KK OOF FTHTEHEWWOORLRDLD
THETHPLEEPALSEUARSEUOREF OVAF RVIAETRYIEOT YNOYNOUYROUPLRAPTLEATE
What is sous vide ?
Sous vide, which means “under vacuum”
in French, refers to the process of vacuum-sealing
food in a bag, then cooking it to a very precise temperature
in a water bath. This technique produces results that are impossible
to achieve through any other cooking method.
Because you Food cooks in Traditionally cooked
cook your food its juices. This ensures steak loses up to 40%
to a precise that the food is of its volume due
temperature for a moist, juicy and to drying out.
precise amount of
tender. Steak cooked via
time, you can precision cooking,
expect very KTHE PLEASUORE OFF VTAHRIETEY OWN YOOURRTaste
consistent results. loses none Traditional cooking
of its volume. can require your
RedWuacsttieon constant attention.
Precision cooking
brings food to an
exact temperature and
02 Rice Bowl Sous vide Flexibility holds it. There is
no worry about
Consistency overcooking.
provides the
following bene ts
K OF THE WORLD
What is sous videTHE PLEASURE OF VARIETY ON YOUR PLATE
Sous vide, which means “under vacuum”
in French, refers to the process of vacuum-sealing
food in a bag, then cooking it to a very precise temperature
in a water bath. This technique produces results that are imposs
to achieve through any other cooking method.
Food cooks in Traditionally cooked
its juices. This ensures steak loses up to 40%
that the food is of its volume due
moist, juicy and to drying out.
tender. Steak cooked via
precision cooking,
D
loses none
ATE of its volume.
Because you Taste RedWuacsttieon Traditional coo
cook your food can require yo
Consistency Sous vide Flexibility
to a precise provides the constant attent
temperature for a following bene ts Precision cook
precise amount of brings food to
exact temperatu
time, you can holds it. There
expect very
consistent results. no worry abo
overcooking
Sous Vide
Chicken Rice
0034 FrRiiecde ChBiocwklen Chop CB1- Korean Spicy Braised Chicken RM8.90
RM8.90
Popcorn chicken are braised in spicy Korean sauce. The result is amazing! Its so delicious RM8.90
and heart warming! Its a perfect main dish to serve with steamed rice and egg. RM8.90
RM8.90
CB2- Taiwan Dry Pepper Salt RM8.90
RM8.90
Taiwan popular street snack. It consist of bite size pieces of chicken, coated with salt and RM8.90
pepper seasoning. RM8.90
RM8.90
CB3- Indian Butter Chicken RM8.90
RM8.90
Popcorn chicken in a rich gravy (a.K.A. Curry) made with tomato, butter, and RM8.90
a special spice blend as a base. RM8.90
RM8.90
CB4- Japan Miso Chicken
Chicken is very moist, flavorful, and delicious. Serve over steamed rice and
drizzle extra miso sauce on top!
CB5- Chinese Mongolia Chicken
Chicken is crispy slices of chicken breast stir fried in a sweet and savory sauce.
CB6- Japan Chicken Katsu
The taste is very unique, with tartness from the Worcestershire sauce, slightly
salty and sweet at the same time. It's also thicker.
CB7- Hong Kong Onion Chicken
Chicken sweet, tangy caramelized onion sauce, this is a weeknight Dinner!
CB8- Japan Teriyaki Chicken
Teriyaki chicken is a Japanese dish with savory and sweet teriyaki sauce. This is the
best chicken teriyaki recipe that calls for only 4 ingredients. So easy!
CB9- Malaysian Honey Chicken
Honey chicken with crispy chicken in sticky and sweet glaze.
CB10- Chinese Kung Poa Chicken
Kung Pao Chicken is from the Sichuan province in China. The Chinese name is
(gong bao ji ding) but some restaurants spell it as Gong Bao Chicken or Kung Po Chicken.
CB11- American TSO Chicken
General Tso Chicken (also called General Tso Chicken) is one of the most popular
Chinese recipes and most ordered chicken dish in Chinese restaurants in the United States.
CB12- Hong Kong Sweet & Sour Chicken
The dish comes complete with crispy fried chicken cubes with mouthwatering sweet and sour sauce.
It goes well with steamed rice, fried rice or chow mein.
CB13- Hong Kong Honey Lemon Chicken
Honey Lemon chicken is a popular Chinese recipe sweet, sour and refreshing. If you love Chinese food,
you will love this simple and delicious dish.
CB14- Hong Kong Cha Siao Chicken
Delicious oven-roasted chicken with sweet, sticky and savory Chinese Char Siu marinade.
This chicken is finger licking good.
CB15- Indonesia Rendang Chicken
Amazing Malaysian-Indonesian chicken stew with spices and coconut milk. Deeply flavorful.
The best rendang recipe ever!
B11- CSBou1s1-VCSidBoeuA1s1-VmSiedroeicuAasnmVTeidrSiecOAanCmTheiSrcikcOeannCThiSckOenChicken
eneral Tso CGhiecnkerna(l aTlso cCahGlliecedkneGenrea(nlaeTlrsasoolcTCalshloeicdCkGheniecnk(earnlsa)ol iTcsaoslolneeCdohGficetkhneenrm)aloisTtospnooeCpohufiltcahkrenm)oistopnoepouflathre most popular
hinese recipesCahnidnemseorsetcoiprdeseCraehndidnchmesiecoksrtencoirpddeiesrhaeidnndcChmhicoiknsetensoerdrdieshsrteaidnurcChahnicitnkseinsedtrhieseshtUaiunnrCaitnhedtinsSeinsteatrhtees.tUaunriatendtsSintatthees.United St
04 Rice Bowl
05 Fried Chicken Chop
Sous SVouidse Vide
FriedFCrihedopChop
FCC1- Korean SpicyFBCCra1i-seKd oCrheiacnkeSnpicy Braised ChickRenM13.90 RM13.90
The sauce is rich in taste with strong aromTahaensdahueclepis troicbhrianisteatshte wfoiothd sttorong aroma and helps to braise the food to RM13.90
reddish-brown colour reddish-brown colour RM13.90
RM13.90
FCC2- Taiwan DryFPCepCp2e-r TSailwt CanhiDckreynPepper Salt ChRicMken13.90 RM13.90
RM13.90
Dried peppers have just as much of the capDsariceidnpaespfprershs hoanvees,jjuussttains ma umchoroef the capsaicin as fresh ones, just in a more
concentrated space. so technically they tendcotnocbenethraotteedr.space. so technically they tend to be hotter. RM13.90
FCC3- Indian ButteFr CChi3c-keInndian Butter Chicken RM13.90 RM13.90
RM13.90
A sauce made of melted butter, often dilutAedswaiuthcewmaatedre, osofmmeetlitmedesbtuhtitcekre,noeftden diluted with water, sometimes thickened RM13.90
with flour or egg yolk, or both, and seasonwedithwiftlhoulermoronegjguiyceo.lk, or both, and seasoned with lemon juice. RM13.90
RM13.90
FCC4- Japan MisoFCChiCck4e-nJapan Miso Chicken RM13.90 RM13.90
RM13.90
Miso is a fermented paste that's made by Minoicsuolaistianfgerammenixteudrepoafste that's made by inoculating a mixture of RM13.90
soybeans with a mold called koji soybeans with a mold called koji
FCC5- Chinese MonFgColCia5C-hCichkiennese Mongolia Chicken RM13.90
Whisk the mongolian beef sauce ingredienWts thoigsketthheermcoonnsgisotilniagnobfeseofysasauucceei,ngredients together consisting of soy sauce,
water, brown sugar, asian sweet chili saucew, aritceer,wbinroew, hnosiusigna, rp,eapspiaern,swriereatcchhailai nsaducoe,rnrisctearwcihn.e, hoisin, pepper, sriracha and cornstarch.
FCC6- Japan ChickFenCKC6at-suJapan Chicken Katsu RM13.90
Sauce contains an abundance of vegetableSs auncdefcrounitsaliinkseatnomabatuoneds,aonncieonofs,vceagrertaotbsl,easpapnldesf,ruits like tomatoes, onions, carrots, apples,
lemon, and prunes. the natural sweetness alenmdosonu, rannedsspcroumnesp. rthime anraitluyrfarlosmwetehtenfelsasvaonrdofsourness come primarily from the flavor of
these vegetables and fruits. these vegetables and fruits.
FCC7- Hong Kong FOCniCon7-CHhiocknegnKong Onion ChickenRM13.90
Onion sauce is a strong accompaniment, pOernfeiocnt fsoarutcheoiseawshtroolnogveaaccsotmropnagnerimtaesntet,fpoerrfect for those who love a stronger taste for
grilled or boiled meats or to enrich a cheesegbriollaerddo.ritbs ouinlefdormgetattasbolre btoitetnerrsiwcheeat tcahsetese board. its unforgettable bittersweet taste
requires just a little effort compared to otherreqsauuirceess.j.ust a little effort compared to other sauces..
FCC8- Japan TeriyFakCi C8hi-ckJeanpan Teriyaki Chicken RM13.90
A sweet and tangy sticky sauce, authentic Atersiwyaeekti adneldivtearnsgaybsitgichkiyt osafusacelt,yaumthaenmtic teriyaki delivers a big hit of salty umami
from its simple base of soy sauce from its simple base of soy sauce
FCC9- Malaysian HFoCnCey9-ChMickaelanysian Honey Chicken RM13.90
Honey sauce is the most incredible sweet, tHanognye,yasnaducereiasmthye msaouscteimncardedeifbrloemsweet, tangy, and creamy sauce made from
simple ingredients like honey, mustard, masiymopnlneaiinsge,rvediniengtasrl,ikaenhdoanceoyu, pmleusptaicreds, mayonnaise, vinegar, and a couple spices
FCC10- Chinese KunFgCPCo1a0-CChihcikneense Kung Poa ChickenRM13.90
The sauce and marinade contain soy sauceT, hcheiscakuecnebarnodthm, vairniengaadre, conrntastinarscohyasnaudcceh, iclhi picaksetne broth, vinegar, cornstarch and chili paste
FCC11- American TSFOCCC1h1-icAkemn erican TSO Chicken RM13.90
It is sweet, sour, and spicy all at the same tIimt ies.sywoeuetc,asonuarl,saontadsstpe iscoymaelluamt athmeisainmtehetirme,e. you can also taste some umami in there,
brought about by the hoisin sauce brought about by the hoisin sauce
05 Fried Chicken ChopFCC12- Hong KongFSCwCe1e2t-&HSoonugrKChonicgkeSnweet & SourRChMick1en3.90
Sweet and sour sauce tastes just like it sounSdws.aeeltitatlnedbsitouswreseatuacne dtaastleisttjluesbt iltikseouitrsaotunthdes.saamlitetle bit sweet and a little bit sour at the same
time. you will also have notes from whatevteirmyeo.uyofluavwoiullrailtsowhitahve notes from whatever you flavour it with
FCC13- Hong KongFHCoCn1e3y-LHemonognKChonicgkeHnoney LemonRChMick1en3.90
This oriental sweet and sour recipe combinTeshtihs eorsiceennttaolfswleemetoannwditshoutrherescwipeetctoamstebionfehsothneyscent of lemon with the sweet taste of honey
FCC14- Hong KongFCChCa1S4-iaHo ConhgicKkenong Cha Siao ChickRenM13.90
Here's a fairly common base set of ingrediHenetrsei'nscalufdainrlgyhcoimsinm,ohnonbeayse, soeyt osfaiuncge,resdhieernrtys,including hoisin, honey, soy sauce, sherry,
chinese five spice powder that imparts the uchbinquesietofuivseflsapvicoerpaonwddgelrostshyasthimeenpatrotschthaer usibuiquitous flavor and glossy sheen to char siu
FCC15- Indonesia RFenCdCa1n5g-CIhnidcoknenesia Rendang ChickenRM13.90
He sauce is made with aromatic spices likeHcine nsaaumceonis,mcaardeawmiothmaarnomd sattaicr sapniciseesaliskwe eclilnansamon, cardamom and star anise as well as
fresh aromatics including lemongrass, garflirce,sghinagroemr aantidcsgianlcalnudgianl.g lemongrass, garlic, ginger and galangal.
SousSVouisdeVide
KatsKu aCtsuhopChop
FCB1- Korean SFpCicBy1B- rKaioserdeaCnhSicpkiecny Braised Chicken RM11.90 RM11.90
The sauce is rich in taste with stronTghaerosamuaceains drichhelipns taosbterawiistehthsterofonogdatrooma and helps to braise the food to
reddish-brown colour reddish-brown colour
FCB2- Taiwan DFCryBP2e-pTpeariwSaanltDCrhyicPkeenpper Salt ChickRenM11.90 RM11.90
Dried peppers have just as much ofDthriedcappespapiceirns ahsafvreesjuhsot naessm, jucsthinofathmeocraepsaicin as fresh ones, just in a more
concentrated space. so technically tchoenycetenntrdattoedbesphaoctet.erso. technically they tend to be hotter.
FCB3- Indian BFuCttBer3C-hIicnkdeinan Butter Chicken RM11.90 RM11.90
A sauce made of melted butter, oftAensdaiulucteemd waditehowf amterlt,esdombuettiemr,esofttheinckdeinluetded with water, sometimes thickened
with flour or egg yolk, or both, andwsitehasfolonuedr owritehggleymoolkn,jouricbe.oth, and seasoned with lemon juice.
FCB4- Japan MFiCsoBC4h-icJkaenpan Miso Chicken RM11.90 RM11.90
Miso is a fermented paste that's mMadeisboyisianofceurmlaetinntgedapmasixtetutrheaot'fs made by inoculating a mixture of
soybeans with a mold called koji soybeans with a mold called koji
FCB5- Chinese MFCoBng5o-liaChCihniecskeeMn ongolia Chicken RM11.90 RM11.90
Whisk the mongolian beef sauce inWgrhedisikentthsetomgoenthgeorlicaonnsbiesteifnsgauofcesoinygsraeudcie,nts together consisting of soy sauce,
water, brown sugar, asian sweet chwilai stearu,cbe,rorwicenwsuingea,rh, oaisiann, pswepepeterc,hsilriirsauchcea, arincde wcoirnne,sthaoricshin., pepper, sriracha and cornstarch.
FCB6- Japan CFhiCckBen6-KJaatpsuan Chicken Katsu RM11.90 RM11.90
Sauce contains an abundance of veSgaeutacbelceosnatnadinfsraunitsalbikuentdoamnacteooefs,voengieotanbs,lecsaarrnodtsf,raupitpslleisk,e tomatoes, onions, carrots, apples,
lemon, and prunes. the natural swelemtnoenss,aannddsporuurnes.stchoemneapturrimalasrwileyetfnreosms atnhde fsloauvronreossf come primarily from the flavor of
these vegetables and fruits. these vegetables and fruits.
FCB7- Hong KFonCgBO7n-ioHnoCnhgicKkeonng Onion Chicken RM11.90 RM11.90
Onion sauce is a strong accompaniOmneniotn, psaerufceectisfoarstrhoonsegwahccoolmovpeaanismtreontg,epretrafsetcet for those who love a stronger taste for
grilled or boiled meats or to enrichgariclhleedesoerbbooairledd. imtseuantsfoorrgteotteanbrliechbiattecrhseweseetbtoaasrted. its unforgettable bittersweet taste
requires just a little effort comparedretqouoirtheserjussatuacelist.t.le effort compared to other sauces..
FCB8- Japan TFerCiyBak8i-CJhaipckaennTeriyaki Chicken RM11.90 RM11.90
A sweet and tangy sticky sauce, auAtheswnteiecttaernidyatakni dgeylisvteicrksyasbaiugche,itaoufthsaelntyticutmeraiymaiki delivers a big hit of salty umami
from its simple base of soy sauce from its simple base of soy sauce
FCB9- MalaysiFanCHB9on-eMy Cahlaicykseiann Honey Chicken RM11.90 RM11.90
Honey sauce is the most incredibleHswoeneet,ytasanugcye,ias nthdecmreoasmt iyncsraeudciebmle aswdeeftr,otmangy, and creamy sauce made from
simple ingredients like honey, mustsaimrdp,lme ianygornedniaenistes, lvikineehgoanr,eya,nmd uasctaourdp,lemspaiycoesnnaise, vinegar, and a couple spices
FCB10- ChineseFKCuBng10P-oCahCinheiscekeKnung Poa Chicken RM11.90 RM11.90
The sauce and marinade contain sToyhseasuacuec,echanicdkemnabrriontahd,evcinoengtairn, csorynssataurcceh, cahnicdkecnhiblirpoathst,evinegar, cornstarch and chili paste
FCB11- AmericaFnCTBS1O1-CAhmickereincan TSO Chicken RM11.90 RM11.90
It is sweet, sour, and spicy all at thIetsaismswe eteimt, es.ouyro,uacnadnsapliscoytasllteatsotmheesuamaemtimi ine.tyhoeurec,an also taste some umami in there,
brought about by the hoisin sauce brought about by the hoisin sauce
FCB12- Hong KFoCnBg S12w-eHet o&ngSKouornCghSicwkeent & Sour ChiRckMen 11.90 RM11.90
Sweet and sour sauce tastes just likeSiwt esoetuanndds.asoluitrtlesabuicteswtaesettesajnudstalilkitetliet sboiut nsodusr.aaltittthleebsaitmsweeet and a little bit sour at the same
time. you will also have notes fromtwimhea.tyevoeurwyoilul aflsaovohuarveitnwoittehs from whatever you flavour it with
FCB13- Hong KFoCngBH13o-nHeyoLngemKoonnCghHicokneney Lemon ChiRckMen 11.90 RM11.90
This oriental sweet and sour recipeTcohmisboirniens tahlesswcenettaonf dlemsouonr rweictihpethceomswbeientetsatshte oscfehnotnoefylemon with the sweet taste of honey
06 Katsu Chop FCB14- Hong KFoCnBg C14h-aHSoianogCKhiocnkgenCha Siao ChickenRM11.90 RM11.90
Here's a fairly common base set ofHinegrree'sdaienfatsirilnyccluodminmgohnobisainse, hseotnoefyi,nsgoryedsaieunctes,isnhcelrurdyin, g hoisin, honey, soy sauce, sherry,
chinese five spice powder that impacrhtisntehse ufibvieqsupiticoeups oflwavdoer athnadt gimlopssayrsths ethene utobciqhuairtosuius flavor and glossy sheen to char siu
FCB15- IndonesFiaCRBe1n5d-aInngdConheicskiaenRendang Chicken RM11.90 RM11.90
He sauce is made with aromatic spHiceesslaikuececiinsnmaamdoenw, ictahradraommoamticasnpdicsetsalrikaencisinenaasmweolnl ,acsardamom and star anise as well as
fresh aromatics including lemongrfarsess,hgarloimc, agtinicgseirncalnudignaglalenmgoanl.grass, garlic, ginger and galangal.
Sous Vide
Grilled Chop
07 Grilled Chop GC1- Lemongrass Grill Chicken Chop RM13.90
RM13.90
This lemon grass sauce recipe is a fusion of Asian and Spanish flavors and RM13.90
relies on fresh ingredients RM13.90
RM13.90
GC2- Salted Egg Grill Chicken Chop RM13.90
RM13.90
The irresistibly salty, rich umami flavor lends itself well to so many uses, and RM13.90
today’s restaurant chefs are latching onto people’s love for them. They’re not RM13.90
just using them whole, they’re also using it as a condiment in sauce or paste form. RM13.90
RM13.90
GC3- Creamy Garlic Grill Chicken Chop RM13.90
It's made with basic ingredients such as butter, garlic, and Parmesan cheese.
The flavor of this sauce is everything you expect: creamy, garlicky, and rich
GC4- Creamy Mushroom Grill Chicken Chop
Miso is a fermented paste that's made by inoculating a mixture of
soybeans with a mold called koji
GC5- Satay Peanut Grill Chicken Chop
The strongest tastes should be sweet and salty in order for the finished satay to taste its best.
Add more sugar or more fish sauce (in place of salt) to adjust the taste.
GC6- Yakitori Grill Chicken Chop
The yakitori sauce tends to be the star of this chicken dish. It's a combination of umami
and sweet flavors, soy sauce, mirin sweet cooking wine, brown sugar for sweetness,
rice vinegar for acidity, fresh ginger and garlic.
GC7- Szechuan Grill Chicken Chop
Szechuan sauce tastes like if you took a classic suburban American Chinese restaurant's
sweet-and-sour chicken and mixed it with some soy sauce and maybe a hint of sesame.
It's goopy, sweet, and very salty — and, in its own right, it's a pretty tasty option
GC8- Gochujang Grill Chicken Chop
Gochujang has heat — it can be extraordinarily spicy — but it also has a salty,
almost meaty depth and a slight sweetness.
GC9- Cheese Grill Chicken Chop
cheese sauce is known as one of the 'mother sauces' lifting many dishes across the
globe with its smooth, and sometimes tangy, flavour.
GC10- Black Peppercorn Grill Chicken Chop
Peppercorn sauces can be zesty, smoky, spicy, a sweet or a blended combination of all of
those flavors. But most of all they should have that classic peppery taste.
GC11- Rendang Grill Chicken Chop
Hours of bubbling turns the protein soft and spoon-tender, taking on all the intense
tropical aromatics of the coconut, chiles, and spice. And along the way, the coconut
milk deepens into a nutty, buttery sweetness.
GC12- Adobo Grill Chicken Chop
In general, adobos are spicy, zesty, savory and often tangy. If you get a can of
Mexican chipotles in adobo sauce, you'll find it richly smoky.
SouSsouVsSiVoduesi-dVeW-idWe h-olWehoLleghLoleeg Le
ChCickheiCnckehRnickRiecne iRce ice
R1- HoBngRK1-onHgoSngoyKBSRoanu1g-ceSHCooyhniScgkaKeuncoRenCgichSeicokyenSaRuicceeChicken Rice
sauce chicken, aSlsoyksnaouwcencahsicSkeenY, aalsooGknaioSwinonyCasasanuStcoeeneceYhseia,ckoiseGan,acalialisnosiCckadnnioswthonloeavssed,SibseeyaYmclaaosnsiGyc.adisihnlCovaendtobnyesme,ains ya.classic dish loved by many.
ough not cookedAilnthaonugohvenootrcoovkeredaninoapnenAovfliterhneolouirkgeohvCnehroatarcnoSoikpue,dnroifnairsaetnlgikoeovseCen,heoatrrc.oS,vieur,arnoaosptegnoofisree, leitkce.,Char Siu, roast goose, etc.,
onsidered to be ait’Ss ciuonMsideeirdeidshtosobledaatSCiuanMitto’nesiecdsoeinsshtiydsleoerldeBdaBtoQCbaesnhatoopSnsie.useMstyeliedBishBsQoldshaotpCs.antonese style BBQ shops.
M15.R9M0 15.90RM15.90
BR2- HBaiRna2n-esHe CahinBicakRneen2se-RCHihceiackineannReseicCe hicken R
the flesh is marvelotuhselyflteesnhdiesrmaanrdvesillokuys,lywtiethnedaefrleisachndilsasmyilekaryrov,fewfloaituthsalayndrtiecsnkhdinlearoyanenrtdopfsiflaktya, nwdithskainroicnhtloapyer of fat and skin
like a gelée on top olfikaelaivgerelpéeâotén. Ttohpeorficaelisvleaikrlsepoaâstugébe.ltTéleyhofenlarivtcooepriesodfa,alwsoliitvshuerbhtipnlyâttsfélo.afTvohredri,cwe itshahlsionstus boftly flavored, with
chicken essence in ecvhericykebnite,ssaendceainsqeuveeerzye bocfihtleiic,mkaennoderasdsesanqsucheeoiznfeheoovfterlsiyamubecieoter, daansdhaofsqhuoeteszaeuocfelime or dash of h
is all the dish needsitsoaflilllthyeoudiushpnoenedashtotfsiullimsyoamulleutrhpdeaodnyis.ahhnoetedsusmtomfiellrydoauyu. p on a hot summ
RM15R.9M0 15.9R0M15.
08 Whole Leg Chicken
08 Whole Leg Chicken
SouSs oVuSsiodVuesiBVde iBudregeBursrgeursrgers
B1- MBC 1C-hMickCenCBhiucrkgeenrBurger
The sandwich cTonhseistasnodfwaictohacsotendsiwsths eoaftabtuonas,taedbwrehaedaetdbun, a brea
chicken patty, schhriecdkednedplaettyu,cesh, arendddmedalyetotnuncea,isaen.d mayonnaise.
RM11.R9M011.90
B2- ChiBck2en- ChoicpkeBnuCrhgeorp Burger
he sandwich conTsihstessoafnadwtoiachstecdonwshisetsatofbaunto,astcehdicwkehneat bun, a chicken
hop meat, cheesec,hshorpedmdeeadt,lecthtueecsee,,ashnrdedmdaedyolentntuacisee,.and mayonnaise.
RM12.9R0M12.90
B3- GrBille3d- BGereilfleBduBrgeefrBurger
These are the ulTtimheaseteagrreitllhbeuurlgtiemrsa.tTe ghreiyllabruerpgaercsk.eTdhey are packe
with flavor andwreitlhiafblalyvojuricayn,devrelniawbhlyenjuciocyok, edvetnowheleln-dconoek.ed to well-
RM14R.9M014.90
09 Burgers
10 CoffeeCoCffeoeffee
CD1- AmeriCcaDn1o- Americano
An Americano is an esprAessno-Abmaserdicdarninokisdaensigesnperdestsoo-rebsaemsedbldercionfkfedeebsirgenweeddto resemble coffee brewed
in a drip filter, consideredinpoapdurliaprfiinltethr,ecUonnsidteedreSdtpaotepsuolfarAimn tehriecaU. nTihteids States of America. This
drink consists of a single odrrdinokubcolen-sihstostooffaesspinrgeslseoocrodmobuibnled-swhoitthouf pestporefossuorcombined with up to four
or five ounces of hot waterorinfiavetwouon-dcesmoiftahsostewcuapte.r in a two-demitasse cup.
RM3.90RM3.90
CD2- Iced ACmDe2r-icIanceod Americano
An Americano is an esprAessno-Abmaserdicdarninokisdaensigesnperdestsoo-rebsaemsedbldercionfkfedeebsirgenweeddto resemble coffee brewed
in a drip filter, consideredinpoapdurliaprfiinltethr,ecUonnsidteedreSdtpaotepsuolfarAimn tehriecaU. nTihteids States of America. This
drink consists of a single odrrdinokubcolen-sihstostooffaesspinrgeslseoocrodmobuibnled-swhoitthouf pestporefossuorcombined with up to four
RM6.90RM6.90or five ounces of hot waterorinfiavetwouon-dcesmoiftahsostewcuapte.r in a two-demitasse cup.
CD3- Latte CD3- Latte
A caffè latte is simply a shAotcaofrfètwlaottoef ibsoslidm,ptalystay sehsporteosrsotwwoitohffbreoslhd, stawseteyt espresso with fresh, sweet
steamed milk over it. Somsteapmreefdermtoilakdodvesryritu.pSormeextprraefeesrprtoesasodtdostyhreurpecoirpex. tra espresso to the recipe.
RM6.90RM6.90Some maintain that it is Senotmirelympaeinrfteacitnatshias.t it is entirely perfect as is.
CD4- Iced LCaDtt4e - Iced Latte
A caffè latte is simply a shAotcaofrfètwlaottoef ibsoslidm,ptalystay sehsporteosrsotwwoitohffbreoslhd, stawseteyt espresso with fresh, sweet
steamed milk over it. Somsteapmreefdermtoilakdodvesryritu.pSormeextprraefeesrprtoesasodtdostyhreurpecoirpex. tra espresso to the recipe.
RM6.90RM6.90Some maintain that it is Senotmirelympaeinrfteacitnatshias.t it is entirely perfect as is.
CD5- MochCaD5- Mocha
The term “mocha” meanTs ahemtiexrtmure“mofocohfafe”emaneadncshaocmoliaxtue.rMe ofochofafseeoraingdincahteodcolate. Mochas originated
n Yemen, and they containinYaepmleans,aanntdchthoceoylacotenftlaaivnoar.pTlehaisacnotffceheoicsolate flavor. This coffee is
generally sweet and is servgeednewriathllyaslwaeyeetraonfdmisilkserovnedtowp.ith a layer of milk on top.
RM6.90RM6.90
CD6- Iced MCDoc6h-aIced Mocha
The term “mocha” meanTs ahemtiexrtmure“mofocohfafe”emaneadncshaocmoliaxtue.rMe ofochofafseeoraingdincahteodcolate. Mochas originated
in Yemen, and they containinYaepmleans,aanntdchthoceoylacotenftlaaivnoar.pTlehaisacnotffceheocolate flavor. This coffee
is generally sweet and is seisrvgeednewriathllyaslwaeyeetraonfdmisilkserovnedtowp.ith a layer of milk on top.
RM6.90RM6.90
CD7- CappuCcDin7o- Cappucino
Outside of Italy, cappuccOinuotissidaecoofffIeteadlyr,inckapthpautcctiondoaiys ais ctoyfpfieceadllryinckomthpaotsteodday is typically composed
of a single espresso shot anodf ahositnmglielke,spwriethssothsehosutrafnadcehtotpmpeidlkw, withithfotahme seudrface topped with foamed
milk. ... The top third of tmheilkd.r.in..kTchoentsoisptstohfirmdiolkf tfhoaemdr;itnhkiscfoonasmistscaofnmbeilk foam; this foam can be
decorated with artistic dradwecionrgastmedawdiethwiatrhtitshtiecsdarmawe mingilsk,mcadlledwliathttethaerts.ame milk, called latte art.
RM6.90RM6.90
Soda SDodariDnk rink
SD1- Blue OSceDan1-LBemluoenOacdeean Lemonade
The combination of three dTifhferceonmt bliuneactioolnoroefdtbherrereidesif(febrleunetbberlurieesc,olored berries (blueberries,
blackberries and blue raspbelarcrkiebs)erprileussalenmdobnlu, cerreaastpesbaerurineisq)upelfulas vleomr on, creates a unique flavor
with a strikingly Blue Oceawnithfeeal.sBtriekcianugsleyoBf tlhueatO, OcecaenanfeeBl.luBeeicsause of that, Ocean Blue is
one of Calypso's most popuolanre folfaCvoarlsypso's most popular flavors
RM6.90 RM6.90
SD2- Blue OScDea2n-MBolujietoOcean Mojito
This drink reminded me ofTthiescdrryisntkalrbemlueinwdaedtermseofofatphoeoclraynstdalisblue waters of a pool and is
beyond refreshing. beyond refreshing.
RM6.90 RM6.90
SD3- StrawbSeDrr3y-MStorjaitwoberry Mojito
This mojito is sweetened wiTthhhisomneoyjiatonids fsrweesehtesntreadwwbietrhrhieosnineysteaandd fresh strawberries instead
of being loaded with sugar.of being loaded with sugar.
RM6.90 RM6.90
SD4- StrawSbeDrr4y-LSetmraownabderery Lemonade
Vitamin C is essential for bVuiltdaimnginaCroisbeusssteinmtimalufonre bsyusitldemin.gOaurrobust immune system. Our
bodies can't produce it, so itb'sodviteaslctaonc'tonpsruomduecietivt,iasofoito'sdvaitnadl tdoricnokns.ume it via food and drinks.
RM6.90 RM6.90
SD5- TropicSalDF5r-uTit rLoepmicoanl aFdreuit Lemonade
Lemonade fruits are a goodLesomuornceaodfevfirtuaimtsianrCe atogsotordensgouthrecne othf evitamin C to strengthen the
immune system and potassimummutonbe asylasntecme falunid pleovtealsswiuimthitnotbhaelabnodceyf.luid levels within the body.
RM6.90 RM6.90
ADD ON :AMDADGOICNB: AMLALGIC BALL11 Soda Drink
P1 -Lychee MaPgi1c-BLyacllhee Mag+icRBMa1l.l00 +RM1.00
P2 -Passion FrPu2it-MPaasgsiicoBnaFllru+itRMMa1g.0ic0Ball +RM1.00
P3 -Mango MaPgi3c-BMaallngo Mag+icRBMa1l.l00 +RM1.00
P4 -Yogurt MagPi4c-BYaolglurt Mag+icRBMa1ll.00 +RM1.00
P5 -StrawberryP5M-aSgtricawBablelrry+MRMag1i.c0B0all +RM1.00