfeoiToita,goeeyn.fYow.lrridoEyegankoFhetrttamm.tbhhhEauotrerayoeaeeess.-rrrt.
Act was designed to force colonists to onpotiwon(sthaerethmieavneys: awlshoeewlcehntaiarftteernnthise,
use special stamped paper in the print- aprcehrseoryn,al rionwfoinogf, dwehceaeslcehdavireterruagnbsy).,
ing of newspapers, pamphlets, alma- trTahcke VaAndis ofifefledr,ingeqcuredstirt-imano,nistonroiwng-
nacs and playing cards. bsoearrvdiicnegs,abt inaothclosnt,. cArloesrsts-cwoeuntroyutskbiy-
dtfnmodfevhsgCipwCfgnUoddalMomliAcmsuiaAVUtprrbdtoSLtbwtUaJwcmsbAI“pgwpBcAsciaa$fGdtEtRPaCNi(P1t“gfatswatteaaaDicmwobii“sbmimAnagmcOglsfRh1craNthnuhesnaioieahinorsIeeoaro1hhnuonrynnhrornehsHdouvwararufnnfufaiilouiieiBeesauihuivle39rxoocnonhGroo7roiaryaof•••••••••••laiair•••araodonatoe..rmeylv•••••••teeiratacoaoereaetpiecnoeosaogereometrfawnceegeauaaro9oggecpyalseundndsierectvaserbddSSbkezcftrsegtiyermaTplvni02dnaldmtu1neFlullilsfsfOCs.ondapOerlwaaattnOxvpdni,mmzdtpeOOtrgroinOrturnstrrgOOnioOtOsnOtOau.eOcevzemctieOoWOnOad)rhpO’iull2iocinrtartztia,iOyo,eavlemOieOeleevseoO..7gteio6WoieneobetcoprbnelhiOrmtirrIbwiesfteocinhrdtergorrepctoasm,hia,dapiylasonenmeetdtoiDeatiremheysdstdaendnpl5pmlnesbnkfBtsjnif”rtaayeuerdentnartdaownnro,ehei,hhnnsas©nnennlpnmr,enngnsonnnnfpterhbeiennteecoVezeraflosrlnai1unamnenoYrnefs-hoianpdlettnssh.uitkcdaibessunealarTne,tcr)etsnhsegrisfnPeiedsigaetltemfoftgivrtteaaNfuroFisihoyurclkhiciioveoaediitsogklftFOdnibNeeNi!t0lcMaosuariNrOsstiidsfstwUno,oeorsmdnsC,rohgF2nMNoa.eeirNOyaddnaoNicnoeooignOilNtoOednucentFnhnladssFannl’inieiarhlecNetaonenhcasnlirdeeeSmeinttfeesNtfo.tetnitoitafbesH0odtdnFycntHafseoeaToiasftGifawcben.hcoreFweaPwdunncsesfJrirtfthsiterooooreshaeLiettartnoicnohldbddNw”waah’geeneegndHeccooooein2ecepaittoabavttlneewacmsahaa.mecp.tllabczarturkaadobmhayrcoiteieenhcdvamshluswAti,lodtn,vgFobrbmhxaIenhthveekvaaeraov0lrlidsoueebopioitbml”vfnihsreeveedhoknjeveaenanlwcvlttepaote’niAtWl.anpawtroiohidsoCtv.i:socdo“iye’tvsleb.itttdoeofdradiotoow.hrvi.Jreisvb.r.em.,anhahtnc.asiphies.ao.apnt.Hei.ccoorpcsm.l.rgspt.shof.tnehamM.asHenetstifenss2rishf3tF.aocLrpenpdgtulAe.lffdrtuaJrigshr“oef2v2TveGd.ln.oIos2aiheitynhsnia4crcrnnr1oaiteome3.clreienaroyi2oiorsinkaAhe1tchcfer2sd1odnderdts2aJaeaeontiT5lwAvgtfu22adiohe2,rvor3t2worenaunareo1d.nEanutpliunhannsa2a8del1yedrNcefhe1ionresymegeerG.Hs,9snind-hng.ya(1arrosokalNuwssar0fsla2ef3eit78iolesa1tadpifttp2re9relga,oaw0see6noraem,Qlt0barg0sdssCiweaLmrefi9prm1s1cAltsae2eg—a1iuipt,sfssutmr,eomrTnnrn,oTumcmdls1rcawdcaRsiib,camew’ferBni,rtdsga,urnm4mcs,faaf,sioah7rfonbeureshTi1o3rnK7tkai,iWuo,,e’.o1yLm,grdsoceoevae,sekeAd,isbidtai,,t78iha1ameet119c1iCoaerrsdamoe“Nodlutnerhorppmul1t9mddoisidaeeetefahtir1il,ecogdtsnnta1bbeanB71l-imtfee’l,n1olb7e,gheslwemdumi“e.ar9eoycnn1ir1ioshhnnerptasipmo1nde7a,cocesCel8ah1ei9hMy9521bsiNcelaamwmoe1obsda1clg9esesrm2Ftlhuireetbometnbhvueahc9rte9dideoelsl9rd7eem-.inLoetry9e3sraeH.oda-mr913tpemyyin9adrvaiaheasekbal,Ooee89tsseBcitkod8al88teedaa27.uk9aati1n7atdcnca68sMneoproe8urscrikao-oigifri1slsTerlbl3tdhrni5ss..w7nisaloaY,ullsr1sroaVdec4hs2oceuDptpnmh29evlwid0nekaisia7nasendaciyeeairt8nechisoAne6ra6tonvtr91key9t)0o9ofmoatet97StuNosohhpia,mesumtaG.mnF6beg9GfGbirt87iwdinne,nrerld8NRaahrt.rttadtohfiP7st,pdtstemceer34i1bloaicpi,aac-oc,narur1kesTnCmteldasess4OmA,os,8ntnni5A0vsol,Rnf8sr,otuhoe8oo’rsdriihtY.wltddma,ceonaedn5yPytba,mthot,lnieiwGgaHae8eFxooaedeadufbbfeora,hoenohn,7fsrpsep4eClaritrransgrhr:wadSa,aeNoefmth,iP,ortpt—o8enntcu,Bhaw,’o,ecetsertew“aagoohojtgesatnAe.k7recGaeTPTid1wghottdrare5dtiaiommrcsiuenrrsrirfsucut,yjnwn-NeshubtesnfBoeiwhusr“tetwlreaaaaaiaeeDad,zrigwarsme-fotrxtdSanwsBgwREsteyrnAhrawoOvouaunsnruaIiihttrartn,mtyd,nrrhheulnrorly(eaano,i3ryoataA.btkonhlowtleisrrveatyorretr9fheTgusmsretotmneeheh0Hvhtodcetcttaosasm“eeaspBthrykrtnronbiyaereicntaddhumnmletBerdoipmosnoGeeHSeerautaluealatiatsFyieo“4chlaenasatilGtaaloaeOmbenaidwa0tdypioeiriaAdhodflinrpeg,azb0peataredsyyiccehsTo2’oidrouEMgpiyeoraraGe.lplhvmetfLt4orwngtntustpdhysiinnbvkgmaroboaTipadlsaornyet6gbonruoe”nosHsrPkumectbtwiei9iuraUeideseusthbiueei“eiotlod0e,utoanseiCcVVua”lpapantfo4brrldCgsn”roaonyoWnt0khenrner”hcnrlhchiota“rlnnugnog-.efeledeydohlhseudgWaeetrnlrlagttnonnnlhaireRhn,frcoCSatr-aiacuhFrgnieeasivrentitTeiarnbntnitstreoaconaoo.abaaolaeviksrfeotmk.asboReraHeciittlssoieidilfsidndiele(mwe(naofohaedetrrlnfauALhmhntlarrgatioifacsnryeottnsioSbdWrsorrkngvgerwrstiooiahtiedr”xlcaheeosyoluepFwwihftnlc1urslflwoOu1toCddsenteotlossfooenyld,snesorhneevngtrhtiotenvfcegolngni.kiedt.ereeenhaoveoiwddhtcwuopaLinhftvasuiuatAt.tt.isirnei,sirethertnoetdmrT,eroIswCfnbss8.talsrnSn,aC9rtdrm.rpnPsdialadhowreetsaletnpnoadrsDidGihoHowealnn.aFAntessainelrOlomt(t,dprcisoemtueignotalelsletTdGm.de.oimtePidydnEieelergnawbfpeW7sFooaepnsoadl2oei,haONrhecrcWw1gsfnrieatScl1iliutuJdm”atrsxaan,libtnallwgohaWohtndnkoddOTrGeepnBgogslseLsatioimnfpmsciMsuteurewinleaotetfia”ommawaaa.olcaLdeeeiloto.etae6nocddeanha7odieshw7io,etinrl9mmtconChlrncrHdm1rpiaeigergsmfarrao“urileCcaeeehldil”oawelalaulaffhlcfNgreibyhcolitlftstisv.ngnhrhhiiTolcuabkrvaotgLonrofnaharpieit)aaaauioWil,ceu)oOaiaykgiuifesug2utffiTelictstuouegcherfprw9nrlctonitrerncseomeaieeerislio.nhyoireisa.ocigynnnanuos.nininioeievtrteinaoguehitvllgchepntapaatntwehleatztaceotluesdhnneegosnh.gdmeoIgim.mititneasctle0mrihassrtslrla.ndtil4tolengorhicdreets.fhhhifnllihhaeceelaub”gssnhdghhngdypnnonrlointaIaehndrilaitceeee”eliiesuherenlashnwlasesassysiityrrse--isf---f---rfrsyiirI’iisilltt.,,.)y.yhnogro2dyndynndnnydeeedannndoaeeaeeaeeecsss”easss--------rssssr--rf--ttt-tr-r,,,,,ltttltt.,,,..,,,, inmgaailndtomtahnoys,emvaenteyramnosraef.fected, with
iTnostruficntidonsporntshoinw ytoupr roatreecat, ppeur-t
• O©©n22002N109oHHAAveell.lalarrRRss2titiggC,Chhototsms1mRRm9mee6ususen0enririvc,vcaeaetdtidaioonnss,l,aInInnccd. .mark Sspoonratsl iCnlfuob. (FIifnydoeur idnidthneostegaerct hanboaxleartt
dvrcstoahetwlocmD[email protected]ssrbo,vfslue.’ee,iiiogrbn/tayttmrdavecenrtdoyfnoanematotaviaavuhdlaunre.cdnsltgyg.nielmheg.spts.lyYrowvaa,ie,rssaotavOctoioedfceeenedi.utacutyf./l.rnlteh)gltiyes’casehhpoteIlr,,[email protected],SuiFdspqtiCrtrhpnagiSrouolrtcloniioeaoCreowCssatscgdrnshttluVties.triaeshniaswzapieor4ovotgbamaetognwVefteotr.lmrsidt/rt.epyuwooh.yateeoatuntens.hrrnbprspvsssoeeHolpSeacoorynttalatulodnhehiget’engtpnleraaarsirpdaee---r-ttlt.
sAnanrdlyfomr vesesteargaenstowthhoe nCeoemd nmeiwtteweaoyns
toVedtearalnws’iAthffsatiresscslaaimndinagntxhiaettiyn, a$d1d.i5-
mtiollniotnoisthgeoi4n6g,0to00eqvueinteerathnesr,aapnyo, theart
is1,7w,0o0r0kinpgrowviidtehrshowrseerse anafdfelcetaerdninags
hwowell.itNcoatnsoo. pTeunrnsneowut tdhoaot rtshetroe wcoepre-
in1g7.,0(0D0idtoytaolupkrnoovwidetrhsatwbhioocuhseemd itchael
cchoamngpeusteorccpuror ginratmhe, bbruatinonwlyhil1e3wwoerkre-
iwnifmwugnwpwda.sibctgtlheordaghbsoab.rvnesadde..sgo?of)vtW/hVoaAstcen,htaogtnhele/y6v3si1idx2e8oh.aadt

©©22001290KKininggFFeeaattuurreessSSyynndd..,, IInncc..

Page 8 TO ADVERTISE: CALL (970) 744-0558 www.fortcollinstidbits.com

Answers

Commercial and Residental
High QCuCaoolmmitymmUeerSrcc,iiaaSlltaaatnenddaRnRedessiMiddeielninttataarlly Flags
HHiigghh QQuuFaallaliittgyypUUoSSle,,sSS&ttaatAteecaacnendsdsoMMriielliisttaarryy FFllaaggss

FFllaaggppoolleess && AAcccceessssoorriieess

DIDAILALUSUTSDIOTAOL US TO LOCK IN YO UR PROUFRUITRPRPORFOIFTIT • $3,000 sign-on bonus
LLOOCCKKININYYOO •••C$$3o3,m,000p000etssitiigigvnne--oomnnilbeboaognneuussrates

WHELOLOC 1100CK00 10KLT0 TOC 10K0 T RUCKI NGEET INNCGENE.TGEEEIETTNICN.C.2201•••ACCdoodmmitppioeenttiiattiilvv$ee.0mm8iillceeeaanggteesrrfaaottreeossversized loads
3 16TH STR •••AAAddddddiiitttiiiooonnnaaalll$$$...000588ccceeennntttsssfffooorrrhooavvzeemrrssaiiztzeeloddalldoosaaddss
WHEWWHHEE 222200112201 •••$AA.0dd2ddiiPttiirooonndaaullc$$t..i00o55nccBeeonnnttsussffoo&rr h$ha.a0zz1mmSaaattflleootaayddBssonus
RRUUCCKKIIATL3A31N616DTTH, WHSYSTOTRR8 •••P$$a..00id22 PVPraroocddautuicocttniioosnn BBoonnuuss && $$..0011 SSaaffeettyy BBoonnuuss

ATATLALANNDD, W, WYYOO88

•••4PP0aa1iidKd VV&aaPccaraottiifooitnnSssharing
•••P44a00i11dKKH&&eaPPlrtrhoo,ffiiDtt SeSnhhtaaarrlii,nn&ggVision Insurance
•••2PPaYaiieddaHrHseeavalelttrhhi,f,iDaDbeenlnettaaellx,,p&&eVrViieissniioconen &IInnscsuluerraaannnccMeeVR
•••N22oYYpeeaeartrsspvoveleircriiyffiiaabbllee eexxppeerriieennccee && cclleeaann MMVVRR
••••••••FDNDFNFDaeaoeaoemdmdmdppiiiciicleclelyayaytatttotpoepoeewodwodwdlnlnirnirrcecoeoeoydyududuttateaaeensnnssdddppporororoopoppvveveeiirirdrdadaaeetetteeeffdfldldleeesxsxsxiiiiinibnbnbclclcleeeeehh1h11oo9o99m5m5m566e6eetttiiimmmeee


Click to View FlipBook Version
Previous Book
KANCIL DAN BUAYA
Next Book
Oriflame katalógus 2020/16