AD&D - The Lost Handbook (1e)

Dragon 48

Explanation/Description: Via this spell, body of the cleric and all of his or her Vol. VI, No. 8
the cleric or a creature he or she touches, non-living gear (not to exceed 100
up to the size of a ogre, is empowered to pounds in weight aside from the cleric in ly. Transmute Rock to Mud kills the cler-
walk on water as if he or she wore a Ring any case), he or she will be instantly ex- ic instantly and permanently. Stone
of Water Walking. The recipient of the pelled from the stone. Shape will deal out 4d4 points of dam-
spell may carry 500 pounds of material age, but the cleric can stay in the rock
with him or her, over and above his or her The spell lasts for 8 + d8 rounds. Dur- without suffering further harm.
naked weight. Weight in excess of 500 ing that time the cleric may step out from
pounds will cause the spell to fail within the stone the way he or she came into it. Negative Plane Protection
2-5 minutes. Thus, the person and that He or she may not exit from any other
which he or she carries might be in the face of the stone; thus the spell is not (Abjuration)
middle of a body of water when the spell similar to a Passwall or Phase Door. Level: 4
fails. Weight in excess of 750 pounds Range: Touch
cannot be carried at any time for even a If the duration runs out before the cler- Duration: 1 turn/level
moment. ic voluntarily leaves the rock, he or she Components: V, S, M
will be expelled and will absorb 8-32 Casting Time: 1 round
Meld Into StoFonuert(hAltLeeravteioln) (8d4) points of damage. In such a case, Saving Throw: None
all carried items must save vs. petrifica- Area of Effect: One Prime Material
Level: 4 tion or be turned to stone. If the cleric
Range: Touch steps out of the stone before the dura- creature
Duration: 8 + d8 rounds tion is expired, then items carried are not Explanation/Description: By holding
Area of Effect: Special harmed in any way. Artifacts and relics his or her holy symbol while casting this
Components: V, S, M not meld into stone in the first place but spell, the cleric protects himself or her-
Casting Time: 7 segments will stay behind. self from Negative Plane undead. He or
Saving Throw: None she partially opens a contact to the Posi-
While in the stone the cleric is aware of tive Material Plane.
Explanation/Description: By holding a time (but never knows the exact spell When the recipient of the spell is
sample of the like stone as a material duration, which the DM rolls for secret- touched by a Negative Plane undead
component, a cleric can meld into stone ly), but the caster cannot see or hear (shadow, wight, wraith, spectre or vam-
within seven segments. He or she merely though he or she can smell and taste. pire), the positive energy will cancel the
stands next to the stone (which must be The following spells aimed at the rock negative aura to some extent and may
large enough to accommodate his or her holding the cleric will harm the cleric: A prevent the draining of a level from the
bulk in all three dimensions) and then Stone to Flesh will expel the caster in- cleric or the figure he or she protected by
blends into it. If the dimensions are not stantly, with the usual 8d4 damage, but touch.
large enough to accommodate the entire items need not save. A Dig spell will do The spell recipient gets a saving throw
8-64 (8d8) points of damage, and the vs. death; if the save is made, he or she
cleric must save vs. death or die instant- takes normal physical damage from the
undead’s touch but does not lose one
There’s more! level of experience. (If the undead drains
Proud as we are of this issue of DRAGON™ magazine, we’re pretty two levels per touch, one level is lost
pleased with what we’ve done in the past. And apparently, so are our instead of two.) The spell is then can-
readers, because most of our back issues are sold out. We do have copies celled so that the next touch, if there is
of some magazines for sale, including issues #45 through #57. one, will be without benefit of a saving
throw. The undead creature will auto-
If you’ve searched in vain for a copy of one of our early issues, the two matically take 2-12 (2d6) points of dam-
BEST OF DRAGON™ volumes may solve the problem. These age when touching a protected charac-
anthologies reprint the most requested material from our first four ter who makes the saving throw.
years. Also sold by Dragon Publishing are: THE FINIEOUS TREAS- If the saving throw is failed, the cleric
URY™ collection of adventures featuring the hero of our most popular or figure touched takes double physical
comic strip; and DRAGONTALES™ anthology of original heroic fan- damage plus loss of the level as well (a
tasy fiction and art. spectre or vampire would drain two lev-
els as usual). Instead of absorbing points
SEND ME COPIES OF THE PUBLICATIONS MARKED BELOW. of damage, if the spell recipient’s saving
throw is failed the undead may add that
(Please indicate the number of copies of each issue desired. Include $4.50 for amount (2d6) to its hit-point total, up to
each copy.) its normal maximum.
All such Positive/Negative Plane con-
— # 4 5 — # 5 0 —#54 ————TBBDHEERSSEATTGFOOOINFNFITEDDAORRLUAAESGGSO™OTNNR™E™AAnVSVtUhooolRl.l.YoIgI™Iy Collection tact will cause a bright flash, and a
— # 4 6 — # 5 1 # 5 5 thunder-like crack of sound will be heard.
# 4 7 — # 5 2 — # 5 6 No damage is caused by the flash or
— # 4 8 — sound. The protection will last for one
— # 4 9 —#53 —#57 turn per level of the cleric or until the
— cleric touches a Negative Plane undead.
The spell will cause the cleric to ex-
Send check or money order to: plode (instant and irrevocable death) if
he or she dares to cast it while on the
DRAGON PUBLISHING Negative Material Plane. The spell will
DIVISION OF TSR HOBBIES, INC. not function at all on other planes of ex-
istence besides the Prime Material.
P.O. BOX 110
LAKE GENEVA WI 53147

Allow four weeks for delivery. Prices include $1.50 over cover price to pay for postage
and handling.

76

Dragon 49

Vol. VI, No. 9

magic-user. The stuff of base servitude and inferior status
would be cast aside for the heady power of actual spells! How-
ever, as I worked on the list of cantrips which might be possible
to apprentices, I was struck by the real usefulness of many of
them. Why not allow the magic-user the option of retaining
cantrips? Would it unbalance play if a number of cantrips could
be substituted for a single first-level spell? A few days of addi-
tional work detailing the powers of cantrips and determining
their possible effects gave the answer: Not only did the addition
not adversely affect the game, the inclusion of cantrips made
the play of low-level magic-users very much more interesting
and challenging! The following regarding cantrips is from my
AD&D™ expansion manuscript.

by Gary Gygax CANTRIPS
Cantrips are merely 0-level magic-user spells, the spells
©1982 E. Gary Gygax. AIl rights reserved. learned and used by apprentices during their long, rigorous,
and tedious training for the craft of magic-use. Most cantrips
Elsewhere in this magazine is a new column. That, Gentle are simple little spells of no great effect, so when the individual
Reader, is where news of the WORLD OF GREYHAWK™ Fanta- becomes a journeyman (1st-level) magic-user, the knowledge
sy Setting, as well as material for new adventures therein, will and information pertaining to these small magics are discarded
be aired. This separation is made to avoid any confusion. He- in favor of the more powerful spells then available. However, a
rein will be found material for adventures in any ADVANCED magic-user may opt to remember up to four cantrips in place of
D&D® campaign, and occasionally DUNGEONS & DRAG- one 1st-level spell. This assumes that the magic-user has, in
ONS® material too. The new column will adhere strictly to the fact, retained his or her book of cantrips — a tome as large as a
Greyhawk campaign and what goes on there. So if you are bent good-sized book of higher-level spells.
on immediate news from the Flanaess, please look elsewhere. The number and types of cantrips known and recorded is
What follows is strictly in the AD&D™ gaming realm. determined by random use of the tables given below. The ex-
ception is the table of useful cantrips — those which were
This is not to say that no further word from me will be read in employed to make apprenticeship less wearisome. An apprent-
the columns pertaining to Greyhawk, for I am still laboring on ice will have one useful cantrip for each point of intelligence,
the updating — as well as on (don’t faint) T2 and a pair of other and is allowed free choice from the list of 20 offered.
modules, “The Forgotten Temple of Tharizdun” (a scenario All cantrips are 0 level, have a 1” range, a generally small area
connected to S4) and “Wasp Nest — The City State of Stoink.” of effect, require only soft, simple verbal and somatic compo-
More or less concurrently, I am attempting to plug away at two nents, and are cast in a very short (1/10th to 1/2 segment) time.
new volumes for AD&D™ gaming. The next book of monsters Only those which involve living creatures afford any saving
will be the one to be released last (1984 possibly). throw. The common cantrips are:

With plenty of labor and even more luck there will be an Useful Reversed (2-8) Legerdemain (2-5)
ADVANCED DUNGEONS & DRAGONS® expansion volume No. Cantrips Curdle Change
next year. It will be for both players and DMs, with several new Dirty Distract
character classes, new weapons, scores of new spells, new 1 Chill Dusty Hide
magic items, etc. What will follow here in the next few issues is a 2 Clean Hairy Mute
sampling of the material slated for inclusion in the expansion. 3 Color Knot Palm
4 Dampen Ravel Present
I have often wondered why no player or DM has asked me 5 Dry Sour
about what apprentice magic-users actually do. The very 6 Dust Spill
thought always conjures up visions of Mickey Mouse having 7 Exterminate Tangle
troubles with brooms marching endlessly with buckets of water 8 Flavor Tarnish
— Walt Disney really outdid himself when he made Fantasia! 9 Freshen Untie
That aside, I have always reasoned that apprentice dweomer- 10 Gather W ilt
crafters had to fulfill the dual role of menial and student, per- 11 Polish
forming chores all day and then studying late into the night. 12 Salt
After a certain point, an apprentice would begin to acquire 13 Shine
sufficient magical acumen to employ minor magics— mainly to 14 Spice
lighten his burden of drudgery but also to create some amuse- 15 Sprout
ment at times. The petty spells gained by an apprentice magic- 16 Stitch
user are cantrips. 17 Sweeten
18 Tie
Previously, the acquisition of first-level spell ability sub- 19 Warm
sumed that lesser magics would be ignored by the fledging 20 Wrap

No. Person (2-8) Personal (2-8) Haunting (2-5)
1 Belch Bee Creak
2 Blink Bluelight Footfall
3 Cough BFiuregfinger Groan
4 Giggle Moan
5 Nod Gnats Rattle
6 Scratch Mouse TTahpump
7 Sneeze Smokepuff Whistle
8 Twitch Spider
9 Wink Tweek
10 Yawn Unlock

6.

March 1982 Dragon 50

CANTRIP EXPLANATIONS
Useful Cantrips

Chill (Evocation) A cantrip of this nature allows the
A of E: 1’ cube caster to cause liquid or solid material
CT: ½ segment to become about 40° F. cooler than it
was, subject to a minimum temperature
of freezing. If the subject is living mat-
ter, the cantrip will be only half as ef-
fective and will not lower temperature
more than 10° below normal for that
creature. Verbal component is a soft
whistling, somatic is a downward-
thrust thumb.

Clean (Abjuration) This cantrip removes heavy soil, dirt,
A of E: 4 sq. yds. and like foreign objects from floors,
CT: ½ segment walls, dishes, windows, etc. The sub-
Color (Evocation) ject surfaces are then spotless, but care
A of E: 1 cubic yd. must be taken in removal of pigments
CT: ½ segment and the like, so usually only one type of
Dampen material will be treated in a single ap-
plication. Verbal component is a low
(Evocation) outrush of air, somatic is a circular
A of E: 1 cubic yd. hand motion.
CT: ½ segment
Dry (Abjuration) This brings color to an object. It can Flavor area of up to ½ cubic foot can be rid of
A of E: 1 cubic yd. be used to restore faded hues or to (Enchantment) pests. The somatic gesture is a pointed
CT: ½ segment tinge those already colored with a dif- finger, while the caster verbalizes a low
Dust (Abjuration) ferent hue. Thus, dull or faded fabric A of E: 1 object “zzzt” sound.
A of E: 10’ r. can be brightened, pigments restored, CT: ½ segment
CT: ½ segment or even hair or skin changed to another This cantrip enables the caster to
Exterminate color. The effect must be renewed ev- give the subject a superior or better or
ery 30 days. Verbal component is a different flavor. Thus, much can be
(Abjuration) humming, somatic is a back-and-forth made to taste as if it were lobster
A of E: One very or wringing hand motion. bisque, but the dweomer will not actu-
ally affect the quality or wholesome-
small creature When a cantrip of this sort is cast, ness of the subject. Spoiled food re-
CT: 1/10 segment the subject area is permeated by a fog- mains spoiled; a poisoned drink would
like dampness which leaves all material still be deadly. The verbal component
within it damp to the touch. It is useful is a muttered lip-smacking sound; the
for many sorts of things. It is hard on somatic gesture is a shaking motion.
parchment, and it similarly makes it
and like substances hard to set aflame. By means of this cantrip the caster
Verbal component is a low hooting or a brings new life or freshness to the ob-
hummed ditty, somatic is a hand ges- ject desired. The magic applies to food
ture upwards with writhing fingers. and drink items such as milk, beer,
meat, and raw vegetables. It also works
The cantrip removes dampness and Freshen with cut vegetables, flowers, herbs, etc.
escess moisture from materials within (Enchantment) Although it will remove a slight taint of
the subject areas. It is useful for cloth, spoilage, restore drooping flowers, and
herbs, and cleaning chores. Verbal A of E: 1 object so on, it lasts for but an hour. The sub-
component is similar to that of the CT: ½ segment ject must be of relatively small size, i.e.
dampen cantrip, and the somatic is a a small cask of liquid, a sheep, a bushel
two-handed wringing motion. of vegetables, etc. Verbal component is
an “mmmmmm” sound, while the hand
This removes all fine dust and tiny makes a mystic symbol with thumb and
grit particles from exposed surfaces forefinger forming a circle and the oth-
such as floors, shelves, walls, etc. er fingers upright and apart.
Material so removed is transported el-
sewhere, but new dust can accumulate, This cantrip enables the caster to
of course. Verbal component is a con- neatly gather numerous small objects
tinuous in-drawing of breath, somatic into a stack or pile. For instance, if
is a back-and-forth hand motion. nails, nuts, coins, papers, or like ob-
jects were spilled, the magic would
When this cantrip is used, the caster Gather (Alteration)
may kill a small pest such as a fly, A of E: 1 sq. yd.
mouse, rat, beetle, or the like. It is use- CT: 1/6 segment
ful for indoors and outdoor applica-
tions. If the subject is very small, an

7

Dragon 51

Vol. VI, No. 9

Polish (Alteration) bring them together. It can be used se- Stitch (Alteration) flower, etc. Fruits and vegetables can
A of E: 1 object lectively, for instance to separate one A of E: Special be caused to ripen (or actually go past
CT: ½ segment type of material from another, but only CT: ½ segment ripening to spoilage) by this cantrip. A
Salt (Evocation) the selected type would be gathered Sweeten susurrant sound is verbalized while the
A of E: 1 object neatly. The caster verbalizes the type of caster’s hand makes hoeing motions.
CT: 1/6 segment material to be gathered while making a (Evocation)
Shine (Alteration) gathering motion. A of E: 1 object This cantrip magically sews seams in
A of E: 1 object CT: ½ segment cloth or leather. It will make new ones
CT: ½ segment When this cantrip is employed, the Tie (Alteration) or repair old work. About 20 yards of
Spice (Evocation) caster, magically smooths and brings a A of E: 1 object cloth can be thus stitched, but only
A of E: 1 object luster to materials such as wood, metal, CT: ½ segment about 2 yards of leather. The seam thus
CT: ½ segment stone, leather, or ceramic. Naturaily, created is neither stronger nor weaker
Sprout (Alteration) the desired object must be relatively Warm (Evocation) than a seam done without magic. Usu-
A of E: 1 cubic yd. clean in order for the cantrip to be ef- A of E: 1’ cube ally a brief rhyme is recited as the hand
CT: ½ segment fective. The object affected must be of CT: ½ segment makes a sewing motion.
reasonable size — a floor of up to 1,000
square feet, an armoire, etc. It works This cantrip is the same as a spice
better on smaller objects, of course, cantrip, except that the result is the ev-
such as boots, mirrors, crystal contain- ocation of a sweetener — sugar, honey,
ers, etc. The caster hums a ditty while or even a syrup. Components are a
making a buffing motion. buzzing sound and a stirring motion.

This causes a sprinkling of fine salt By means of this cantrip the caster
to magically appear and descend upon can magically cause the object —
the desired object — a stew, some thread, string, cord, rope, or even cable
troublesome weed patch, or a barrel — to tightly knot itself to either its oth-
full of stock fish to be preserved. The er end or an end of a similar object.
object must be a reasonable size — up within 1’ of it. The resulting knot will be
to perhaps 4 square yards in area or a normal one such as a square knot,
about 30 gal. liquid volume. Care must half-hitch, running bowline, or whatev-
be taken to avoid over-salting if the ob- er the caster desires. The caster verbal-
ject involved is smaller, and if the ob- izes the knot name desired while hold-
ject is larger, it will not receive much ing up three fingers.
salt. Verbal component is a labial
smacking, while the hand makes a This cantrip is the same as chill, ex-
sprinkling motion. cept that the magic brings a warming
of the liquid or solid. The temperature
Similar to the polish cantrip above, Wrap (Alteration) will rise at most about 40° F. The can-
this magic allows the caster to remove A of E: 1 cubic yd. trip will never cause living creatures to
tarnish, rust, corrosion, and like sub- CT: ½ segment become warmer than their normal body
stances from the desired object. This temperature. Components are an “aah”
cantrip brings about a mirror-bright sound while the hands are rubbed
shine to objects capable of such, caus- briskly together.
ing their surfaces to be smooth and
unmarred. A piece of jewelry, for in- When a wrap cantrip is employed,
stance, would be made more attractive, the caster creates a strong and sturdy
and even its gems better (+1 on die wrapping around the subject desired —
rolls). A single object up to about 1 a bit of herbs, a heap of flour, a bundle
cubic yard in volume can be treated by of cloth, etc. The material of the cantrip
this cantrip. Verbal and somatic com- is of a suitable type and thickness for
ponents are similar to polish. the item(s) to be wrapped. Thus, a few
ounces of fine powder will be con-
Unlike the flavor cantrip, this magic Curdle tained in a waxy tissue, gem stones in a
actually brings a particular spice to the (Enchantment) felt-like envelope, meal in cloth, and so
object food or drink. Thus, ginger, forth. The wrapping can be opened
pepper, and like spices can be brought A of E: 1 object normally, but the caster can just as eas-
to add zest (or disguise). Herbs like bay CT: 1/6 segment ily order it to open, so the cantrip is
leaf, garlic, parsley, etc. can likewise be often used to enfold the material com-
evoked by this. The quantity is suffi- ponents of a spell. The caster verbal-
cient to spice food or drink for about a izes a general class of wrapping de-
dozen people. The spice (or herb) ap- sired while making folding motions
pears over the object vessel as a fine with his hands.
powder or flake, falls upon it, and adds
its substance to the dish or drink. A dit- Reversed Cantrips
ty is hummed while the hand makes a
crumbling and sprinkling motion. This cantrip is broader in effect than
its name, for it affects many food and
By means of this cantrip the caster drink items. The magic curdles milk
causes acceleration in the growth of and hastens spoilage or wilting. It has a
plants, particularly with respect to the permanent effect on the object. It is
germination of plant seeds. Upon cast- otherwise similar to freshen. The caster
ing, the cantrip will cause seeds to verbalizes a retching sound while point-
shoot forth tiny sprouts, buds to ing the thumb downward.

8

March 1982 The opposite of clean cantrip, this Knot (Alteration) Dragon 52
Dirty (Evocation) lets casters soil, spot, and sully walls, A of E: 1 object
A of E: 4 sq. yds. floors, dishes, garments, etc. Verbal CT: ½ segment This cantrip is a permutation of the
CT: 1/6 segment component is a spitting sound, made Ravel (Alteration) tie. It causes the thread, string, cord, or
Dusty (Evocation) while shuffling and stamping the feet. A of E: Special rope to knot itself in such a manner as
A of E: 10’ r. CT: 1/10 segment to be very difficult to untie, and from 2-
CT: 1/6 segment By means of this cantrip the caster Sour (Evocation) 8 rounds, minus dexterity bonus for
causes a film of dust and grime to set- A of E: 1 object reaction of the individual untying the
Hairy (Alteration) tle upon all exposed surfaces within the CT: ½ segment knot, to undo. It works even on material
A of E: 1 object cantrip area of effect. Verbal compo- already affected by a tie spell. The cast-
CT: 1/10 segment nent is a low humming, while the hands er verbalizes a low “zizzing” sound
make shaking motions. while moving the arm forward with
strong wrist motion.
While this cantrip is not actually one
of the standard “useful” ones which This cantrip is the reverse of a stitch.
apprentices reverse for mischievous- It will work only if there is a loose or
ness, it is one which is generally used broken thread in the seam or fabric to
for no good purpose. It causes hair, fur, be affected, except for material magic-
or hair-like growth to thicken and leng- ally stitched by the appropriate cantrip.
then. Thus, a head of hair, a peach, a When the latter sort of seam or material
beard, a cat, or whatever could be af- is involved, the ravel cantrip will always
fected. The growth will cause the sub- work, except in the case where the sub-
ject material to increase from 2-12 ject is otherwise magical, i.e. a bag of
inches in length. The subject material holding, a cloak of protection, boots of
must be trimmed or cut to remove the elvenkind, etc. The name of the cantrip
cantrip’s effect. This cantrip can be is verbalized while the fingers make a
reversed to shorten growth or effective- plucking motion.
ly shave, but as the effect on short
material (growth under 1 inch in When this cantrip is employed, the
length) is complete absence of growth caster causes the subject food or drink
for 2-12 days, it is not often used. The to take on a sour taste, not unlike vi-
caster verbalizes snicking sounds while negar of the appropriate sort. While it is
making massaging motions for growth, typically used to spoil wine, beer, or
or scissoring motions for removal. some pastry, the sour cantrip can be
used to useful purpose. The magic ac-
tually causes about a pint (maximum)
of vinegar to appear over the subject.

9

Dragon 53

Vol. VI, No. 9

Spill This can be an empty container in Untie (Alteration) The object must be of about 1 cubic
(Alteration) which such liquid is desired. The caster A of E: 1 object yard or less in volume. Verbal compo-
purses the lips and makes a whooshing CT: 1/3 segment nent is a spitting sound, while the hand
A of E: 1 container sound while clenching the hand. Wilt makes a sprinkling motion.
CT: 1/6 segment
Tangle (Alteration) The opposite of a gather cantrip, this (Enchantment) This permutation of a tie cantrip is
A of E: 1 object enables the caster to cause the con- A of E: 1 object simply the reverse of the magic. The
CT: 1/6 segment tents of a container to spill out. The ob- CT: ½ segment caster selects an object — thread,
Tarnish ject container is actually tipped by the string, cord, etc. — which is knotted or
cantrip, and as it is not powerful, con- tied. The cantrip removes the knot or
(Alteration) tainers of more than about gallon size, tying. Note that the untie cantrip will
A of E: 1 object or magical ones, will not be affected by cause a tangle to be nullified. The can-
CT: ½ segment the cantrip. Solids and/or liquids within trip will not remove both a knot and a
the object container will spill out, pro- normal tying (normal knot or one
viding the container is not securely caused by a tie cantrip), but it will
closed or capped. The caster verbalizes cause the former to disappear so that
an “oh-oh” sound while making an only a normal tying remains. Somatic
abrupt hand motion. and verbal components vary according
to desired result. In general, a popping
A permutation of the tie cantrip, this sound is made while the hands are
magic allows the caster to cause fine pulled apart — either as if a knot were
material such as thread, hair, small being untied or a cord snapped.
grass, and the like to become twisted
and entwined in a tangle. It will not A reverse of the freshen cantrip
work on heavy material such as rope. which affects only vegetable material
Untangling subject material will take 3- — whether growing or picked. Thus, a
12 rounds, unless it is roughly done — plant can be made to wilt (or possibly
and the material is broken and snapped wither if it is not very healthy) or a
in the process, torn loose, etc. The can- bunch of cut flowers sag and droop.
trip will tangle mixed materials such as Verbal component is a descending
grass and string, hair and threads, and hum, while the forefinger is slowly
so forth. A buzzing is verbalized while curled from an upright position.
the finger makes a stirring motion.
Sorry, Gentle Readers, but that’s all there is room for in this
The reverse of a shine cantrip, this issue. Next month we will pick up where we left off and finish all
causes a covering of rust, corrosion, of the explanations, as well as give a brief note on casting
verdigris, or the like to cover an object cantrips. Until then....
normally subject to such tarnishing.

‘Advanced Illusion and Philosopher’s Stone

by Gary Gygax Explanation/Description: This spelI ity is lined with a quicksilver that ena-
©1982 E. Gary Gygax. All rights reserved, is essentially a spectra/ forces spell bles the transmutation of the base
that operates through a program (sim- metals iron and lead into silver and
It seems that TSR gets the cart in ilar to a programmed illusion spell) gold. Either an alchemist or a magic-
advance of the horse fairly often. the caster determines. Thus, the illu- user will be required to effect such
Thanks to the kind offices of DRAG- sionist must concentrate on the spell transmutation, however. From 50 to
ON™ Magazine, we don’t have to keep for longer than 5 segments after cast- 500 pounds of iron can be made into
everyone in suspense for months be- ing it, as the program has then been silver, or from 10 to 100 pounds of
cause of premature actions. I refer started and will continue. The illusion lead can be turned into gold from a
specifically to the mention of an illu- has visual, full audial, olfactory, and single philosopher’s stone. Better still,
sionist spell, advanced illusion, in the thermal components. If any viewer two additional substances are possi-
FIEND FOLIO™ Cyclopedia and to actively disbelieves the dweomer, he, ble within such a stone. The first is a
the mention of the magic item, philo- she, or it gains a saving throw versus greenish, crystalline salt which will al-
sopher’s stone. Here is the informa- magic. If any viewer successfully dis- low the manufacture of from 1 to 4
tion you need to handle both items. believes, and communicates this fact potions of longevity and has a 75%
Just to keep our Gentle Readers well to other viewers able to comprehend probability of occurring within the
informed, they will eventually appear the communication, each such viewer stone. The second is a pure white
in a tome of material expanding AD- gains a saving throw versus magic powder which, when mixed with a po-
VANCED DUNGEONS & DRAGONS™ with a +4 bonus. The material compo- tion of longevity, can actually restore
games that should be ready in 1983. nents for this spell are a bit of fleece life to a dead human (or even a demi-
Advanced Illusion (Illusion/Phantasm) and several grains of sand. human) if administered internally with-
Level: 5 in one week of his or her demise. (Cf.
Range: 6” +1”/level Philosopher’s Stone: This rare and raise dead spell.) There is a 25%
Duration: 1 round/level magical object appears to be an ordi- chance the white powder is present.
Area of Effect: 4 sq.” +1 sq.”/level nary, rather blackish and sooty piece
Components: V, S, M of rock. It radiates a faint dweomer. If X.P. Value: 1,000
Casting Time: 5 segments broken open, a geode-like cavity will G.P. Sale Value: 10,000 (payable
Saving Throw: Special be discovered. The interior of this cav- only for an unopened stone)

10

54

by Gary Gygax

® 1982 E. Gary Gygax. All rights reserved.

theBesceacutiosen othnerceanatrreipsmfaonrymeaxgpicla-unasetiorsn,sthneeeGdoeoddtRoecaodmepr lwetiell
be pleased to discover that this introduction is short! For those
of you who failed to acquire last month’s issue, I suggest you
drop this one and get busy finding a copy of the initial part of
tcnhaeinswtrsipde.rimiMeseovn—isnyigoonuri’gvoehftfaualrnloeanfodgry, missed a crucial portion of a whole
mheargeica-ruestehres,dtehteailOs -olef vtheel sbpaelalln, coer
of the cantrips listed last time:

ALCCEhToGa:fnEE1gR/:1eD01E(oAsMbeltjgAeemcrIaNtetnioCtnA) NTatseRaltrmBhIPaoyeSultmgekihernsagtnhdosoenmoecf,hsaaamnncadghelalonomngbelyujecsaatcnntbitmteroipaw,laitnathhnoeidnthcteavhesre,-- appear, the noise of its cry would still be
getable objects are affected. Thus, a heard. Likewise, if an elephant were hid-
piece of parchment can be changed to a dtreunmbpyettihneg,coarnteripv,enthebrseoauthndingofmitsigthret abde,
brightly colored cloth square, then the vhieeawredr.s Tahreebdewsiedeomorebrewhiinlldntohtewcaosrkteri.f
eclrotuhsecaonf tbheecchaanntrgipe.dLtiokeawirsoes,eabbyiradncoathn- The cantrip lasts for 1 turn on an object
sbqeucirhrealngbeydainnotothear buaste, thoef tbhaet stoamaeflytyinpge of 2 cubic yards or less in size. The dura-
of cantrip, and so forth. Each change tion is reduced by 1 round for every addi-
requires a change cantrip. The cantrip tional 2 cubic yards of volume made to
will not cause more than a 50% increase seemingly disappear, until at 20 cubic
or decrease in size/volume, and the ef- yards of volume, duration is 1 round. At
fect will last for a base time of 1 turn. If over 20 cubic yards of volume, duration
tbhee rcehdauncgeedisacracdoircdainl,gtlyh;eni.et.h, ea tdimeeadwtioll is reduced to a number of segments
live object ‘is a radical change and will equal to -1 per 2 additional cubic yards;
vlaesrtyonsllyig1htroaulntedr.aOtionnthesuocthherashancdo,loar oi.fe.9, tsheegmhideentcsainf tcriapswt oillnhaanveobajedcutroaftio2n2
change or the like will last for 1 or more cubic yards volume; 8 segments for 24
days. Saving throw does not apply as cubic yards, 7 segments for 26, 6 for 28, 5
long as small, animal-intelligence, non- for 30, 4 for 32, 3 for 34, 2 for 36, and 1
magical creatures of normal sort are soveegrm3e8nctufboicr 3ya8rdcsubinicvoylaurmdes.wAillnaytthbiensgt
concerned. Typically, a magic word is mreoamppeenatar rialygasiene. mVetrobadliscaopmpepaorneanntdistheann
verbalized while the hand makes a pass activating word such as abracadabra
over the object to be affected. while the hand makes a pass across the
forepart of the object. The caster can
Distract cauBsyesmaellawnshooaf rtehiwsactcahnintrgipt,othloeokcaatstaenr adicstpiveal titnheg cwaonrtrdip. simply by speaking the
ACT(oE:fn1Ec/h:3aSsnpetemgcmeiaenlnt)t area of the caster’s choice. The area
must be to the right or left of the caster,
and the distraction must be within 10 feet AMuotfeE(:A1Iteorbajeticotn) altTerhethemustheapcaenotrfipsmaalllol wosbjethctes caster to
of the caster. Thus, the caster can cause CT: 1/10 segment of a min-
viewers to watch his or her right hand
and a place a few feet distant where the
caster’s finger is pointing, while the cas-
ttiecre’sd.leSfat vhinagndthdroowess aspopmlyetohninlygtouninndoi--
viduals above 0 level, or with at least 1+1
tashhpiatdenudariacklotesiwonaarnnaodtfinaaogtnnt.elyiTnnh1ttieeoslnledig-gigsemternaetctcnietnt.cgoaTfnhwetgroirpcredaahstateoesrrr
phrase and gestures to the left or right to
effectuate the cantrip.

Hide (Illusion) This cantrip allows the caster to magi- eral nature. It applies to glass, metal,
A of E: 1 object cally hide an object of virtually any size srotodn, ea, toertuc.s Ato palasnpehecrae;nebtce. Tahltuesre, da tcooina
CT: 1/10 segment for a short period of time. The cantrip
scoastthsaat itdwbeecoommeersoivnevristibhlee dtoesairlledwhoobjaercet
in front of the caster. Note that the magic could be changed to be a ring. Similarly,
does not affect sound, so that if a crow- glass could be changed to crystal, lead
ing rooster were made to seemingly dis- to silver, copper to gold, etc. The dura-
tion of the mute is but 1 round. if another

16 APRIL 1982

55

the exact nature and location of the ob-
jaercet oonr othbejepcetrssoton bofeapnroetsheerntineddiv.iIdfutahl,eya
saving throw versus magic applies to the
ainrdeiviindupalla,inunsleigshst.the object or objects

PERSON-AFFECTING CWAhNeTnRtIhPiSs cantrip is cast the subject
Belch (Evocation)
A of E: 1 person will involuntarily belch. A saving throw is
CT: 1/10 segment applicable only to see how loud or muf-
fled the burping sound is, failure indicat-
ing a very loud belch, success meaning
that the sound is relatively low and
muffled. Verbal component is an almost
inaudible belch while the caster’s hand
presses his or her diaphragm.

ACBlTion:fk1E/(1:E01vsopecegarsmtoioennn)t caBusyems ethaenssuobfjethctispcearsnotnrip(,orthcerecaatusrtee)r
to blink his, her or its eye or eyes. The
bcolinukrsineg, lraesaticntgionnoismoonrley tmhaonmehnatlfaray,seo-f
ccaotneds.oAnlysuacsciengslsefuelyseawviinnkg, tohrronoweinffedci-t
for one-eyed creatures. The verbal com-
ponent is a softly spoken word (such as
“hatcha-cha”) while the fingers snap.

Cough (Evocation) theThsisubcjaencttripinednivaidbuleasl tchoeucgahstesrpatosmmoadkie-
A of 1E/:31speegrmsoennt ctaolulyg.hIfisaonslayvainbgriethfrhoawckiisngmwahdiech, twhiell
individual actually touches the object af- CT: nuoret uinsduicaalltyesdiastulorubdoathnedr aaccttiviveitiseesr.ieFsaoil-f
fected, the dweomer of the cantrip might coughs lasting from 1 to 3 seconds. The
be affected: The individual touching it somatic component is a gagging gesture
Vimiflaeairrtkbestaosul caaacnesdcaehvsdaionsnmggtaehttheiccroaccwnaotnmvrtiepprrio.psnueissnmtdsaisagpricee,llsaeimndd.- while a gasp is verbalized.

APaolmf E:(I1llussmiona)ll object wcritTehhtoiaustscsameneatmrlilpionebgnjetaocbtdleoinssthohi.esTcohareshtdeewrrethooamsneed-r AGiogfglEe: (Charm) By means of this cantrip, the caster
CT: 1/10 segment creates an illusory duplicate of the ob- 1 person tcaaruilysegsigtghlee.sTuhbejeclotuinddnievsidsuaanl dtoleinnvgothluno-f
CT: 1/3 segment tIhf itsheresauctbiojenctdfeapielsndtoosnavthee, thsaevrinegsutlhtrwowill.
be a chuckle or giggle lasting about 2 or
ject to be palmed, so that the other can b3corisemefcpcoohnnudecskn,lteIfiswthailel sbsienavgcelaeuswsuecodcre.deTodhrse,pvohenrralbysaeal
be taken while under a form of hide can- (known in magical circles as a “punch
trip (which actually works regardless of flionret”h) wrahpiliedloyn.e finger is moved back and
viewer position). The illusory duplicate
of the palmed object lasts but 1 segment,
so it must be covered or screened from
view, or else any onlookers will see it
wink out of existence. A special word is ANoodf E(E: v1ocpaertisoonn) anThinisvoclaunntrtaiprycanuosdesofthtehesuhbejeacdt dtouegivtoe
spoken while a digit points at the object CT: 1/10 segment smuubsjecclet cwoenrterancotiodnd.inTghien eafgferectemiseanst oifrthaes
to be palmed. The caster may then pick a greeting. A successful saving throw
suepetmheingnloywo-ninlyvitsoibulcehiancgtuoarl hoabnjedclitngwhthilee snleigghattneosdthoef tehfefehcet.aTdhwehcilaespteoringtiinvgeshias
illusory duplicate. or her small finger at the subject.

ACPrToe:fsE1e/n:6t1s(seAmgltamellreaonbttijoenct) A present cantrip enables the caster to ACScTor:af t1Ec/:6h1(sEecrvgeomacetuanrtteion) A scratch cantrip causes the subject
bring any small object or series of ob- creature to experience an annoying itch
jects from within a 2-foot radius of his or on some portion of the body. Unless a
her person to his or her hand. The object
or objects will appear magically in the
caster’s hand as he or she puts the hand
upward or outward with a flourish and swailvl iinngvotlhurnotwariliys sscurcactcehssafut lt,hitsheitcshu. bTjheicst
speaks the key word to begin the dweo-
tmheurs. Ipfraenseonbtjeecdt, athselacrgaentarispawtiallnbkeardexis- scratching will take but a second, and
hausted, but as many as a dozen coins will immediately cause the itch to cease.
Verbal component is the name of some
dcowueldombeerbfraoiluegdh.tTtohethceahsatenrdmbuesfot rkentohwe abroeday opfetshte(filtecah, ilsoupsoein, teetdc.)tow. hile the

DRAGON 17

56

Sneeze (Evocation) A cantrip of this nature causes an irri- sdlieceepc. aEnveben aaffcerceteadtubrey of up itfopr5e+v2iouhsi-t
ACTo:f E1/:21 creature jteactiot.nUinnlethsesnthaseasl upbajsescatgmesakoef sthae ssuucb--
segment sleep
ly victimized by a yawn cantrip, but the
cessful saving throw versus magic, a ethfefecctreoaftutrheehsaledep4+s1petoll i4s+d4icheitddfiocer;ais.e.if,
srenleieevzee twhiell oircrcituart.ioTnh.isThseingcleasstenreevzeerbwaill-l
izes the name of an irritant substance there is a 50% chance it will not be af-
fveecrtbeadl. cTohme pcoansetenrt hwuhmilse amalukllianbgyaforrocthke-
while touching his or her nose. ing motion with cupped hands.

ATwoiftcEh: 1(Ecvroecaatutiroen) caBuysemseaanmsuoscf ltehicsocnatrnatrciptio, nthiencsaosmteer PERSONAL CANTRIPS OF THE APPRENTICE
CT: 1/3 segment dpaogrteiosn—of htheeads,ubnjeecckt,chreaantdu,rea’srma,pfpoeont,-
bleugt,weitllc.noTthceatuwsietcthhewisltubbjeecntogtirceeaat bdlies,- Bee E(:S1umbemeoning) caWstehresnumthmisoncsaanthriopneisy ebmeepflrooymeds,omthee-
comfort or loss of control or concentra- A of place — where is of no importance, for
tcieosns.fuTlhseavcianngtrtihproisw.neVgearbteald cboymaposnuecn-t CT: 1/2 segment tbheee cwriellaatuppreeaarpinpewahrasteinvesrescpoont dthse. Tcahse-
is the name of the area to be affected theimr isogr ahzeirn.gTahte, ubpeetois1,”odfisctoaunrcsee,fraonm-
wmhaikleesthae tcwaitsctheirnggamzoetsionatwthiteh athreeahaanndd. nlivoinyegdc,raenadturiteisit 9fi0n%dsliiktseelylf tuopsotnin.g(Tahniys
wviiolllecnetrltyaiinfliyt wcaouuslde oththeesrwubisjeectbetosroeaacf-t
AWCTion:fk1E/:(1E01nscpehegrasmnotenmnet nt) This cantrip enables the caster to fected by a bee sting.) The verbal. com-
ecayues.eAthseavsiunbgjethctroinwdiivnidduicaaltteoswthinakt othnee cpaosnteenr’tsisfoarelfoinwgebruzmzoinvgessotuhnroduwghhilfeligthhte-
winking is rapid and not greatly notice- Iike passes.
able, while failure to save indicates a
Tgrheeatlcyasetxearggsepreaatekds, aprmoloanggiecdal wphinrkainsge.
(such as “23 skidoo”) white making an Bluelight This cantrip enables the caster to con-
imperceptible winking of his or her eye. A (oCfoEn:ju¼ra’tion) jure a small sphere of glowing blue, ra-
CT: ½ segment diance. The light has an eerie effect
AYCaTow:fn1E/6(:Es1veocgrcemaatetiuonrnte) creAatyuarewnfeeclaantbrripiefmwaakveesofthderowsusibnjeescst when seen from a distance, but it only
which in turn evokes a yawn reaction. If a illuminates an area in a 5’ radius. Fur-
saving throw versus magic succeeds, the thermore, the bluelight does not cast re-
subject creature is totally unaffected by fdleocetsionnost baeffyeocntdeitthhiesrriandfriauvsi.siTohneolriguhl-t
the dweomer of the cantrip. Failure, travision. When the caster says a rhyme
hmoewdeiavteerl,y nooctcuorn,lybufotrtcheessaubyjaewctnistothimen- using the words “blue” and “light” in any
more susceptible to asleep spell. During combination, the bluelight appears in his
the balance of the round in which the or her open palm and remains aglow un-
yawn cantrip was cast, and during the til the caster ceases to concentrate on it.
whole of the succeeding round, the sub-
ject will automatically fall into comatose ABuogf E(:S1umbumgoning) scoaAmntervipaforieramntioaonbfleocsfratthwheleinbgceaeinsstceearcnt.ttroiTph;seuthmbemebeoutlnge
ssolum1baedrdfirtoiomnaal cslreeeaptusrpeelwl icllasbteuvpuolnneirt,- CT: ½ segment or bug appears in the same manner as
able to the spell if more than 1 creature of the bee summoned by the cantrip of that
4 or fewer hit dice are subjected to the name. It will likewise be irritated and will
spell. Further, if creatures of 4+1 to 4+4 pinch, bite, or otherwise attack the crea-
chhitandciceethaarte2inwvilol lavcetdua, lltyhebreeaifsfecthteednbay ture it might find itself upon, with ap-
propriate results. Verbal component is
the name of the insect desired while the

18 APRIL 1982

57

caster’s forefinger makes a sliding and ACSpToi:fdEe½r: 1(Ssummalml sopnidinegr ) mbuoTgnhsiosarcmasmnotaurilspl,e, omordruincgahnryaatssspdcidoaeenrstrfriaopm,beseeulsmoer--
tphoeinbtiungg’smaoptpioenaraatntchee(duepstiored1”adreisataonft where to the location desired by the cas-
from him or her). segment

ter, up to 1” distant from his or her per-
son. The arachnid so summoned will us-
ACFiTroe:ffi1En/:g3e½sr’eg(Amlteernattion) tfeoroTthtoeincfalieruensfgientghaetrjoectsaohnfotrfoilpatmfeoenratuhbplefrtsoomtohneheis-chaaoslr-f ually be a common garden spider or the
her finger. The flame is very hot and will like, no larger than an inch or two in
diameter, and basically harmless. There
ipganricthemceonmt,btuwsigtisb,lekinmdalintegr,iaalnsdsuthcehliakes is a 5% chance that the creature will turn
out to be one with powerful poison
(blackwidow, brown recluse, etc.). Since
without difficulty, providing the mate- the spider summoned will be annoyed,
rials are relatively dry. The flame persists
for up to 1 segment. The caster speaks a the creature upon which it finds itself, if
swoonr,dzoipf-ppoo,woerr tohveermeulechmerenvtaelrefidrew(roornd-, such is the case, will be subject to an
immediate biting attack. This will have
only a momentary effect, distracting the
wdmuiatnhk-hetishll)ea, deoxwtennwdasrdthoer sfiodreewfianygserm, oatinodn victim for 1 segment, for a normal spider.
thumb. If the spider is of the very poisonous sort,
the victim must also make a saving throw
versus poison at +4. Success indicates
AGnoaf tEs:(1Sucmubmiconfoinogt ) beAe caanndtribpuogf cthainstrnipasturdeesiscrsibimeidlarabtoovthee, only 1 point of damage is inflicted. Fail-
ure indicates 2 points of damage are in-
CT: ½ segment except that when it is used a cloud of flicted, and the victim will feel sick and
gnats is summoned. The swarm will im- be unable to act normally for 1-4 days
mediately proceed to fly around the c“druaeeanrmfnleaetroscrishvtphen,aeidttnshh”ieceeuwktnrhtcaoeialslxiezssientesf.popror(riAsse1opandsedalasoinypwk.g)eslpTlhtooihissisecocaoanswrstohwtthretidolerl
head of the nearest living creature, and
unless this creature makes a successful
saving throw versus poison, the cloud of
gnats will distract the creature for from
1-4 segments before the gnats fly else- fingers and wiggling them.
where. The verbal component is a high-
ppiotcinhtesdabudzigziitngatstohuenadrewahiilen wthheicchasthteer ATCwToe:fa1Ek/:31(Csecorgnemajueturnartetion) By means of this cantrip, the caster
gnat cloud is to appear. causes an unseen thumb and forefinger
tsoomhearpmolretisosnlyo,f baucthaonsennoysiunbgjleyc,ttwwiethaink
a 1” radius of the caster. Portions subject
AMoouf sEe: 1(Smuomumseoning) Similar to the cantrip which summons etoart,hbeetawrde,akmcoaunsttaricphea,rew:hcishkeeersk,, onrotsaeil.,
a bee or a bug, the mouse cantrip ena-
CT: 1/2 segment tbole1s”thfreomcahsitserotrohberrinpgosfoitriothn.aTmheouasneimuapl
The cantrip’s effects do not disturb spell
casting, although the tweaking might
wailsl pbeeciaestyapsicaplofsiesldiblme.oWusheeonr iat sarsriimveilsa,r distract any creature by causing it to turn
tAo fdaiislucorevetro tshaevseovuercresuosf mthaegaicnn(woyitahncree-.
the caster will have no control over the
mouse, and the animal will behave as
would any mouse in the given situation. spect to creatures with an intelligence
The caster speaks a summoning word tuhnadnerin7t)e,lloigrefnaciluererotloledrolol na 3sdc6ore(wgitrheartee-r
(typically the name of a food item desir-
able by mice) while holding his or her spect to creatures with intelligence of 7
or greater), indicates a l-segment dis-
hands in such a way as to resemble tprahcratisoen. (sTuhceh caasste“rkitscpheya-kkistcahym-caogoi”c)
mouse ears.

while making a pinching and pulling mo-
Smokepuff When this cantrip is employed, a puff tion with thumb and forefinger.
A o(Ef vEo:c1a’tdioianm). cloud oalnfodcaacwttiouilnla,lausscpmeotnokde1a”asdpiwsptoeauanlrtdsfraionmntohtrehmeadcleascsliorteeurdd,
CT: 1/3 segment of smoke, or be dissipated, depending AUnolfoEck: 1(lCoocknjuration) jurTehiasnciannvtirsipibleen,akbeleys-litkhee fcoarscteeratpoprcoopn--
CT: ½ segment riate to the locking mechanism to be
on the prevailing conditions. The caster
can cause the smoke to be either white, opened (or closed). The unlock cantrip
gray, black, brown, yellow, or green. The will affect only simple locks of the most
caster names the color of smoke desired cblaossiincgsoprrtes—sutryeppicraolnlygsthoorsebowlthaicnhd hpainvse,
while moving a hand from an extended or bolt and spring closures. Locks with
mhoeraiznownhtialel pboresaittihoinngtoforathvaerptiucfaf loof naeir,. tumblers or levers, as well as secret-
combination locks, are not subject to

DRAGON 19

58

this cantrip. Note that simple locks with Groan (Illusion) approach closer than 1”. The caster
tcroigmgpelerixngwwaridllsbteo spurebvjeecntt tsokealnetounn-lkoecyk A of E: Special afmoroeutsstttoespooscftcwlyuhrviloeinciptaioaliilznlyetinasgnodiunnstduhsbessaeirmqeuaielantrhtletyoy.
cantrip. While the caster speaks a word CT: 1/6 segment lusAiognrooanf acawnrtraipckcinregatcersy tchoemaiundgibflreomil-
or phrase associated with locks (tic- some location no more than 1” from the
tmacakk-edsouabletwloicskti,nygahm-eolt,ioentcw.)ithhe foinrgsehres AMooaf nE:(ISllupseicoianl) caster. Naturally, those creatures within
held as if to grasp a key. CT: 1/10 segment hearing distance are allowed a saving
ACRaTot:tfl1eE/1:(0ISllpsueescgioimanl)ent tthhreowindvievrisduusalmwaigllich,eaanrdnoif situscuhccneoeisdes.,
HAUNTING-SOUND CANTRIPS The caster makes a soft groaning sound
in his or her throat while pointing to the
ACroefakE:(ESvpoecciaatlion) evBokyems eaannosisoef sthimisilacrantotrtipha, tthoef acadsoteorr area from which the sound is to appear
CT: 1/6 segment welisteh acosroroudneddashinifgseosmseloonwelyoor pseonminetgh,inogr wtoillcnoomteh.aNmopteer tthhaet raancgoentoafintheer coar ndtroipo,r
were walking across squeaking floor- ssoeetmhattoa cgoromaeninfrgomsoubnedhicnadnabedomoar,dientao
sbeogamrdesn. tT; htheefolartmteerrnsooisuendwillalslatsstfohral1f/3a chest, etc.
fseeegtmdeisnttaannced. sTeheem ctoasttrearvemrsaekeusp atolo1w0 ceaitTnhtheriirps,acepaxicntietfrupitlpmtihsoaatthntheinegssaoomruneedlsaeisnvaaonlvgeeroedariines
creaking sound in his or her throat while one. Verbalization of the desired sound
ousrinfigngaehrsantdo tmo amkaekeaawnaolkpiennginmg omtoiotinon. is either a low-pitched one for the haunt-
ing effect or a high-pitched one for the
AFoooftfEa:llS(pIlelucsiaiol n) When this cantrip is employed, the pitiful effect.
CT: 1/6 segment scatesptesr. cTrehaetessouthnedaiusdaiasl iilfluasiohnumofafnooot-r caBusyems ethaensauodfibthleisilcluasniotrnip,ofthae rcaattslitnegr
humanoid was walking. The footfalls can sound associated with chains. Its direc-
pbreoascohf,t morovfeairalwy anyofirsoym. ,Tfhoelloywc,aonr oatph-- tion and distance are the same as for a
Terhweisyemsuesetmbetogipnawrailtlheilna1p”eorsf othneorcapsatretyr., groan cantrip. The sound will last for up
but they may thereafter move away from
him or her up to a 2” distance, or may

20 APRIL 1982

59

tthoe2soseucnodnadrse. eAnlltitcleredattuoreassawvitihnignth1r”oowf lows loudly while pointing toward the
vtheersiullsusmioangaicrytosoduentedr.mTihnee sifptehlel ycahsetearr warheialewthheinrkeinthgeocfatnhteripthisumtopcinogmseofuronmd.,
names the rattling device which he or
sshheakdiensgireosnetohcarneadtevigthoeroilulussliyo.n of while AWCTho:ifs1Etl/e:6S(sEpeevgcomicaeal ntiton) caWusheesnathfiasinctaonrtrliopuids wcahsist,tlitnhge sdowuenodm.eAr
floauindt wohniestlwinitghicnan30b’.eThheearsdowunithdinca1n0’,bae
ATaopf 1(EE/:6v1oscseaqgt.miofoenon)tt abBley tmoeeavnoskoefathnisincvaisnitbrilpe, fthoercceawstheircihs sharp and normal-seeming or echoing,
CT: w—illatadpooorr, rlaidp, aflogoarin, stat bsloem, weaslol,lipdaonbej,eocrt tthlheoellsodoweft,slyiarenindd aseoemurinead.nnTwehrheigleceanhseetreaorllrymssuhismetillowaorhkitsos-
whatever. The sound will occur once,
towf ifcineg,eorrs tehxritceendaecdcobryditnhge tcoasthteer.nIut misbaenr at the area from which the sound is to
actual sound, and creatures within 1” of come and holds two fingers near his or
tshoerynooirsgeanwsillpceermrtaiti.nlVyehrbeaarl citoimf pthoenirenstenis- her mouth.
aaghaoinlslot wthesopuanladtec,roerataedkebyypthhreasteonsgpouke-
en softly, while the finger makes a tap- THE CASTING OF CANTRIPS
ping motion.
NoCteantthriapst daerespbitaesicthaellyir csaimstptlheecsoammpeonweanytsthaant dspsehllosrtarceasctainsgt.
Thump (Illusion) An audible illusion, the athu1m” pracdaiunstriopf ttfshiaimnecgteorlsoersu, m:nodsnaulgiyrnipctrw-wiushoseice,chrianontihtrtiearaitppicvsapenrc,etraanipnntidcibsees.coFacsouatnrst.ithsAeddrfumteerpiornergtnehd,eaetnnhfiytersortsnoeougftnhmtedheeubnstytwuoaaofl
ACTo:f E: Special causes all creatures within cantrips is cast, the magic-user must roll a four-sided die to
the area of effect to hear a loud but determine how many segments later he or she will be able to
1/10 segment muffled thumping sound, as if some- cast the second cantrip (if so desired). It is not possible for a
magic-user to cast both a spell and a cantrip during the same
thing large just fell from a height of afoot round, no matter how short the casting times.
or two. A successful saving throw versus
cmaasgteicr cnaunllicfiaeussethethecasnoturinpd’stoefsfeecetm. iTnghley
come from any location within a 1” radi- And now that you have finished with cantrips for magic-
us of his or her person. The caster swal- users, get ready for next month, when cantrips for illusionists
will be featured. Until then....

DRAGON 21

60

Person: 2-5

HPearusnotninagl:: 25--58

No. Minor IlluSspioencia(l5-8il)lusionist cantrips
1 CDoimlored Light
32 Haze
4 MMairsakge
756 NRoaiisnebow
8 Two-D’lusion

Explanations and descriptions

Co(lAolrteedratLioignh)ts When this cantrip is employed, the
A of E: Special cpaasstteerl cligrehatte(csf.omneagoicr-musoerres’gblolubeelsigohft
CT: ½ segment fcoaonttrinip)d.iaAmseintegrlecagnlobbee obfroilulugmhtinfaotritohn, o1r
a pair of 6-inch-diameter globes, three
by Gary Gygax 4c-ainsctehr gclaonbecsa,uosre ftohuerse3-ginlcohbegsloobfelsig.hTthtoe
©1982 E. Gary Gygax. All rights reserved. nbeateofaarnaydipuassaterlouconldori.t eEqauchal wtoillfiivlleumdii--
faomoet treards;iuis.e.o,fara1d-ifaonotceg,lowbheilsehaed3s-ianc5h-
By this time I assume that most of you Gentle Readers who sopf h1e5reincohf elisg.hAt sillulomnginaatsesthoenclyasaterracdoiuns-
twheereladset vtwotoedcotolumADn&sDw™ill hgaavmeinbgesguufnficeiemntplylotyoinlgabcoarntthrirposuginh ccaennttrriaptewsillurpeomnaitnheacctiovelo,reanddlitghhetsg,lothbee
yrioenucrerdesipnemctyivoewcnamGpreayighanws.kIfctahmepraeigsun,ltsthaerree lwikiell hthaavteebxepeen- or globes will float near or rest upon the
considerable zest added, for low-level magic-users are now caster, as he or she desires, within the 1”
pmaorrtye, tahnadnaonnien-istihaol at tltuarckkersspeinll rtohlel wnieththqeurmesotisotnraebgleionpsunocfhtnhoe Tfroahrntehg,eilu.lupGmaloinnbdaetdsioocwnannf,rotbomeanamdnoyvfreoodfatsbhaedcemksirawendild.l
tlohnegbeersnt eceadntrsippsellcatrnoubbelesufobrsttihtuetePdrefosrtidthigeitfairtsotr-,lesvinecl ebufmoumreorf! not cast reflections beyond 1”, and the
It is also “pure” AD&D gaming, too, for the cantrips and rules 3lig”.hltnfsrhaveidsiocnanannodt ubletradveisteiocnteadrebenoyot nadf-
ftRhoeeraytdheaerpi,rpyeeomaurpenldooywhmehereanvtwewittihlhlienbeeacdogymeeaeornpoaarrltltwothofo.tshMeeeimsaynpswrtuehdmielen,mt Feuanciohthugfauhsl fbeuctteodthifelrighhut eiss cwoillolrdedistpuarlbe tbhleueseorvipsiunak,l
noWt tiothamcqaugiirce-uDsRerAsGsOeNe™n toM,aitgaiszintime eontoatarkeeguulapr tbhaesicsa. use of capabilities. The caster must speak the
their more specialized cousins, illusionists This sub-class is tchoelnorspaenadk naummabgeicr woof rgdlo(nboemsad, emsairzedda,,
wnohtattowohpeonputhlaerginammeosstysctaemmpaexigpnasn,sbiount tihsaptuwbillilschheadn. gTehastomvoel-- oetrcm.),owrehilfeindgierersct.ing the globes with one
Mumeeanwwilhl ilhea,vyeoumawnilyl fninedwthaantdahdidghinlyg ucsaenfturilpsspteollsthfeoirr irlelupseiorntoisirtse.
now makes the playing of illusionist characters immediately ACDTiom:f ½E(A: slSteepgremacteiioannlt ) istBycamuesaenss aofliaghdtimsocuarnctreip,tothebeillcuosimone-
msaomree daessitrhaobslee. fTohremcaagnictr-iupssefrosrotfhethesusbt-acnladsasrdarseorbt.aTsihceallmy athine pweeramkeearteodr tbhyelivgehrtyraayirs.toIfbliegchotmsoeulrecsess
adniffdertehnecyehsaavereatnhaetnitlilruesiaodndisittisongaelntyepraellyofhcaavnetrifpewneort konfotwhenmto, amreedituomb-seizeadffeficrete, d(s,uacbhoaust 6in taorcfirheepsla,cae
maIlgluics-iuosneisrtss. learn many of the same cantrips as do apprentice or acocnatminpufairlel)i,gh72t candles, or even a light
amdadgiitcio-uns,ecresr,taaisn ionfdtichaetierdowonn ptheettytambleagbiceslowwh. iTchhetyhehyavmei,ghint or spell can be affected.
hbaevloewl.eOartnheedrw. Tishee, saell sppreocpiearlticeasnptreiprstaianrienglikteowmisaegeicn-uusmeerracatend-
tripURLseesgveaeefpurrpdsl eleyCmda:taon2int-tr:5hipo3ss-:6eA(esdm4mp+alo2gy)ice-dusbeyrsi,llu-3sionists. abTohvee ldigimht csaonutrrcipeswtioll caat ubseestasnhyedofotnhley
6 MAY 1982 ahrosaulcnfadtnh.deTleiorsr,nchocaermnsdawlelislrlawbduililranbnuoctenglyflooawrsodbnimreiglyhf,utllayl
fire will become torch-like in illumina-
tnioonr,maanldbraigllhlitgnhetsssp.eAllfsfedcimtedtolighhatlfmthuesirt
sbpeewaitkhian m1”aogficthael pcahsrtaesr.eH(esuocrhshaes mBueset
Row Nout or Rhee-Oh Stat) and make a
fdeocwtunawtaerdthme octaionntriwpi.th one hand to ef-

61

CAHTao:zfe½E:(sA1e”lgtemcruaebtnieotn) moWsphheenrea ihnatzheecdaenstirriepdisacreaasto, ftheeffeact-t
becomes cloudy, as if layered by smoke
Mask (Illusion) oarttefimllepdtinwgithtofldoiasctihnagrgdeusmt.isAsnilyescroeractuarset
A of 1E/:61speegrmsoennt shpaezellswailtl abetaarfgfeecttesdc.reTehneedtarbgyetsuisch5%a
CT: harder to hit, so missile discharge is at -1
“otnoehiist”gaivnednswavhienng oththroerwwsisaerenoante+1is(aolr-
sloawveed,inaltthheoulgahtteitr icsaosnel)y. aHi5d%ingchinanscheadto- Noise (Illusion) illuTshoerycsaosutenrd oof f awhnoaitseevecrannatrtiuprecahueseosr
obwysaisha5z%e cmaonrteripe.ffTechteivehawzhyeenffseccrteelansetds ACTo:f 1EI6: 1s”egment she desires, although it is indistinct and
but a single round. It must be cast over cmounrfmusuirningg. Tsohuunsd, haes oifr mshaenycavonicceasusweerae
Mirage (Illusion) apnhearirceacownidthitiionn1s”woifllthdeesctraosytethr.eAhtamzoesi-f gsrpeeaatkdinisgtabneceh,inad rausthhiincgk sdoouonrdosrimatilaar
ACTo:f ½E:s2egsmq.e” nt gapueprspstleicoatfhbweleinh—dazseap.egTlohl owedicllbairsmeteemzreeh,durimaaitnse,layetmdc.iesAl-- atondwisncgrsapainndgwaisndif cmomanbyinpeedo,pslheuwffleinreg
tohdey bwohdiley tthoe ehfafencdtsuamtaekethipsascsaenstrbipe.fore moving things or walking slowly but at
wsoitmhine tdhiestaarnetapolfaecfefe,cettwc.illAblel csruebajetucrtetos
A mask cantrip enables the caster to tihneg ctharnotrwip.,Sbuuct ceeascsh niseegnattietlesdthtoe anosiasve-
walhteartehviserorshuebrjevcistagined,ivoirdtuhael v(ihsaugmeaonf, with respect to the individual. Range is
dcheomosi-ehsu, mbyanm,eoarnshuomf aillnusoiiodn). hEearos,r hsahier, c1a”sftoerr tphoeinctasnatripd’isgirtaadtiutsheofdesosiurendd.aTrheea
head shape, facial features, and all such aonf dthtehennoissoefstlydemsairkeeds. sounds imitative
mapseapeserksctswcliololsfoeanlyplypoebraercaadnnecteedceattraeebcltaefiflilefucsatieodvn.ieaTwnheder
Tdoheescasost.eTr htoeuechffeescthliassotsr fhoerr3f-a6cer,outhnindkss. Rainbow (Alteration) By means of this cantrip, the caster
aofwthoerdddeessircerdipfteivaetuorfetsh,eanvidsathgeendsepseiraekds. ACTo:f 1E/3: Sspeegcmiaelnt wbrhinicghs einxtaocbtleyindgupalipclaatnees oaf praaisntbeol wco. loHres

This cantrip lets the caster cause an foorost-hweidceanbacnadusoef tchoislo3r 0to-foaortc-hloningto, 1a-
tahraena ittoisa. pTpheeamr itroagbee csaonmtreipthbinrigngosthaenr bowed shape, remain a ribbon, twist and
illusionary scene to cover the area. The
alersesa, manudstthbee mreilraatgiveelmy uflsatt baendanfeaactuturea-l
cpalascteer, ihnaesxaisctetunaclleyabtethheeldti.me, which the

A saving throw vs. magic is applicable.
Tcohnececanntrtaritpesl,asatslthfoourgahs leoancgharsouthned ctahseterer
is a 5% cumulative chance that it will
wtinriagpv,aearmsaiwnradigIIeredwviseiplalelilnistilsltuatsnriuotleny dnoiarstpdueirselp.tehTleomcuaacngh---
ic. The caster must speak a word or two
adessicnrgipletivpeasosf tthoecmauirsaegethaenmd athgeicntmo abkee-
gin. It is maintained by concentration
alone thereafter.

DRAGON 7

rtuairnnb,oewtcm. Iunsat nbye ewvitehnint, 1o”neofetnhed ocaf sthteer 62
when the cantrip is cast. The colors will
g(nloowrmsaolf)tldyaarnkndebses.vIifsinbolemeovteionninistodtea-l cantrips over the course of his or her apprenticeship. The Dun-
tshireedra,inthbeowca. sIftemromtioany liesadveesitrheed,vtihceinictyasot-f dgeetoenrmMinaestiferit misuosftscuaitraebfulellynaretuvrieewanadnpyopwreorpwosheedn ccoamntpriapretod
erermmauinstwciothnitnro1l ”itobfyith. aTnhde graeisntbuorewawnidll to existing cantrips herein. In no event is it possible for any
gcilafarsetzhtaeeftouacrtrae1thssetreofarruainlkiinndebgeoapwntosdfosittrhaienv1ne-m4fvaossedt.igeommnaae.wngVatisecy,r.wb2Aa-il5llll apprentice to have developed more than three new cantrips.
clbaoonmtdh,phpoeangneednest-lefisoer,ametncaa.)mpwyerhailoemf itpdhoeswhfienargpee(rg.saor-f Reading and recording cantrips

Two-D’lusion This cantrip is virtually the same as a Since cantrips are magical, they must be read as would a
ACT(oi:fll1uE/s6:io4snes)gqm.” ent pThhaentcaassmtearl cforercaetsesspaetllwion-dmimosetnrseiospneacltisl-. ssapemlle. Lpirkoecweidsuer,etoisrefoclolordweodneasinina srepceollrdbionogkaorspoenlla. scroll, the
alunsyiovnieowfewr hoabtseevrevrehseitofrrosmheandeasnirgeles.oIff tioWn eolln, GthoeodsuFbojelkc,t tohfatcacnotmripplse.te(sDuthriengwthhoelecoofurksneowonf thinefornmeax-t
more than about 45° from its horizontal yoeccaurro, rbesoca, umsoerethecoAulDd&bDe®agdadmede, soyrssteommeismviintaolr, cbhuat nagneysamlteigrah-t
oillruvseiornticwalilvl ibeewcinogmaexiims,mtheedinaatetulyreaopfptahre- ttihoensinwteilrlimbe.)immaterial to your use of cantrips in campaigns in
e(dnist.peItl iislludsiiosnpeollreddisbpyeltomuacghico).r Tmhaegiilc-
rlueasrio. nIt liassitnsvaissiblolnegfraosmthethceasstiedrecoonrctehne- This brings us to the subject of the next few issues.
ttrhaetecsasutpeornmiut.sTt ospeefafekcatupahteratshee dceasnctrriipp-, cokobinIuvtdirossueeese,nlymobusungtoahttshtethifoyeIccchoaaannsvteerh.ibaigNuvneetoeitrhneheedriwscploesrorfpiffceiecslsl,esssa!ionLnodencndatrnhuLieadhksamovtfokaeoatt,cehabranuotstriftpbhsnies,eewoinsf
tlaivremofottihoenilwluisthionhiws hcilloesmedakhinagnda.circu- smpaenllussfcorripbtosthomcleermicsonatnhds dprausitd,sa.sLkeinngsethnattmI epaastshiucpkosnhethaefmof,
tahmemendforopr uobthlicearwtioisneifreIvaispeprwovheedre. Hnaevciensgsmaryys, ealfnduntdheerntaskuebnmtoit
Other cantrips egtthrrxiobepuuaaptnilotdoenfrtahwthteiaoosslnisemtacoonofsdntatrrvwiebaevuililtascioiobonmlnesesnt.opeWecbleliestshssfoaehrerisynt.hpeb(eEsyredmrietciosalarsd’siseosrnsne,oswI,teahL:saeTvnthhe’seedcnofoiernnswe-t
It is possible that an apprentice will have developed other cleric spells presented in issue #58 of DRAGON Magazine.)
cwlheSircoichosnw, iwdllrilduleibdteasgi,lintmheaagcloiucnr-gruesnseetrrlsiise,tsaoonffdacdoildlluuitsmioionnsnsistuotnsdt.heeIrf stthphieissllhsleisoatrsdtinfoogfr
material is meat and drink to you, I urge that you be certain not
tfoormthisesreaanryeoofvtehre1n0e0xtspseevllsercaol misisnuge!sUonftiDl tRheAnG..O..N Magazine,

8 MAY 1982

63

in a magic-user’s career (having higher spell-level capacity
than “beginning” books) are not supplied by a M-U’s master,
but must be composed by the M-U in question as part of his or
her training when the spell caster is trying to rise to the next
experience level. This composition will take from 4-7 weeks for
each new standard book; the book is composed during and
after the time when other training exercises are taking place.
The same caonsdts/cporimcepsosaepdp:lyAnwyhesntansudcahrda sbpoeollk bisoobkeirneg-
manufactured
quires a 1,000 gold piece investment for materials plus 100 gold
pieces per level for each spell entered within the book, payable
when a magic-user adds a new spell to his or her repertoire.
(Entering a first level spell costs 100 gp, a second level spell
costs 200 gp, etc.)
A travelling spell book costs 500 gold pieces for materials.
The cost of each spell contained awsithtainndsuacrdh abobooko.kAilnl ttrhaeveslalimnge

saps ethllebcooostksformeunstterbinegfaabsripcealtleind by the magic-user, or otherwise
discovered as treasure by the magic-user or his or her asso-
ciates. A player character cannot automatically possess one at
the beginning of his or her career.

by Gary Gygax PhAyssictaalndasapredctsspeolfl sbtoanodkarisd books 16 inches in height,

©1982 E. Gary Gygax. All rights reserved. approximately
12 inches wide, and 6 inches thick. (The DM has leeway to
reduce or enlarge this general size, although nothing smaller
All information regarding spell books in AD&D™ gaming is than 12 x 12 x 6 inches or larger than 18 x 12 x 9 inches is
currently inferred. This was not, Gentle Reader, by design. recommended.) The weight of a standard book is 150 gold
Simply put, I overlooked it in the morass of getting three vol- pieces (adjusted upward or downward for varying sizes). The
umes put together. In order to rectify that oversight, the follow- encumbrance value of such a book is equal to three times its
ing rules are offered. When the ADVANCED DUNGEONS & weight (450 gp or thereabouts), although it is correct to assume
DRAGONS® Expansion volume is completed (please don’t ask that a volume will fit within an otherwise empty backpack or
me when!), the same rules will be included therein, although large sack.
some minor changes are probable. In any event, stalwart read- The cover of a standard book is typically heavy leather —
ers of DRAGON™ Magazine are again getting the straight dragon hide, gorgon hide, etc. — inlaid with metal so as to
goods first! provide both extra security and a means to close and secure the
book. Vellum pages are sewn together and secured to a fine,
SPELL BOOKS supple leather spine backing. Pages are secured additionally
When a magic-user completes his or her apprenticeship, it is by fine leather front and back pieces. It is also usual for such a
aBsosoukmoefd Fthirastt hLeevoer lshSepehlalss one, or possibly two, spell books. A tome to have vellum stubs at intervals for insertion of additional
will certainly be possessed, and there pages, although this by no means allows for any increase or
might be a Book of Cantrips as well. The latter depends upon change in the number and types of spells the book can contain.
the options of both the DM and the concerned player. The sodtriasNbinnoodottweakgi,rt”dhrwassttiatipohnend+l,li2nabgtnoododaklinicgyehhartsosnplilaesncgsmiaaaavltditnaepgcrtokothtsesr.ocatwvioeneasqguaapillnatsoctetadhcaitdtho,effri“erleeoabnta,hlela,r
following applies to all spell books.

Types of spell books Physical aspects of travelling books
A travelling spell book is approximately 12 inches tall, 6
There are two different kinds of spell books: inches wide, and 1 inch thick; 9 x 9 x 1 is likewise a good
1. Standard spell books, each of which contains up to working size. The weight of such a book is approximately 30
gold pieces, and encumbrance roughly 60 gp. Five such books
36 cantrips, 24 spells of under 4th level, 16 spells of under will fit within a abatrcakvpealclikn, gtwsipceellthbaot onkumisbsetrroning,asulaprpglee sack.
7th level, or 8 spells of 7th, 8th and/or 9th level. The cover of leather,
such as that from a giant cobra. The hand-sewn leaves of
2. Travelling spell books, each of which contains at parchment are carefully secured to a fine leather backing and
most one-fourth of the number of spells possible to be
contained in a standard spell book: 9 cantrips; 6 spells of
1st 2nd, and/or 3rd level; 4 spells of 4th, 5th, and/or 6th
level; or 2 spells of 7th, 8th, and/or 9th level.

CoAstsotaf nsdpaelrldbsopokesll book costs 1,000 gold pieces for materials glued to the spine. The whole is further secured by front and
back pieces of vellum. A small lock or leather ties are typically
plus 100 additional gold pieces per spell level for each spell used to secure the whole. Pages are very thin and fragile, so
contained therein. great care must be taken to care for the book when in use.
otrraNbvooetolwlkiin,t”hgswtsaiptnhedlinlnobgoboaoknnyuhsaesspsae(clsiikaaevl inapgrostthtearcontwidoanersqduapbllaotocoektdhhaatthsoe)fr“aelegoaanti,hnesart
The cost of a new magic-user’s or illusionist’s initial book or certain forms of attack.
books is assumed to be borne by the new spell caster’s former
master, so the fledgling spell caster will have one or two spell
books at no cost to him or her. Books which are prepared later

14 JUNE 1982

64

time the spell is learned and thereby immediately usable by the
M-U doing the studying.

Illusionist spell books
Illusionist spell books are the same as those of regular magic-
users, wSitthantdhaerdfosllopwelinl gboeoxkcsepctoionntasi:n
1. 24 first or second level
spells, 16 third or fourth level spells, or 8 spells of fifth,
sixth, and/or seventh level. If first level magic-user spells
are known and used by the illusionist, he or she must have
satan2ne. wdTarsrapdveelwlllibonorgkoksfopfreorlflirssbutocolhekvsseplhecollolsdn; tt6ahiinssipntegollmsuepofitsofires2st4soersnpstieealclllsoy.nad
level, 4 spells or third or fourth level, or but 2 spells of fifth,
sixth, and/or seventh level.
Starting spells for an illusionist player-character are deter-
mined according to the preference of the player (subject to the
usual “chance to know” roll based on intelligence). For addi-
tIilolunsailosneacruyriStyc, riilpluts,iownhisictsh may opt to do their spell books using
would only be recognizable as such by
another illusionist. A magic-user may not learn a spell from an
illusionist spell book (and vice versa) even if the illusionist spell
in question is the same in name (and perhaps other respects) as
a magic-user spell. The magical forces released by the casting
of “namesake” spells are similar to one another, but the way in
which that magic is triggered differs from class to class.
Except as noted above, treat illusionist spell books as magic-
user spell books.

Cost of magic-user/illusionist spell casting
While the cost of having a cleric cast needed spells is reason-
ably well detailed in the Dungeon Masters Guide, the cost of
VaAluestoafndspaerdll bspoeolklsbook has an Experience Point Value of 1,000 magic-user or illusionist spell casting was neglected. Rather
than give an extensive list of spell costs, the following set of
points per spell level contained therein (considering cantrips as guidelines will enable the DM to determine a “reasonable” fee
first level spells for this purpose), and a Gold Piece Sale Value forBaansyicspceoll.sts: A willing magic-user or illusionist will typically
of 200 gp per spell level (but only 150 gold pieces for each work for a fee of 200 gold pieces per spell level. Double the
material component(s), or material components of at least such
caAntrtirpa,vief ltlhinegbsopoekllisbooof kthhaat ssoarnt)E. xperience Point Value of 500 value as substitutions, is also considered to be a part of the
baAsidcdfeitei.onal costs: Failure to furnish the material compo-
points per spell level contained therein (again, considering nent(s) of a spell which has ordinary sort will incur a surcharge
cantrips as first level spells), and a Gold Piece Sale Value of of 10% or three times the value of the component(s), whichever
1,000 gp per spell level (applies to all spells, including cantrips). is greater. Any extraordinary component(s) bring a 100% sur-
charge or three times such value, whichever is greater. Spells
As with any other magical items, spell books must either be wIdheicnhtifyp,lawcehicthhecacuassetesr in danger (including such castings as
sold immediately or else the X.P. value taken. This holds true a temporary drop in constitution of the
regardless of whether or not any tome is eventually sold. Thus, caster) require at least a double fee, and guarantees will be
a spell book cannot be kept while a particular spell or spells are
transcribed, and then the work be sold for G.P. Sale Value and
the proceeds taken toward experience points.

Casting spells directly from books required as well. Spells which age the caster will be cast only if a
In extremis the DM may allow a magic-user to cast a spell counter to such aging is awarded prior to spell casting, or else
directly from any sort of spell book just as if the book were a the aging is insignificant to the caster. (A young elf will not be
scroll. The book must be of appropriate sort so that the spell overly concerned about five years, although a ten times normal
matches the profession of the caster, i.e. magic-user spell, feeMmagigihct ibteemchpaargyemd!e)nt: A magic-user or illusionist will general-
magic-user spell book. The caster must have read the particular
spell. The caster must be able to know and use the spell in ly accept some item of magic in lieu of cash or like valuables. In
question. (Note that in this regard, reading directly from a spell such cases, the sale value of the item, adjusted downward by
book differs from the use of scroll spells!) the general reaction of the spell caster to the individual request-
Direct casting of a spell from a spell book automatically ing his or her services, is to be considered the base value of the
destroys that spell. There is also a 1% chance per level of the item. The character and behavior of the NPC encountered will
spell that the spells immediately preceding and following the always be the purview of the DM. Such character or behavior
spell cast will likewise be destroyed. There is an additional 1% wilHl, onsattuilreallsyp, eolfltecnaasftfeecrst :coInstgseannedralf,eaesh.ostile spell caster will
chance that the casting of a sPpeerllmdairnecetnlycyfromspeall,spfeolrl book will
destroy the entire book. A instance, either charge at least double normal fees, or else he or she will
would not prevent a spell from “disappearing” when cast in this simply refuse to cast any spell whatsoever — unless possibly
manner; even though writing might remain on the page, that bribed to do so with some magic item. Any spell caster of good
writing will no longer be magical in nature. alignment is quite unlikely to cast any spell for a character of
These strictures aopr ptlhyewbhoeothkeor f aansoptehllerc.aRsteeradis Musainggichiiss or evil alignment in any event. Again, adjudication of such events
her personal book re- is SthpeerlelaclmasotifntgheuDnMde. r duress: Use the rules in the Dungeon
quired to read another mage’s spell book, and a magic-user can
learn a spell by reading it in another’s book. This learning Masters Guide for all magic-user and illusionist spell casting
process requires 2-8 hours of study per spell level, after which under threat, magical influence, etc.

DRAGON 15

65

by Gary Gygax AStbreilnitgyth Dpoicinettoscfoinred Saspepceiarlfiogrhtbeornus
©1982 E. Gary Gygax. All rights reserved. WInitsedlliogmence best 33do6f 9d6 aass ppeerr ttaabbllee iinn PPHH
As usual, I am working on too many projects at once, and Dexterity best 43do4f 7d6 +2/point over 14 *
seoamche gpeotinstaqubiitteoaf afettwensthioonuldbustusdedeemnlys btoenceovmeprlegteetd,doannde.mAyt CChoanrswaistrihmtmuea*tno—iorantryDmpeoexrste.wrIifotyranbtboliesenasubtsse3t3ldtfooao6wfiral8tryhdme6bourfalkciryl+alays2assbrphmuea.lporkp.yrtp/aplioisboerlisenwbtooiunonrlnkvPlyye,Hr 14
opfrfotdhuectbivaitrybawriilal nsecehmargarcetaetr icnldaesesdw. hMicehanthwehitlee,stIehrsavheavdeusetend- erexcdeuscseotfh1e4.bonus to +1 per point of dexterity in
joyed the most of the new classes I have proposed for the
enxepeadnsmioonreofwthoerk,ADba&rDb™ariarunlsesw. eWrehilienstthaentolytheursecdlasasneds esenejomyetdo Race of barbarian characters
cbhyatnhcoesetoeategsetrthfoer calacshsanfogrey. oNuorwselyvoeus, aGnedntsleeeRiefaydoeursa, ghraevee. a Only humans can be barbarians.
BARBARIANS
miBghatrbsaeerimanrsatahreer asimsuilabr-ctloaspslaoinf ffiigghhtteersrs, .bAutt fairstht ogrloaungchestthuedyy CcCBHhlaaAarsbrRsaaAcrotiCaefn*Tr—ERTChHetLdiyt1Apin2dSeiitSeiaElMSdaioeTxfA.rhoBni8lutLl*EmdfoicrbIeae(ardbdairtbaiSonabnporiliae*ai*tlln)yl Clansl osi mnleeivtel
of the sub-class will reveal that they are by far the most singular character
tryapnegerins, tahned wpahloadleinsfi)g.hting genre (also including fighters, tcraenatneedvears b7e, bleustsatlhl aandd7i,tiownitahl sroclolsreasreofa1s tsoho6wbneibngy
ChBaararbctaerriaanbsilihtiaevse no major characteristics and thus gain the die.
neither a penalty or bonus with respect to experience points. abbuit*li*tt—ihees.sSeominenabtaerbsapreialln-likaebilaitbieilsitireesseamreblneost pseplelsl,l
Barbarians never have psionic ability per se. To determine the
characteristics of a barbarian character, use the following
table:

66

CHARACTER CLASSES TABLE II (additional) and general weather prediction.
theTrsaacmkeingle:vTehl,isbustkaill bisarebqauriaanl tomathyattraocfkaornalynginerthoef
CBahrabr“faaaCrci*irhaltyean—rrbaauPAcnlatkryermyt*riaooalrrbloibSlsaiutshnilekyioeysfl”dadaerbmxotoevrrieaWtyu)nneywblaoiikplnleuomlysn.a(sskeeeOyweinlseoaterinungdPoeofr i?son outdoors.
Secondary skills are generally not usable (certainly not to
MaBgaicrbaarrmiaonrs, dsehtieesldtsm, aagnidc awnedapdoisntrryust those who use it. They tbhaeriiranfu,llaelstht opuogtehntthiael)siknillasrecaasn wbehicahppalireedutnofaamnileiawr tlooctahlee wbaitrh-
awsillsruecfuhs. eThtoeyemwpilllodyeasntryoysomrtaogficmiategmicsitief mtheifythheayveretchoegirniwzeayit. dcoifnfetirniunagl feloxrpao,sfuaruentao,tahendnecwlimaaretea.after about one month of
While a magic-user will be shunned by barbarians, clerical ingTetretiratirayrysksikllisll:s,Badrebpaerianndsinwgillonhatvheeolnoecaolremaonrde coufltthuerefofrlloowm-
ssppeellllss anroet ntyopticraegllyarudseadbales bmyaagictrib(eaxlcsehpat mfoarnthoer lmowor-elevpeolwcelrefur-l which thAenyimoarligHinaantdel.ing: Usually dogs but possibly some
ic), so barbarians will associate with clerics on occasion. olytnhxe,reatcn.imals such as wolves, large birds, giant

The Barbarian: General description Horsemanship: This skillhcaonudlldingalsoof dinracfltudteeamthse.
skBillasrbnaericaensssaarrey aforsusbu-rcvlaivsasl oinf faighhtoesrstilewheonvairreonamdeepntt.atThmeasney Long Distance Signaling:
sclkimillbsinign,cluusdee orfapmidanmy owveeampoennst,,
Tsceehrcetaoyinndaa“rsreiyxthliaknseedwnissteeesr,t”itaoaruyngdhsmkaiallnnsdy. fDlarsuhmess, , etscm. oke, mirror
able to recover from damage Running: This skill im-
nquoTBnicha-kelralbywb.aafrusialenamsliogmvnemamyeennbtt.eraotef
barbarian is 15”. any cpalinesmtohvaet athtedobuabrlbeanrioarn-
for a tmhaanl stphereeed fdoarynsobfeefworeer
hinagviangdatoy“mreostv”inbgy aspt ennodr--
Languages: A barbarian knows mal speed. Similarly, en-
only how to speak his or her sdniutouraramtniocanesl. wf oillr bme otvweicme e n t
oCwonmmtroibna. lA/nabtaiorbnaarliatnonmguuset leaanrdn
tdoerseiraedsatnodhwarvitee tihf oheseorsksihlles.sAo Small Craft, Paddled:
barbarian can learn languages Tbuhiilsdinsgkiallndinucsleudoefssmthaell
gaecnccoer.diInngantoy hcaisseo,rahbearribnateriallin- canoes and hide boats.
does not use alignment language skSillmianlclluCdraefst, tRhoewbeudi:ldTinhigs
of any sort. of wooden boats and the
trhoewmin. g and/or sailing of
Special skills: A barbarian
climbs trees and natural cliffs Sound Imitation: This
t(hoirelfedogfetsh,emsoaumntaeinlse,veetlc.w) oauslda sainkngidllosifnobcuilrnudddsae,nsdetihtaheneimrmfaoilmrcilacuklrls--
cclliimmbb wwaalllsls. Bofarobtahreiarnksinmdasyoanlcseo ing those creatures or for signaling purposes.
ttohepyrahcatviceehsacdaltinhge aopppaorrtitcuunliatyr Trap Building: This skill includes the ability to
type of surface. Barbarians can construct deadfalls, pits, and other traps for large or
whiodueldinhnidaetuinraslhsaudrorowusnidf itnhgestaersraainthiiseffaomf itlhiarreetolethveemls,hoigthheer-r even very large animals and like creatures.
wise, the hide as a thief of the same level. SpBecairablaraibainlistiehsavaendthdeeffeonllosewsing special characteristics:
50S%uropfritshee: tBimaer,bainrciarenassisnugrptoris4einop6p(o6n6en2t/3s%a)t wlehaesnt
ingSesceocnodnadrayrysksikllilsls::Every barbarian possesses all of the follow- tthheeymasreelvinesfaomnilliyar1t0e%rraion.f tInhetutrinmteh,e5y%areinsfuarpmriislieadr
traSpuprivnigv,al:fisThhinisgs, kfiolloidnclguadtehserhinugn,tinsgh,elstemralbluainldiminga,l terrain.
body covering, and fire making. froBmacbkehAitntda,ckin:cAlundyinagttesmucpht taottaatctkasckbay baasrsbaasrsiianns
and/or thieves, has a 5% chance per level of the
First Aid: This skill includes binding wounds, set- ibfaarbbaariarbnaorifabneidnegtedcettsecatedbaacnkd actotaunctker(ewdi.thThaat5i%s,
atinppglysinpgraninastuorarlbprookiseonn baonntiedos,tecson(1c0o%ctinchgaannced/oorf
success unless poison form is known; then chance DRAGON 9
rinisgesantod 5a0p%plypinlugsnvaitcutrimal’scucroensstfioturtmionin)o, rainlldneksnsoews.-

Outdoor Craft: This skill includes animal identifi-
cation, plant identification, direction determination,

67

chance of so doing if he or she is 1st level, 10% if ExPp0eo—riBnie6Atn,s0Rc0Be0ARIANrSELiexen1(pvFceeIelG- HfoTlrEPHRa-cisStci)duP1em*TodAiundlBtasicLteeEd I.
f2onrdm, eertcb),acthkeabttaarcbkarbiaencoamvoeidssathneoramttaalckatftoarcmk.. TThhee 162,,000011——1224,,000000 23 TLietvleel
bbaacrbkaaritatanciksear,lseovethnentheonutgithletdhetobaatrtabcakriathnemfoarymaelr- Barbarian
ready have engaged in what would otherwise have 23 BBaarrbbaarriiaann
been his or her full normal combat for that round. 4284,,000011——8408,,000000 546 45 BBaarrbbaarriiaann
18500,,000011——125705,,000000 7 67 BBaarrbbaarriiaann
Leaping and Springing: Barbarians are able to 275,001—500,000 8 8 Barbarian
sfleetaaeprtt.buIapf catkobwleaartmod,amxoiomrvu3emffredeeiestltyaunapcnwedaorgdfe1tf0raofmeruentanfoisnrtwgaansrdtdai,nrt3g, 11,,505000000,,,000000111———11-,,205,000000,,0000,000000 11910 888+++1842 BBBaaarrrbbbaaarrriiiaaannn
the forward leap can range from 16 to 21 feet, and 500,000 experience points for each additional level
ttihveeluyp).wSarpdrilnegaipngfroumnd4e½r stoim6ilaferecto(nd6ditaionndsd4givreesspeacn- abo*v—e tIhneitia1l1dthie. roll for hit points must be at least 7; rolls of
suuprwfaacredudsiesdtaansceaosfte4p—to7 gfeaeint,hdeeigphetnadnindg“sopnrinthge.” 1 to 6 are treated as the minimum result of 7 points.
elervDeseleteoncfstedIeliltsuesramiocnint:uinaBglalyrtbhaaanrtiasnilolsumsheioanvse/ipghhata,n5s%taosucmnhda,snpocreelloptohe-fr
snhoeovwmeeerveetyxrc,peethe.deR7ceh5g%aan.rcdeletsossoofdtehteecbtasrubcahriaspne’sllslemvealy, BARBARIANS’ ATTACKS PER MMEeALletEteaEckRRsoOupnUedNr D TABLE
sonifooDdtnee/tpottehecpactentMirtnasagosgmniacs.n: yTwBhahsirosobraaatrpiroaepfnlsmaiebhsalaegtvoiectoiatoeetmbhffaeessrceotthr2ma5s%anpgeaclilcnsh.,aiFnlblucoue-rt Level
gaeaancinhaeddlde. ivtTeiohlnetahlceh5ab%nacrbteoartitoahnesogcahdianensteccbeteytmooandydenttehecevte1rmseat xglceiceveeidsl, BBaarrbbaarriiaann 16--510 1/1 round
90%, regardless of the barbarian’s level of expe- Barbarian 11 & up 32/2/1rorouunndds
aribenilictye.. The type of magic is never revealed by this
CClhaasrsacotfer WNEWuAeImPnaObi6pteiNoarnl soPfROFICprIEPoNNefi-ncoC1ainYel-tnycTyABLWEAed1acd/pi2eeondnlcesyvP/eLrilonesfvie- l
Barbarian

10 JULY 1982

68

aNnoIdtneiSstiapRleaenrgu.amOrdbnienergoorWf mweaoepraeopnoandPsdriotmiofinucaiseltnricneyqculuTirdaeebdleAw:xeeap(Honasndb)a,sKednifoen, Stonefist, would produce Scandinavian/Slavic-type barbarian
native area may optionally be decreed by the DM. sfighhotret rbso. wTsheasseacdhdaitrioancatelrsreqwuoirueldd ienmitipallowyebarpooands.sHwoorrsdesmaannd-
sahndipinwomuoldstbceasneosmthinealskaitll boefsmt,abkuintgruannndinmgawnnoinugldrboweendorbmoaatls,
baCriahnaraisdmdsa:hiWs hoer nhedrelaelvinegl owf itehxpoetrhieenr cbeartobahriiasnosr, haergicvheanrisbmara- woNuoldmeaxdisst.from the Rovers of the Barrens, Tiger, and Wolf
total to get an effective charisma effect upon other barbarians. wNooumldadaslswoohualdveberuenxncinegllesnktillhoarssewmeell.n,ThaendRtohveerfos,rmbeeringgrothuep
wmiothstskbiallsrbinaraicnigmroaluhpa,nwdoliungld, paalsdodlleikdeslymgaellnceraraftt,esionudnivdidimuiatals-
Combat: Barbarians use the table for normal fighters. tion, and trap building. The other nomads would be most effec-
tive in long distance signaling. Rovers would be skilled in wea-
Saving Throws: All barbarians have the following bonuses to wpsiootenuslsdhsuhocarthvbeaosswu.tchhe wclueba,pojanvselians, athned llaanscseo,osrcismhoitratr,boawnd. Ncoommapdos-
their saving throws:
Savages from the Amedio Jungle or Hepmonaland would
vs. poison +4 shmavaell sckriallsft,insoluonngd dimisittaanticoen,siagnndalintrga,prubnunilidnign,g.poTshseibirlyrepqauddirleedd
dpeaarathlyzmataiognic ++33 cinluitbia,lawnedadpaornt sorwjoauveldlinalisnothineclAumdeedtihoe. Wbloithwgreusnpeocrt sthooHrtebpomwo,-
petrification ++32 wnaelaapnodn,sth. e(Eadtiltaotrl’sanndotjea:veOlifnfi,cicalul bs,taatinsdticsshoforrt sthweoradtlaatrleatnydpitchael
proodl,ymstoarffp, hwand ++22 blowgun will appear as part of this column in next month’s issue
breath weapon +1 of FDroRmAGthOeNf™oreMgaoginagz,inteh.e) DM can understand why it is impor-
spell tdaonetstothgisiveheblparbdaerteiarnmcinhearwacetaeprsonas ninaittiivaellyhokmnoewlann,db. uNtoitt oanlslyo
serves as a base for judgement as to the skills and abilities of the
beThaeppalbicoavbele.bonuses are in addition to any others which might bhoamrbealarinadns.wAhfetenr haepoerriosdheofvdewnteullrinegs iinntoa npelawceasreoau, tasidbearbnaartiiavne
cnhaatirvaectteerrrditooersy,bbeuctomunetilatsheenffemctaivneyaosf htheeoarbsihliteieiss ainndhisskoilrlshoefr
coNmaetifvreomTesrormitoeryo:utI-toifs-thmea-wndaayt,obryartbhaarticbsatrabtaerioarn acrheaar.aTcytepris- the character will be severely curtailed.
cally they will come from wild tribes, nomads, or groups of
tgshaeevnaesgrtoaectsek. tSfhrouemcnhewuchenisccsihvailrbiyzaersdbuararroiraeunansdfiiganhrgetserttshoewporoonudllyducpbeleaicndedrsaivwitdhnua.at lscaonf

Relating this to the WORLD OF GREYHAWK™ map, the lands
of the Frost, Ice, and Snow Barbarians, as well as the Hold of

DRAGON 11

69

by Gary Gygax THIEF — Mountebank: This sub-class of thief specializes in
©1982 E. Gary Gygax. All rights reserved. deception, sleight of hand, persuasion, and a bit of illusion.
The barbarian class (issue #63) was, as mentioned, only one These factors, together with speed, are what the mountebank
of several new classes being considered for inclusion in the relies upon. However, disguise and theatrics also provide valu-
expansion volume for the ADVANCED D&D® game system. able tools of the trade to this class, so that one might never
You, Loyal Readers, have a chance to input into this projected know one has been had by this class.
work, and I would be pleased very greatly if you would do so.
The classes under consideration are listed below. Let me know THIEF — Specialization, Acrobat: A normal thief, after attain-
which you like best, which least. I will then work up each class ing a medial level, can opt to continue as normal or become an
fully and present them, in order of preference, in this column. acrobat. Although no further skills of the type which considers
This will be done prior to publication of the new book. If time manual dexterity would be gained, the thief-acrobat would gain
presses, perhaps the Understanding Editor will allow sufficient skills in leaping, vaulting, tumbling, tightrope walking, etc.
column space to run two classes in one article. What follows is a Such a thief-type would be the cat-burglar sort. The earlier
brief explanation of each proposed new class. Again, your specialization takes place, the greater the acrobatic skills, as
comments will be received with thiJsESspTeEcRiali—zatiRonobwKouunldtz,hainvehisancuurprepnetrlyliumnitpuobflisshkielld. module,
pleasure!
CLERIC — Mystic: This sub- The Tower of Zaeen, has in-
class of clerics is concerned cluded a jester. A recent
more with prediction and detec- DRAGON™ Magazine (issue #60)
tion than are other sorts of cler- also included the jester as an
ics. All mystics are of Good NPC class. Because I have also
alignment, although they can considered the jester as an ac-
be chaotic, neutral, or lawful tual class for the game, I have
within the Good alignment. As not as yet read either descrip-
with other sorts of clerics, mys- tion. Jesters, as I envision them,
tics would have seven levels of can be of human, gnome, or
spells, but most would be of the halfling race. (Elves could never
sort to divine or detect. Howev- permit themselves to be so de-
er, some new spells, and some based; dwarves are far too se-
very powerful upper-level spells, rious and just plain humorless.)
are planned. Alignment is as desired by the
FIGHTER — Cavalier: This player. A jester would have a
sub-class of fighter must be of combination of verbal, magical,
knightly or noble origin, so the and acrobatic skills which allow
class type would be usable only the class to be viable even
in those campaigns which had though there is no great power.
social systems of a sort approp- Verbal skills would enable the
riate to this. This class allows character to influence many
any alignment. It differs from creatures toward kindliness,
other types of fighters mainly in humor, forgetfulness, thought-
that its members would have ful consideration, irritation,
more basic weapons, horse- anger, or even rage. Magical
manship, and possible organi- skills would have to do with
zational abilities to allow for jokes and tricks — sort of a di-
more henchmen and followers. At its upper levels, the class rected wand of wonder with
would also gain additional strength and constitution points due some magic-user spells and il-
to training and exposure to hardship. lusionist magic tossed in. Acro-
MAGIC-USER — Savant: This sub-class of magic-user spe- batic skills would be mainly
cializes in knowledge, understanding, and arcane subjects. tumbling and juggling, with some magic tossed in there as well.
Thus, as do mystics, savants possess a fair range of detection Level titles are: Wag, Punster, Masquer, Harlequin, Clown,
spells. Although they know many standard sorts of spells as Juggler, Buffoon, Fool, Joker, Jester. Powerful at its upper
well, savants have many new magics in the nine levels of spells levels. the class will be less than popular with fellow adventur-
possible for them to employ. Savants, can use spells common ers, I suspect, so that jesters will frequently have enemies and
only to clerics and druids, and at higher levels savants can read travel alone. . . .
and employ scrolls of all sorts. Because of the scholarly aspects THE GRAND DRUID
of this proposed class, elven and half-elven savants are envis- A study of the information pertaining to druids will reveal that
ioned as being able to progress several levels higher than if they there must be something above the Great Druid, for each area
were normal magic-users; i.e., 14th or even 16th for elves, 10th or land can have its own druid of this sort. Somewhere there is a
or 12th for half-elves. Savants can be of any alignment. Grand Druid. This druid has 3,000,001 or more experience
points, is 15th level, and is attended by 9 druids of special sort
having nothing to do with the hierarchy of any specific area or
land. Thus, any character of Druid level may, in fact, journey to
seek the Grand Druid and ask to serve him.

DRAGON 9

The Grand Druid knows 6 spells of each level and is also able 70
to cast up to six spell levels as one or more additional spells.
Those who serve him are given three such additional spell them; at 6th level barbarians can affect creatures which require
levels. Three Archdruids roam the world as messengers and +2 or better weapons to hit them; at 8th level they attack as if
agents of the Grand Druid. These individuals are drawn from they had a +3 weapon with respect to their ability to affect
his personal attendants who reach the level of Archdruid. Each creatures otherwise hit only by +3 or better weapons; and at
has four additional spell levels. 10th level, creatures affected only by +4 or better weapons can
PERSONALIZING CHARACTERS be attacked successfully. At 12th level a barbarian can affect a
creature harmed normally only by +5 or better weapons. De-
The statistics of one character can be much like those of spite having the ability to strike such creatures, barbarians in
another, especially so if they are members of the same class. no way gain such a bonus “to hit” or inflict additional damage
However, name, alignment, deity, background development, because of the power. (Cf. “Creatures Struck Only By Magic
secondary skills, height, weight, and equipment all allow for Weapons” in the Monster Manual.) Only barbarian fighter
considerable differentiation. More important, as AD&D™ games characters have this ability, and it is not possible for any other
are for role playing, the individuality the players create, or class or sub-class of characters to possess this power.
should create, will make as many differences between charac- LATE NEWS
ters of the same class as there are between real people. The
element of role playing must be stressed. Any player who does Most of you are not aware that soon I will retire from the
not create a special persona for his or her character is not position of “sole authority” regarding the D&D® game system.
participating in a role-playing game, but rather “roll playing” Frank Mentzer has “volunteered” to assume a new trainee posi-
with dice. But, for whatever it’s worth, here are some choices for tion where he will work directly with me.
complexion, hair color, and eye color for characters. Players
who have not already made all this up for themselves should That the Good Gentleman is talented need not be said. Those
use these choices to inspire more active personification of their readers who belong to the RPGA™ network already know that
characters and more attention to role playing! and have played his modules. Those unfamiliar with his work
will see it soon enough in the additions to the DUNGEONS &
Complexion: black, dark brown, bronze, brown, coppery DRAGONS® game system. Frank began working with me in
brown, golden brown, tan, ivory, dark yellow, yellow, pale yel- July. Sometime in September he should be joined by the re-
low, copper, brown-red, olive, ruddy, pink, fair, pale, white, nowned French designer, Francois Marcela-Froideval.
grayish-white, gray.
When the D&D game project is completed, Frank and Fran-
Skin texture: flawless, fine, smooth, normal, coarse, very cois will be joining me in putting the final touches on the pair of
coarse, pocked, leathery, seamed. new volumes for the AD&D™ game system. That work, along
with a few modules in both systems, should easily qualify them
Hair color: black, blue-black, brown-black, dark gray, gray, to speak with complete authority on either. The upshot will be
pale gray, white, silver, golden blonde, blonde, yellow, pale more game material, better work overall, and more information
blonde, honey blonde, blonde streaked (brown or red), red- passed along by way of these pages. Please give Mr. Mentzer
blonde, copper red, orange-red, red, dark red, auburn, red- and M. Marcela-Froideval a hearty welcome!
brown, light brown, brown, dark brown, salt & pepper (brown/ BEWARE OF IMITATIONS
black & gray), grizzled, gray streaked, white streaked.
All of you are well aware of how many “knock-off” products
Eye color: black, dark brown, brown, red-brown, yellow- are around. They are obvious because without AD&D cam-
brown, amber, golden, pale yellow, hazel, green, bright green, paigns to latch onto, these cheap imitations would be unable to
blue-green, gray-green, pale gray, gray, dark gray, blue-gray, stand alone. I have seen one which contains spells of various
pale blue, blue, bright blue, dark blue, pale violet, violet, deep sorts, including some over 9th level. DMs are cautioned against
violet. use of any non-AD&D game spells of any sort. It is absolutely
MORE ON BARBARIANS stupid to include any over 9th level, for the game has nothing
which warrants so powerful a dweomer. Certainly, deities are
In the course of putting the Barbarian sub-class of fighter employing magic of a slightly higher level, but that is dealt with
together, one highly important piece of information was omit- in a manner which prevents game imbalance. Do yourself a
ted — rules concerning barbarians and creatures struck only by favor and avoid all such fringe products. In the long run, your
magic weapons. I humbly apologize. Here it is: players will thank you for it.

Although barbarians do not employ magic weapons if they
can help it, their natural attack abilities make up for it. Just as
can monsters, barbarians are able to hit creatures otherwise
harmed only by magic weapons. Thus, at 4th level a barbarian
can affect creatures which require a +1 or better weapon to hit

10 SEPTEMBER 1982

71

by Gary Gygax

© 1982 E. Gary Gygax. All rights reserved.

When the cantrips for illusionists and magic-users were deli-
vered (issues #59-61), I promised that spells would follow
thereafter. Well, as usual, various and sundry things interposed
themselves, and I do apologize for the delay. Here, without
further ado, are tAhDeVnAeNwCilEluDsioDnUisNt GspEeOllsNSde&velDopReAdGtOoNdSa®te for
inclusion in the ex-
pansion volume:

N1o3. 1CshtrLoemvaetlic Orb 2AnltderLSeevelfl 3DredluLdeevel
1145 PRheaandtoIlmlusAiornmisotr FUaltsracivnisaitoen PPhhaannttoomm SWteinedd
Whispering Wind Wraithform
Magic
16 Spook

9 D4itshpLeel vMelagic 5AtdhvLaenvceeld Illusion D6ethatLhevFeolg
10 Rainbow Pattern DMreaagimc Mirror Mirage Arcane
1121 SVoalcidanFcoyg Tempus Fugit MPhisalenatadsmagoria

7th Level
87 WSheairddow Walk

SPELL EXPLANATIONS

Chromatic Orb (Alteration-Evocation) fails to save versus magic it will be blinded for the
duration.
Level: 1 CCoamstipnogneTnimtse: :V,1 S, M 2 — Heat from the ruby orb will melt up to 1 cubic yard of
ADRrauenraagetoi:ofn0E: fSfepcetc: ia1l creature segment ice, and creatures not saving versus magic will suffer a
Saving Throw: Special loss of 1 point of strength and 1 point of dexterity for 1
round following being struck by the orb.
3 — Fire from the orb will set aflame all combustibles
tthhhaeeEnrdixellpuasalanirondenaishntituoortnolb/iDatcrreaertsiaectarernsipyabtioeospmtnwp:aoelTlnehgenlenottbhceheherooiflomlurvaasstrihioyciennoigsdrtbehsausienrpedeisn,ltlhhpeeirsontvaoairbdrgilhneeegstr within a 1’ radius of the target, and unless the target saves
creature, and that the target creature is within 3” (the longest versus magic an additional 2 points of fire damage will be
distance the chromatic orb can be hurled). It is magical, and suffered (except when protected from fire by magical or
even creatures normally struck only by +5, +4, etc. magic wea- na4tu—ral means).
rpeosnisstawncilel bweithasftfaencdtsedthbisystpheell,chorfocmoautrisceo. rAbtif1i”t osrtrickleosse.rM, tahgeirce The target subject will suffer blindness for 5-8
is a +3 chance “to hit,” at over 1” to 2” there is a +2 chance to rounds unless a successful saving throw versus magic is
strike the target, and from over 2” to the maximum 3” range the made (cure blindness or dispel magic negates this effect).
chance “to hit” is only +1. The color of the globe determines its 5— A magical stinking cloud of 5’ radius (around the
estfrfeicctet dwhaesntoawshuabtjeccotloisr osrtrbutchke.yLcoawn-lebvrienlgililnutsoioenxisisttsenacree rbey- target) is created when a successful hit is made, and the
means of this spell, although the hues below their level are subject must save versus poison or else be helpless, and
always available should the choice be made to select a color not in any event will be helpless until leaving the area of the
commensurate with level of experience. Colors and effects are vapors (cf. stinking cloud).
shown on the table below: 6 —The turquoise orb inflicts electrical damage, and if
the target is wearing ferrous metal it will be magnetized
for 3-12 rounds unless a saving throw versus magic is
successful. Magnetized metal will stick fast to other mag-
fneecttiezeddwmillectalinl giteumnsti,l apnudllefderfrroeues. metal items not so af-
MofinSimpeu21lmnlsdtCLaesvteerl CGoelPoRnreeuarobarflytyeOdrb 7 — Unless a saving throw versus paralyzation is made,
3rd Flame oHf itD11Pa--mo64 iangtse dSPsfmblpphiiegtprelaeoiieaanhnaertw3grakttdtci1h2enfliniyna9raeessgcltsitissiso7cm4nlo68ud5 the8 —subTjehectscurbejaectutrcerewaitlul rbeewpilal rbaelytzuerndedforto5s-2to0nerouunnldesss. a
45tthh EAmmebraelrd 1-8 saving throw versus petrifaction is made, and even if the
6th 11--1120 save is made, the subject will be slowed for 2-8 rounds (cf.
87tthh Turquoise 2-16 slow spell).
9th ASmapepthhyirset 9 — The subject creature will die unless a successful.
Ashen (pa(sralolyws)is) saving throw versus death magic is made, and even if a
save is made, the subject will be paralyzed for 2-5 rounds.

No1te—s on special powers: spell will be generated and riaTtehehumea,teorriaellsceomapcolneeanrtcoryf sthtael sopneell(issuachgeams doifatmheonadp).prTohpe-
Light equal to a light gcoelmorciasnabpepraosprsimatael.l (in value) as 50 gold pieces as long as its
persist for 1 round/level of the caster, and if the subject

22 OCTOBER 1982

72

Phantom Armor (Alteration/Illusion) Alter Self (Alteration/Illusion)

Level: 1 Components: V, S, M Level: 2 Components: V, S
Range: Touch Casting Time: 1 round RDaunrgaeti:on0: 3-12 rounds +2 Casting Time: 2 segments
Duration: Special Saving Throw: None ArearooufnEdsff/elecvt:elThe illusionist Saving Throw: None
Area of Effect: 1 person

Explanation/Description: When this spell is cast, the illusion- Explanation/Description: When this spell is cast the illusion-
ist creates a quasi-real suit of plate mail. This semi-illusory ist is able to alter himself or herself in a manner similar to a
material covers the subject and actually gives some real protec- change self spell (q.v.). However, alter self enables the caster to
tion unless the opponent actively disbelieves in the armor eafcfetucat la. Ifquthaesi-froeraml cshealencgtee,dshoatshawtinsigzse, cthaen iblleusaioltenrisetdcbayn5a0c%tuaolf-
(saves versus magic), or else a dispel illusion or dispel magic ly fly, but only at one-quarter the rate of speed of a true creature
spell is cast upon it, or a wand of negation affects it. For each of that type.
olefvdeal moaf gtheedsepliveellrecdasbtyera, tbhleowphwanhtiocmh waromuoldr wotihllearwbissoerbhit1 aprmoinort
class 3. When the phantom armor has absorbed as many points Fascinate (Illusion/Phantasm)
of damage as the spell caster has levels of experience, it is
dispelled and vanishes. Any remaining and all additional dam- RLeavnegl:e:2 3” CCoamstipnogneTnimtse: :V,2 S
aegr eisapcrcortueecstedtoatsheif pheersoorns.hUenwtilergeonine,ploartedimsbaeillie(AvCed3, )t.hPehawnetoamr- Duration: Special segments
faormrmosr awlshoicahllowwosulad bboenussimoilfa+rl1y omnosdaifvieindgbtyhrmowasgivcearsrmusora.ttTahcke Area of Effect: 1 creature Saving Throw: Neg.
dweomer in no way affects the movement or spell-casting abili-
toyf omfathgeicawleparroeter.cTtiohne.sTpheell mwialltenroiat lfucnocmtipoonnwenitht isanaysomthaellr pfolartme istEaxtptelamnapttisonto/Dceaspctriivpatitoen:thBeysmubejaencst corfeathtuisres’psealltttehnetiiollnusaionnd-
of mithral (10 gp value) which disappears when the spell is cast. gillauisniointsafrroieunnddshthipe, slopveell,caansdte/or rsoobtehdaitehneceo. rTshhee sbpeeclol mcreesa,teins tahne

Read Illusionist Magic (Divination) Reversible eyes of the subject, a trusted and/or desired companion. Un-
less a saving throw versus magic is successful, the subject will
follow the illusionist wherever he or she goes, if possible with-
RDLeauvnregal:eti:1o0n: 2 rounds/level CCoamstipnogneTnimtse: :V,1 S, M out undue risk to life and safety. If the illusionist is able to
Area of Effect: Special segment creoqnuveesrtssefrowmiththtehespfeallsccainsateterdascrleonagtuares,athroell subject will obey
Saving Throw: None of 3d6 per request
does not exceed the charisma of the illusionist. (Requests
which are obviously against the better interests of the creature
Explanation/Description: This spell is the same as the 1st add +1 to the dice roll, and the more hazardous and unreasona-
level magic-user spell, read magic (q.v.), except that it applies ble of these requests will add from +2 to +6 to the dice roll.) The
only to spells usable by and used by illusionists, as well as to spell is shattered whenever charisma is exceeded, and the
various other inscriptions written in illusionist-type magic sonunoblrymjeaacltswshooilrlrttcpweerittrahioindalynoimbf etaimlfileilnetd(e1l-lwi4gitehdnacryaesg)e,wbialluntrdeifmhtahateien.ilflCausrsecioianntauitsertedshfaoosrf
script by illusionists. The material component(s) for the spell been careful to treat the subject well, attend to its needs, and
(and its reverse) are also the same as for read magic (and feed it, there is a 2% chance per point of charisma of the

unreadable magic).

Spook (Illusion/Phantasm) illusionist that the subject will willingly choose to befriend and
fnoolltocwarheidmfoorr) hoerrl.eaOvtehe(rifwitiswea, sthcearcerdeaftourr)ewwheillnatthtaecskp(eifll iwt ewaarss
Level: 1 Components: V, S off. Non-intelligent creatures are not subject to a fascinate spell
ADRrauenragaetio:ofn0E: Sffepecct:ia1l Casting Time: N1esge.gment (cf.
Saving Throw: charm person ).

creature within 1” of the illusionist Ultravision (Alteration)

Explanation/Description: A sstpooomcoeakousnspeeeltolhreesnsoaumbbleejetschtitnhcgereianiltliumusrieicoantlo.- ALRDerauevnreaagl:teoio2:fnET:of6fuectchutr:nCs r+e1atuturren/tloeuvcehledCSCaoavmsitnipngognTeThnirmtosw:e::VN,2Sosn,eeMgments
piset rtcoeipvleaythueposnpenllatcuarsatlefreaarss NbloeErxmfopralaltlnhyae,titorhenics/Dippeieosnwctreiptrotiwosniel:lenAloingthbutletirnauvtsihseieofnuslpsuepncedtlrleummrgarakoebusonvdiet wvphiooeslesreti.-
Wadivthaoncuet sacthtureaalltyenkinnogwlyinugpownhtahtethsiusbijse,ctt,heanidlluisfioansisutcmceesrsefulyl many of these light rays are screened out, but where ultraviolet
saving throw versus magic is not made, the creature will react lhigehlptfuisl ppolewnetrif.uUl,ltsrauvcihsioansaalltonwisghthteabvioevweergrtoousnede,aitsisif iat wveerrey
by rapidly turning and fleeing in as opposite a direction from twilight, i.e. clearly to 10” distance, then hazily to about 30”. (If
the illusionist as possible. Although the spell caster does not ultraviolet light is partially screened, such as by very heavy
actually pursue the fleeing creature, a phantasm from its own cloud cover, then ultravisual capability is reduced to half
tmheindspwoiollkdsopseoll.thHeowcreevaetru,reeaischenrotiutlnedd atoftearntohteheinr istiaavl icnagstthinrgowo,f range.) The material component of this spell is a powdered
and each such saving throw is at a cumulative +1 per round, essence of carrots.
until the subject successfully saves versus magic and the spell
is broken. In any event, the spell will function only against
creatures with an intelligence of not less than 1.

DRAGON 23

73

Whispering Wind (Alteration/Phantasm) and unnoticed as a zephyr until it reaches the desired objective
of the spell caster. It then delivers its whisper-quiet message or
LRDeauvnreaglte:io: 2nS:pSepceiacl ial CSCaoavmsitnipngognTeThnirmtoswe: ::V,2NSosneegments other sound for a duration of up to two segments. The dweomer
Area of Effect: 2’ radius then fades and vanishes — as it will do if the subject is beyond
range, more than two hours of time have elapsed, or it is magi-
Explanation/Description: By means of this spell the illusion- cally dispelled. The illusionist can prepare the spell to bear a
ist is able to either send a message or cause some desired message of up to 12 words, cause the spell to deliver other
sound effect. The whispering wind can be prepared so as to sounds for 12 seconds, or merely have the whispering wind
tarasvtehleasspmelal ncyastteenrshoafsfeleevteulsndoefrgerxopuenrdienocrem. iTlehsusa,boave3rdgroleuvnedl seem to be a faint stirring of the air which has a susurrant
illusionist could send the spell wafting 30’ in a dungeon or as far smoouvneda.sHseloowrlysahse1c”apnerlikroeuwnidseorcaasusqeuicthkley washi2s0p’e(roinrgawnyinrdatteo
as three miles outdoors. The whispering wind will be as gentle in between). When the spell reaches its objective, it swirls and
remains for the full two segments, regardless of its speed
otherwise.

Delude (Alteration) Phantom Wind (Alteration/Phantasm)

Level: 3 CCoamstipnogneTnimtse: :V,3Ssegments Level: 3 Components: V, S
Range: 0 Range: 1”/level Casting Time: 3 segments
Duration: 1 turn/level Saving Throw: Neg. ADrueraatoiofnE: f1fecrot:un1d” /bleroveald path Saving Throw: None

Area of Effect: The illusionist Explanation/Description: When this spell is employed, the
illusionist creates a wind which can not only not be seen, but
Explanation/Description: By amwueitrhaainnosfaohfi3sa”orrdaehdleuiurdseo,wsapnltehalolliguthngemh ietllhnuet- tnoeibthloerwclaignhitt obbejefecltt.sTbheisfomreovite,mfleunttteorfcauirrtadoiness,ohrodwreavpeer,s,seflravpe
fsoior nthisattisoaf balenytoosthuebrstcitruetaetuthree loose clothing (such as capes, cloaks, and mantles), fan fires,
creature must be of higher than animal intelligence for the aura and move clouds of gaseous materials (such as a wall of fog, a
exchange to work. Any attempt to know alignment will discover fog cloud, a cloudkill cloud, etc.). The wind created moves in
only the aura (alignment) for which the illusionist has opted to the direction in which the illusionist points, its effects being felt
tehxechsuabnsgteit.utAeddectreecattugroeo’sd aourrdae. tIefcdteeluvdilewisilludseetdecint tchoisnjuonnclytioonf in a progressively longer path as the spell continues, at a
with a change self or alter self spell, the actual class of the movement rate of 1”/round, with the effects lasting the entire
illusionist will be totally hidden, and he or she will absolutely cpolouyresde toof mthoevpeasthe.veTrhaulss,atihleedsvpeesllseclosu,ldb,utfothr eexfiarsmtpaleff,ecbteedemby-
appear to be whatever class he or she has opted to appear as, the wind would also be the one to move the furthest.
for a saving throw (versus magic) applies only to the aura
transfer.
Wraithform (Alteration)

Phantom Steed (Phantasm/Conjuration) Level: 3 Components: S, M
Range: 0 CSaavsitninggTThirmowe:: 1 segment
RLDeauvnreagl:teio:3nT:o6ucthurns/level Components: V, S, M Duration: 2 rounds/level None
Area of Effect: Special Casting Time: 1 turn Area of Effect: The illusionist
Saving Throw: None
Explanation/Description: When this spell is cast, the illusion-
ist becomes insubstantial and can be hit only by magic wea-
pons of +1 or better, or by creatures otherwise able to affect
istEcxrpelaatneastiaonq/Duaessic-rreipatilo, nh:oWrseh-elinkethcisreasptuerlel .isThcaisstcrtehaetuilrluescioann- those struck only by +1 or better magic weapons. Undead of all
be ridden only by the illusionist who created it, or by any person sorts will ignore an individual in iwllursaiiothnfoisrtmw,ilbl ebleieavbinleg him or
aapfnohnlorladnnswtootohaurmoimlnsmd,sat.leatTheandehndseimiilshrlumaaesvloysieokeenssb-ihsclaauotrclnoeckrrteemhhdaeei,tlkaemiydsn,-sscssuouaoblcnosohdtraenndablty.oiamdTml iohehoeusonynowstvdtiesrtoohspuengwcsorihtafoiiycfcniahgemlhlsymta,.nwabAekiullesllt her to be a wraith or spectre. The to pass
attack. If more than 12 points of damage accrue to such a wthitrhouagll hhesmorasllhheowleesarosrannadrrhoowldsoipnehnisinogrs,heervehannmdse, raesclorangckass,
mount, the dweomer is dispelled and the phantom steed disap- tfhoerms,peexllcpeeprtsivstesr.sNuso cforrematuofreasttawchkicishpeoxsissitbloenwthheen Einthwerraeitah-l
pears. A phantom steed moves at the rate of 4”/level of the spell Plane, where all attacks, both ways, are normal. Dispel illusion
caster. It has what seems to be a saddle and a bit and bridle, is the only way to force an illusionist in wraithform back to
but it can not carry saddlebags and the like — only its rider and normal form. The spell caster can return to normal form at will.
what he or she carries. These mounts gain certain powers The material components for this spell are a bit of gauze and a
according to the level of the illusionist who created them: wisp of smoke.

Dispel Magic (Abjuration)

sw8atmh pleyveglr:oAubndilitywittohopuatssdioffivceurltys.andy, muddy, or even Level: 4 SCCaoavmsitnipngognTeThnirmtoswe: ::V,4NSosneegments
10th level: Ability to pass over water as if it were firm, Range: 9”
Duration: Permanent
dry ground. Area of Effect: 3” cube
bines1nt2eetfahitdlo,efvseoal:cbAhribdaigslitemy.stNoaotntread,vethhloeiwnelitkvheeer,caatirhnaatsbtehifecitrmowsoesureendtficrwmainthlaonnuodtt
casually take off and fly. Explanation/Description: Except as noted above, this spell is
tthbhheeaelotoswtrhasemahcieeltluuawassielo,rtneih.iees7.tttahchai9rlsedthtvselellet.vhveeellscipllleeurlsliciaosnspisifethllc,eadsoistrspseahl edmiwasgpeiecrel(mqtw.avog.)i.lceNvaeosltseif
14th level: Ability to perform as if it were a pegasus.

24 OCTOBER 1982

74

Rainbow Pattern (Alteration/Phantasm) Advanced Illusion (Illusion/Phantasm)

Level: 4 Components: S, M ADLReruaevErneaaxgl:tpeoio5la:fnnE6:a”f1ft+eio1rcno”t/:u/lDen4vedes/sllqecuvriaeprlteio” n+:1TshqSCCiusaoaavsmsripetnipn”eg/ogllelnTviesTehnilrmetossew:s::Ve,5nStSpisa,eelcMglyimalaenstspectral
Range: 1” Casting Time: 4 segments forces spell which operates through a program (similar to a
ADrueraatioofnE: ffSepcetc:i3al” Saving Throw: Neg. purnongeracemsmsaerdyillfuosriothnespilleulsl)iodneistet rtmo incoendcbeynttrhaetecoanstethre. Itspisetllhufosr
x 3” square longer than 5 segments after casting it, as the program has then
area been started and will continue. The illusion has visual, full
audial, olfactory, and thermal components. If any viewer active-
istEcxrpelaatneastioanp/Daessteclr,ipgtlioown:inBgy, rmaienabnosw-ohfutehdisbsapnedll othfeinitlelurspiloany-- ly attempts to disbelieve the dweomer, he, she, or it gains a
ioHnnoglwypegavetetsertr,unrosen. ciTnehtehtheeefdfreiarceintcbitsoiownthpehaetsteaormrnseishaecsadasets,hirytephsne,otaiilclnudpsaitothtneerisnpt(aqnt.tevee.r)dn. saving throw versus magic. If any viewer successfully disbe-
of colors will move slowly off in that direction. It will persist lieves, and communicates this fact to other viewers able to
without further attention from the spell caster for 1-3 rounds, comprehend the communication, each such viewer gains a
and all creatures (up to 24 levels or hit doficleig)hst.ubTjheectratoinbthoew saving throw versus magic with a +4 bonus. The material com-
dweomer will follow the moving rainbow ponents are a bit of fleece and several grains of sand.
pattern will move away at a rate of 3” per round. The material
components for the spell are a crystal or prism and a piece of
phosphor.

Solid Fog (Alteration) Dream (Illusion/Phantasm/Alteration)

Level: 4 Components: V, S, M Level: 5 CCoamstipnogneTnimtse: : Special
DRaunragteio: n3:”2-8 rounds + 1 Casting Range: Special Saving Throw: 1 day
Saving Time: 4 segments ADrueEraxaptoiloafnnE:afStfeipocentc:/DiaSelpseccriaipl tion: dream spell is Neg.
round/level Throw: None A of limited
a form
Area of Effect: 2 cubic” per level wish, but it has far more limited scope. The illusionist must
actually find a comfortable place to rest, lie prone, compose his
Explanation/Description: When this spell is cast the illusion- or her thoughts so as to concentrate upon the desired result,
tiwHshatoelmlwcore,ef vaafoetnegrds,inwaannhmyiloaesrcetrthearaeeotssufperefeorcogtasllt,sitneiomgmn,ilplyabtriinalltgoovwettoihrnyegmswotvraavolelpnogotfrhwsfrooigcnuodsgnphcfeaotlnlrhme(mq.tsovoov.l)iea.d and then go to sleep. If he or she has an undisturbed sleep of
fog will progress at a rate of but 1’ per 1” of normal movement not less than 8 hours duration, the dream magic will be effectu-
rate per round. A gust of wind spell will not affect a solid fog. A ated in from 1 to 12 hours thereafter. Typical things which can
dispel magic will affect it normally. A fireball, flame strike, or a be brought about by a dream are:
cwoamll poofnfierentswiflol rbuthren istpaewll aayreinaapisnicnhgleofrodruiendd.aTnhdepmowadteerrieadl recovery of an individual’s lost hit points
peas combined with powdered animal hoof. restoration of a body member such as a hand or foot
success in locating some object not heavily guarded by
magic wards and protections
dloisccaotivoenryofofaasamfeeapnasthofthinroguregshsaorweilgdreersnsess
approximate strength of enemy/opponent forces
improvement of chances for gaining a rich treasure
Vacancy (Alteration/Phantasm) It must be noted that a dream is not an ultra-powerful spell,
aginvdenthaeborevseuldtsenoofteitss tchaestminagximmuusmt bceapsatbriiclittyly olifmtihteedc.aTshtiengguoifdea
RLeavnegl:e4: 1”/level Components: V, S, M dpreerammasnpeenltl.bRaseissu. lItfs, fwoirllenxeavmeprlee,xcaedeedadthecsoemppaanraiomne, tselrasinoinn aa
Duration: 1 turn/level SCaavsitningg TThirmowe:: 4 segments
Area of Effect: 1” radius/level None recent battle, were dreamed alive, he or she would remain living

illuEsxiopnliasnt actaiouns/eDseasncriaprteioant:oWahpepneaar vtaocbaencvyascpaenltl,isnecgalsetc,tethde, for but 1 turn per level of experience of the illusionist casting
the spell. Thereafter, the dweomer would disappear, the com-
panion would return to his or her previous state, and a more
unused. Those who behold the area will see dust on the floor, permanent form of magic would be needed to allow the lost
cobwebs, dirt, or any other condition which would be typical of individual to actually live fully again.
a long-abandoned place. If they pass through the area of spell A dream cannot be affected by an extension or permanency
effect, they will seemingly leave tracks, tear away cobwebs, and spell. The illusionist can use this spell but once per week. If it is
so on. Unless they actually contact some object cloaked by the csaesctontwdicteimweithainndththeesiallmuseiowneisetkw, itlhl eagsepeflrlowmill1a-1b0soyluetealrys.fail the
ccsMyhpeaesrpnlel,eclyltelhbtetoroupbsnlehaoicntdeegistwtshuoairlmblt esaedell,ieniasmvninsdeiobmotlenaplstoyybiftjooesrfccewteewfhmuailllstc.niotoTnathtcacetcautsuapwslleeiylllltcahisolelonavwtaavciaenanrnsyy-.
Magic Mirror (Enchantment-Divination)

powerful combination of advanced invisibility/illusion, but it Level: 5 Components: V, S, M
can cloak only non-living things. Living things will not be invis- Range: Touch Casting Time: 1 hour
ible, but their presence does not otherwise disturb the spell. If Duration: 1 round/level Saving Throw: None
fsourbcjeefcutltocotnhteacdtwweoithmear cwloillabkeedabolbejetoctpoecnceutrrast,eththoesespcerlel aotnulryesif Area of Effect: Special
fouErtxhplleavnealtimona/gDice-sucsreipr tsiopne:llTohfisthsepseallmiseenxaamctely. Itthuesseasmtheeassatmhee
they discover several items which they can not “see”; each is
then entitled to a saving throw versus magic. Failure indicates a material components, although if the illusionist casts a vision
belief that twheill orebmjeocvtse othnelydawreeominevris, ibsole.thAatdtihsepealciltluuaslioanreoar spell in place of the normal material components, the mirror will
scry properly, although the vision spell will not function nor-
dispel magic mally. (Editor’s note: A full description of this spell will be
can be viewed as it is in reality. The illusionist must have a
square of finest black silk to effect this spell. This material presented next issue, in the first of a two-part series on new
component must be of not less than 100 g.p. value. magic-user spells.)

DRAGON 25

75

Tempus Fugit (Illusion/Phantasm) Reversible

Level: 5 CCoamstipnogneTnimtse: :V,5Ssegments
Range: Personal Saving Throw: None
Duration: 5 turns/level
Area of Effect: 1” radius

Explanation/Description: This powerful illusion affects the Mislead (Illusion/Phantasm)
minds and bodies of all those within the area of the caster. The
spell causes those affected to perceive the passage of time in a Level: 6 Components: S
much faster manner. Thus, every turn (10 minutes) spent under Range: 1” Casting Time: 1 segment
the tempus fugit spell seems like a full hour to those within its Duration: 1 round/level Saving Throw: None
adrweesopmeeerd.eBdeucpauascecoorfditnhgisly,. aTllhefuyncmtiuosntseoatf, asflfeeecpte, daninddsivoidfuoartlhs Area of Effect: Special
according to an accelerated rate. One hour is as six to them,
froeunrewhaoluorsf sapefullsll,daanyd. rTehcoisvearcycoeflehriat tpiooinntosflotismt.eIfadleloswiresdr,etshte, illuEsxiopnlaisnt,athioen/oDresshceripaticotnu:aWllyhcerneaatemsisaleapdhasnpteallsmisacl adsot ubbylethaet
spell caster can reverse the spell so that time is slowed for the the same time he or she is cloaked eblyseiwmhperorevewdhiinlevishiibsiliotyr
individuals. Thus, an hour will seem as only a turn, a day merely magic. The illusionist is then free to go
four hours. Reversal requires no special preparation. In either her phantasm seemingly moves away. The spell allows the
case, the illusionist is also affected by the spell. Under the phantasm of the illusionist to speak and gesture as if it were
reverse, the effects will always last at least one turn after the real, and there are full olfactory and touch components as well.
gcaresatetrlydselsoirweesdi.ts dispelling, because his or her reactions are so A detect illusion, true seeing, or true sight spell, or a gem of
iseteyye,eitnsrugwewislillilgdrheett,veoecartlttrthuheeesiinlelvueisisniiogbnlsefpoielrlullws, ihooarntaisittgi(esc,mf.aonsfhdsaaedeodiwnegtedcootorirnr)ov.ibseibiol-f
Death Fog (Alteration-Evocation)
Phantasmagoria (Illusion/Phantasm)
Level: 6 Components: V, S, M
Range: 3” Casting Time: 6 segments Level: 6 Components: V, S
Duration: 1-4 rounds +1 Saving Throw: None Range: 6” Casting Time: 6 segments
ArearooufndE/flfeevcetl: 2 cubic”/level Duration: 1 round/level Saving Throw: Neg.
Area of Effect: 4 square” +1 square”/level

Explanation/Description: The casting of a death fog creates Explanation/Description: By means of this spell the illusion-
an area of solid fog (q.v.) which has the additional property of ist prepares a special form of spectral forces spell which is
being highly acidic. The vapors are deadly to living things, so twlryihgiigncehcrlueinddveobslvyeassfoufamlllleivnigss,upsealcli,diaianlugad,cioatirol,mno.olfvTaihncegtorrpayhp,ainadtnlayds.mTtaohgueocreihaffeitlylcuptsiccioaannl-
that vegetation exposed to them will die — grass and similar be aimed at making the subjects believe they are so doing or
small plants in 2 rounds, bushes and shrubs in 4, small trees in that something else is doing so. For example, the phantasma-
8, and large trees in 16 rounds. Animal life not immune to acid goria may be triggered when falling into a pit, reaching the
will suffer damage according to the length of time it is exposed center of an area, opening a door, or performing some like
to the vapors of a death fog: action. The subject(s) will then believe that the fall continues
for scores of feet; that a pit has opened and that they are
1st round: 1 point whealtpelreissslryusshliidnigngdodwown nfroinmtotahne uanrekanobwenyoanrdeath;ethjautsat-owpaenlleodf
32rnddrroouunndd::42ppooiinnttss door, or whatever. Note that unlike the programmed illusion
4th & succeeding rounds: 8 points spell, must always involve the illusion of
The characteristics of a death fog are otherwise the same as a phantasmagoria some-
solid fog. The material components are a pinch of dried and thing falling or rushing, or a dwindling prospective.
powdered peas, powdered animal hoof, and strong acid of any
sort (including highly distilled vinegar or acid crystals).

Mirage Arcane (Illusion/Phantasm - Alteration) reality. In its basic form, where casting time is but 3 segments,
fhoorcpeefuol fcodnistcaoctvearnindgtathcteilemdaisgcico,vesrhyoratreofnaecdeessteacrytiotno dheavvieceanoyr
LReavnegl:e6: 1”/level Components: V,S,M (optional) spell. In its more complex form, where a material component is
Duration: Special Casting Time: 3 or 6 segments used, and 6 segments of casting time are expended, detection
Area of Effect: 1”/level radius Saving Throw: None is possible only by some magical means, whether device, item,

to Ethxaptlaonfatthioenv/Daceasnccryipstipoenl:l,Tohnelydiwt iesommoerreopf othwisersfupleallnisd similar or spell. Either form of mirage arcane is subject to dispel illu-
elabo- tsbhiooednybo.erChdooilsndpveeerlrmsweaillglyi,cc.abuAeslsieefwacitpahpnranolopl trpiauotsweueaerlffluyfel caitlflsfuescuitopnothsne, the mind of
#ra6t1e).. TMhireagsepeallrceannaebliessatlhseo csaimsteilrartotomtahkeemainraagreeacaanptpriepar(istosubee thlaewsvieowf enra’s-
something other than it is. The illusionist is able to make it ture and magic. However, under the influence of this spell, the
appear as whatever he or she envisions. The spell will remain as viewer could possibly walk across a bed of hot coals thinking it
long as the caster maintains a faint concentration upon it, and was a shallow stream of water which was cooling his feet, dine
even after this is no longer held the spell will persist for a total of upon imaginary food and actually be nutritionally satisfied, or
6 turns plus 1 additional turn for each experience level of the freeastthceorbmefdo.rtaGbrlayvuitpy,onfoar ibnesdtaonfces,haisrpnsottoanfefes,cttehdinkbiyngthitetodwbeeoa-
caster. (Note: Faint concentration can be maintained during
normal conversation but not while spell casting, in melee, or if mer, so that an envisioned bridge spanning a deep chasm will
harmed by an attack.) In all cases the mirage arcane must be of enovtensut pwpiollrtsethee believer. Those who may be there to witness the
some place the illusionist has actually seen personally. If he or it as a sudden disappearance of the individual.
she actually has a small bit of anything connected with the They will in no way connect it with an illusion unless they are
place envisioned to create the spell, then it takes on a form of otherwise aware of some magic at work.

26 OCTOBER 1982

76

Shadow Walk (Illusion-Enchantment) WEAPON SPECIALIZATION
In the course of a recent visit from Len Lakofka, wherein we
Level: 7 CCoamstipnogneTnimtse: :V,1Ssegment
RDaunragteio: nT:o6ucthurns/level Saving Throw: None were principally discussing cleric and druid spells, the subject
Area of Effect: Special of Len’s unofficial “archer” sub-class came up. I concurred with
Len’s position that a bowman, shaft readied, target at “point
Explanation/Description: In order to effectuate a shadow blank” range, was formidable. I agreed that the game as it now
walk spell, the illusionist must be in an area of heavy shadows. stands does not reflect such threat. We then discussed how to
tTrahnespcaosrtteedr atondthaenyedcgreeaotufrtehsehPerimoreshMeatteoruiaclhePslanweillwthheenrebiet mesh the concept with the AD&D™ game system, and weapon
borders the plane of Shadow. In this region the illusionist can specialization arose as the answer. We discussed use of any
move at a relative rate of up to 7 leagues per turn, moving form of bow by a fighter or ranger. Certain conclusions were
normally on the borders of the Shadow Plane but aware of his taimrriev,eidt baetc.aHmoewoebvveior,uasfttoermreeftlehacttinwge odnidtnhoet mgoatftaerrefnoorusgohmine
or her position relative to the Prime Material Plane. Thus, rapid one case, and we went too far in another! Fighters have too long
travel can be accomplished by stepping from the Shadow Plane been the last-choice class, the group who posed the least
tthoethilelusPiorinmiset. MThaetesrihaaldPolwanwe,alwk itshpethllecadnesatlisnoatiboen ucsoendtrotolletrdavbeyl ftsbahparrerebcbaiaeatrly.iizaoTannhtidoissnuthbdea-ocpemlpaslisuensnsodetaoitnnahlepyeprw;tloyothrtelfodigshpeotafealraalsl,dhfiinegaxhsvc,teelurraad.binnTigglhiteieerarsslel,faoosnruredbt,-hcpweloaeswnaspeeeorwssn.
to other planes which border on the Shadow Plane, but this
requires a rather perilous transit of the Shadow Plane to arrive Fighters have the option to select one — and only one —
at a border with another plane of reality. Any creatures touched weapon to become associated with ever afterwards. This op-
by the illusionist when shadow walk is cast will also make the tion is known as weapon specialization. To become specially
transition to the borders of the Shadow Plane. They may opt to proficient with one weapon, the character must elect to do so
follow the illusionist, wander off into Shadowland, or stumble immumset dsitaatteelyt.haTthtahteisc,haasrathcteerfighhatserbiesebnesinpgecciraellaytetrda,intheed pinlatyheer
rbeascuklt oifntthoetyhearPerliomset oMr aatbearniadloPnleadneby(5th0e%illcuhsaionnciset)f.or either use of a single weapon. Furthermore, the weapon with which
the character is to be specially proficient must likewise be
Weird (Evocation — Illusion/Phantasm) decided upon at the onset of character creation.

Level: 7 CSCaoavmsitnipngognTeThnimrtose:w:V: ,7SSpseecgimalents Weapon specialization requires that the fighter give up the
Range: 3” fuigsheteorf cinlaitsiasl ipsronfoicrmieanlclyy ainlloowneedoirnittwiaol portohfeicriewnecaypionn4s.wTehae-
Duration: Special tphoenns.thIfisthreedpulcaeyesrt/hcheairnaictitaelrnoupmtsbetor oufsewewaepaoponns sinpewcihailiczhatitohne,
Area of Effect: 2” radius fighter can have proficiency, because he or she spent much
additional time specializing in a particular weapon.
Explanation/Description: When this spell is cast the illusion-
tishtemduwset obmeearbilnetotobceoinngve. rDseurwinigthththeecsausbtjiencgt, othresuilblujesciotsnitsot mbriunsgt Bows other than crossbows require triple weapon proficien-
call out to the subject or subjects, informing one or all that their cy, so that the character can have such a bow as a weapon
final fate, indeed their doom, now is upon them. The force of the specialization and but one other weapon of proficiency.
magic is such that even if the subject or subjects make their
saving throw, fear will paralyze them for a full 7 segments, and All other weapons require double weapon proficiency, so
they will lose from 1-4 strength points from this fear, although that the specialized weapon and two proficient weapons can be
the lost strength will return in 7 rounds. Failure to save versus possessed by the fighter.
magic will cause the subject or subjects to face their nemesis,
the opponent(s) most feared and inimical to them. Actual com- In either case, remember that the character must choose
bat must then take place, for no magical means of escape will which weapon he or she will specialize in prior to commencing
be possible. The foe fought is real for all intents and Ipfutrhpeoswees.irdIf athcetivceamplpaay.igWn eaavpaoilnasbilaitryeasseldeicctteadteadccboyrdthinegDtoMt.he tables, and
the subject or subjects lose, then death occurs.
caused by the dweomer is slain, then the subject or subjects Effects of weapon specialization
ceommerbgaet,waitnhdnonodalomsasgeo,f nsopelollsssliokfewiteismes sseeeemmiinnggllyy uesxepdenindethde. BWoewasp:onArscpheecrisaliwzaitthiocnogmapinossitthe,elfoonllgo,woirngshaodrvt abnotwasgeasr:e en-
Although each round of combat seems normal, it takes but 1
segment of real time. During the course of the spell, the illusion- titled to a “point blank” range category. This range is from 6’ to
ist must concentrate fully upon maintaining it. 30’. At this range, any arrow loosed will gain a +2 “to hit”
probability and inflict double damage, including the +2 factor.
General notes on spells These bonuses are in addition to any others for dexterity,
strength, or magic. Furthermore, if the bowman has his arrow
theTotypuetilizoef dtiheesuesesdpetollsd—etearnmdinteheryanadroemofsfipceiallls.—Tshiims pclaynaadpjupslyt nocked, shaft drawn, and target sighted, he or she is entitled to
to initially known spells, those otherwise available, or those loose that arrow prior to any initiative check. It is thus possible
found in scrolls or books. for such an archer to get off two or even three arrows prior to
As a final note, I would have liked to have been able to add still receiving any return attack.
more illusionist spells, but to devise a dozen for each of the first
fthorretehele7vethlsi,sajnuostthteoroddoezemnafnodr ienagcohnoftimthee anenxdt ethnreereg,ya!nTdhfeoruer At short range the specialist is allowed a +1 bonus both “to
might be more included in the book, or there might be only what hit” and on damage. This bonus is likewise in addition to any
you have read here. It all depends on what transpires over the othTehres fwirehircahtemofigthhteaspppelyc.ialist in archery increases with expe-
tnheisxt ofeffwermingon. t(hEsd. itMore’sannwohteil:e,SIeedothheopfoelloywouingwipllahgaeveforfuan with rience, just as the number of attacks per melee round increases.
Thus, at 7th level the specialist gains not only additional melee
last- attack power but also an additional arrow. The rate of fire for a
minute addition concerning starting spells for illusionists.) srapteeciisaliisntcorefa1sset-d6ttho l3e,vaenl dis a2t p1e3rthroluenvedl; afrnodmh7igthh-e1r2athslpeevceilatlhiset
can get off as many as 4 shots per round.

Crossbows: All forms of crossbows have a “point blank”
range of from 6’ to 60’. Otherwise, they receive the same bo-
nuses as other bows, including double damage at point blank
range. The same is true of bonuses at short range, being +1 “to
hit” and on damage. Also, at medium range crossbows gain a +1

DRAGON 27

77

s“gtproeeachtiiata”lissbtto.hnNautasotu,frboautlhlyte,nrtohseodratfsirmeoarfagbteeowobfso,anbucusrto,tswhsehboeswpneeicsmianlpiosltot nyiseeaadbrlblyeyatoas weAohasfipgfuohirsneeusra,wlwof,outirthlhdeinrbweseteaisa4np,cnoteohn.e)rnseps5et,rcictihatieloinzna6trieopgnea.rrSdroitnruigncdtthcaeat tu1es3gethoorliefzvmaetaliogonircaisl
increase it by half steps: From 1st-6th level the rate of fire is 1/2 most necessary, however; the specialist must be a long-
per round for a heavy crossbow, 1 per round for a light cross- swordsman, not just a swordsman.
bow; from 7th-12th level, the rates are 1 per round (heavy) and DUELING IN THE DARK
1½ per round (light); and at 13th level and higher they increase
to 1½ (heavy) and 2 (light). This has nothing to do with weapon specialization, but it is
eaflsfeoctasnoifmdpaorrktnaenstspooinntc.oNmobwahtenroeteind.thHeergeamaree sthyestefamctsa:re the
All other weapons: Specialization in any other weapon, in-
cluding such missile weapons as slings, gain the specialist the the—stIaf nthdearodpppoenneanltyt cfaonr ninovtisbiebleseoepnp, othneenntsa,tta-4c.ks are at
following bonuses and advantages: — If the opponent is vaguely discernible, let us assume

— Use of the weapon is at +1 “to hit” bonus and at +2 as a faint blur or a darker shape against the background,
damage bonus. then attacks are at a penalty of -2.
fou—ghFtaeinriepofiroerisligehffteccotinveditoionnlys,wchoenndoituiotlninsintgypoicpaplonoef natns
— Number of attacks per melee round is one-half attack underground setting with illumination only from torches,
greater than shown on the table, so that at 1st-6th level, lanterns, and magic weapons. In daylight, or in an area
tthhreeefigahtttaecrkussienvgerhyistwoor hroeurnsdpsec(3ia/2li)z;aatito7nthw-e12atphonlevgeeltsit lighted by a spell such as light, the outlining effect of the
goes to two attacks per round (2/1), and at 13th level and spell is lost, and bonuses “to hit” do not apply.
higher it goes to five attacks every two rounds (5/2). In the
case of weapons which already have a greater rate of fire
than this, simply add 1 to that rate for each category,
initially and successively. (In dart specialization, the rate

CRITICISM AND COMMENTARY pbeeacrauinsethethepyagaerse otpofatbrhtuisoilfdmaaangcaaazcmintuepa.alTigchanem.yIpfa,areaigsna,abniDtoMtmmo, ryeeoreudleywtaraialenwdt
From time to time I have used this column to pass along data upon which
iitnefmorsmaarteionusaunadllyvaadridoeuds hfoerrme s(beocf acuosmemI eanmtaaryh.ea“Ldabsty mseinvuetrea”l
months sometimes). I hope to be able to maintain such a forum someone else to do all of your creative thinking for you, by all
means shun the DEITIES & DEMIGODS book. Creative folk
as a regular feature of the column. walarhtTeeoh.dehTirahegvecoetioenapdgesdtr-oeaostnitiohrenaarttionouusLeneamdfkupeTlloSwGyRoesrnkhoe.amvvaeeiismbesapegrnienaasdotimoonuettihnoinvtheger itsroogmsaemeeisnoixgf
Evidently some months ago some gamer wrote a critical
piece for a competing publication. The individual apparently
had a number of unpleasant things to say about the DEITIES &
DreEaMdinIGgOaDlSe™tterCoyfclaogpreedeima.eIntpiocvkeerd tuhpe onnamtheeotfaial ednisdgorufnittlebdy locations. We hope to have the main building, a place of about
100,000 square feet of space, in full operation soon. Then the
ex-TSR game designer. I preface my further remarks by this majority of our personnel will be under one roof. We are being
following fact: This same individual was responsible for the svoeoryn cbayrethfeulfwreiqthuepnltananndingregaunladrcroenletarosel, sofonyeowu gaallmweisll, bpelanyeinfgit
dungeon random encounter tables in the FIEND FOLIO™ Tome aaicdqsu, iarendd sAoMfAorZthIN. AGls™o dMuarignagztihnies,reacecrnatfttimcoempperaiondy,, waendhathvee
wdehtiacihl sinocmluedeosf tthhee coathtoebr leeprraosrsaswhaicLhevseolmXehmoownsstleiprp.eIdnetherdoungoht assets of SPI. Those of you who enjoy military simulations and
under this same individual’s expert editing. the like can expect to see four re-issued or new SPI games
This capable and knowledgeable individual suggests that
dcaatmapoanigtnhe. Tdheaititerseilsigiinosnu,ffbiceieinngt fsoor umsuecfuhlnaespsairnt aonf oAuDr&rDea™l every month starting this fall. Look for both S&T™ and ARES™
hMaavgeazainlseos bbeaeckn iantpwriontrkfrosmettDinrgaguopnaPnubElinstheinrtgaisnomoenn, ttoMo!eWdiea
history, must likewise play a part in your campaign, J. R. R. Division to handle the movie now being written, and other like
Tolkien did not agree, for he wrote many pages without men- projects now in various stages of planning and discussion.
tion of religion. Most of the heroic fantasy and swords &sorcery
pboaortkosfwthriettiernpdrootangoot nfeisattsu.reCaonnysipdaerrticCuolanrarne,liFgiaofuhsrdzeaanldonGrtheey
Mouser, Harold Shea, and the list goes on and on. I do not agree ACIlQluUsIiSonITisIOtsNbOegFinMwAiGthICa-UliSmEitRedSbPoEoLkLSof, sILpLeUllsS,IOjuNsItSaTsSdo
that it needs be a significant part of the campaign. As AD&D™ rgeroguuplasr;moangeicf-ruosmeresa. cThhegrsopuepllswailvl abileabklneoawren dbiyvidtheed binetgointhnrieneg
games depend on participant input for their character, the
detailing of deities and those who serve them is strictly a part of illusionist. The illusionist always has read illusionist magic. The
tshoeunrdolesinpislateyrin?gDaosepseacnt of the game. Must all evil characters spellOgfrfoeunpsiinvges are: Defensive
elf have to be flighty? Need a ranger be Miscellaneous
lugubrious? Actually, the game system tells you what is neces- 1. Color spray Audible glamer Change self
sary for a campaign, but how the campaign is role-played is 2. Hypnotism Darkness Dancing lights
strictly up to the DM and players. 3. Light Gaze reflection Detect illusion
The learned critics’ viewpoints notwithstanding, the DEITIES 4. Phantasmal force Wall of fog Detect invisibility
w&hDicEhMthIeGDOMDScabnoboukildisaapnaentxhceeolnlen—t fdarcatwcnofmropmenthdeiummatferorimal 5. Chromatic orb three(Pcohhpaotniootsnoesm) whaircmhocran(c(bhcehoouoossseeed))*here:
presented or merely based on the ideas presented therein.
Development of ideologies, rites, dogma, and so forth is purely 6*. —S pTohoekDM has
1) allow an additional (5th) miscellaneous spell, or
a matter for the DM — with active participation of players, 2) allow reselection of an offensive spell, this time by
nnoartuwraillllyw. eIt. Hisonwotahignagmwehiischrowlee-pdlaeyseirde istoafomrcaetteurpoofncphloaiyceer.s, the3)pslaimyeprly’sacshsouimcee rtahtahtetrhetharonllbmyeaandsienorothlli,nogrmore than
I instructed the authors of the work on the detail that should choice of a miscellaneous spell, just as a 5 does.
be presented to DMs in the Cyclopedia. I occasionally make Spells from this work were added to the list of initial spells
use of it, principally when the players are in another (alternate) because of the limited number of illusionist spells originally
world. As it is, I can then flesh it out by adding my own concep- given in the Players Handbook. You will note that this has not
vtiaorniosu. sIt fditesitimesy cuasmedpainigtnheanGdrethyehatwemk pceamr opfamigny pwliallyseorso.nTahpe- ablereeanddyohnaesfsourfmficaiegnict -nuusmerbserosf tohfespoerilglsintaol sseolretc,tafsrotmha. t class

28 OCTOBER 1982

78

aEnGdGtaaknesswaerlsonlegttleoroskoant nceowmeclliansessess

Lest I be forced to an existence of do- finalizing the Barbarian sub-class of A BEAUTIFUL IDEA
ing nothing save answering your flood of Fighters, just as actual play-testing here Frank Mentzer and Francois Marcela-
missives, please be forgiving if I am un- is. Cavaliers were usually rated in the
able to answer each of you personally upper middle range, and that average Froideval are already hard at work, and I
—so.tAhot utigmhesI sahllawll,ritinedrseefede,laatsteimf tphtetyoadreo was carried through for Mountebanks as am being flooded with suggestions and
addressing a void, for seldom does an well. Mystic rated the lowest, since no cidoeiassufsroems tahe“sBeeaGuotoyd” Gatetnritbleumteenf.orFrhanis-
article bring any response. An occasion- individual’s rating had it as number one. characters, and I have come to the con-
asul llteinttger) onfatpurraeiseisoorftoefncarititcraela(seuvreen, fionr- However, from the general comments, I clusion that you might also like to use
such tokens indicate that someone is ac- fineaadr ethqautamteudcehsocfripthtiaotnisofdutheetoclamsys.own such a rating. Here are my thoughts:
etuffaolrlty. Arelloawdinmgewnhowattoisawdrdittaenneawt igdreenatit-
ty to readers of this column: Hyperactive Several Good Readers suggested that Comeliness is my word for the attri-
Enthusiasts! I am inundated with res- lIissheeedk eidlseeaws hfreorme. cIhraergacretetrthcalatssIecsanpnubo-t bute. Beauty is too specific, as it calls to
ponses, and I am pleased, for I do indeed do so, of course, copyright laws being “mCionmdelainepsoss” ithivaes astamteoreofngeuotoradl clooonknso.-
need the benefits of your thinking! what they are. In fact, I make it a point to tation; i.e., a character with a 3 attribute
nsiontcereIaddo other systems and articles, sbcuotrea 3foirnBCeoamutyeliwneoussldimbepliaesnoung-lbineeasusty.,
When I attended the World Science not wish to plagiarize. Howev- maC,ohmoweleinveers,sciasnnoatffecchtarciosmmeali.nCeshsa. rAisf--
Fiction Convention in early September, I er, details of the classes which have ter the six attributes of a character are
began to get an inkling of the interest developed since I wrote about them, or determined, his or her looks must be de-
players have respecting the expansion were not gone into in the brief treat- tpelarmin,inoerd.pIrsetttyh?e Tchhiasracchtaerracutgelryis,tihcoims edlye,-
ovifetwhequAeDs&tiDon™s,gtahme eausdyisetenmce. wAfatesr(iansteirs- ments, will please many who viewed one termined by the comeliness roll. 3d6 are
usual) given a chance to ask what they orWanhaotthwerillpnroopt obseedcocvlaesresdaisn ttohoe leimxpitaend-. rolled and totalled. The resulting number,
would of me. Many questions pertaining sion are the anti-paladin (perish the between 3 and 18 inclusive, is modified:
to new character classes were posed thought!) and the samurai. An assassin
tIhreent,urannedd atfotetrhwearodffiicnecaasftuear lLcahbaotsr .DWayh,ena is about as close to an anti-paladin as is Characters with a charisma of less
stack of letters on the subject awaited sneenetdeed.dI. bEyvinloismsetraonnsgcahnamd pwioenll irte. pArseI- than 3 will have an adjustment of -8 on
my attention. The correspondence con- have said before, an anti-paladin is a comeliness, so that it will fall in the
tinues to come in, and I am doing my third leg, and I have never yet seen any range of -5 to +10. For charisma of 3,
wbeilsl tstuomkeueppsuepv.eFroarl itmhepobretnaenftitthoifnaglls, II reasoned proposal which justifies the ft-aoh3nre;df1oa3frod-r1j6u5c-s,8htm,+ar1e-i1s;n;mtfofaoirsr1o-96f5--;m112c7oh,,rae+nr2oits;hmafaodnarju11sot88fm,,4e++-n355t;.;,
have gained from perusing the mail: inclusion of such a sub-class. I believe Racial note: Charisma adjustment to
that attempts to include the character comeliness applies only to the race of
Learned Players, I assure you that I am type come from players who wish to the character; i.e., dwarves to dwarves,
not overly sensitive to critical opinions. have an “unbeatable” character for them- elves to elves, etc. Comeliness adjust-
Not only do I speak freely when I think it selves. Furthermore, there is little men- ment by racial type applies to other races
is necessary, I consider intelligent com- tion of such a type in mythology or fan- only and is:
ments of all sorts, whether they agree tasy literature, so we do not have a solid
with my own opinions or not. Several role-model. Half-orcs . . . . . . . . . . . . . . . . . . . . -3
letter writers apologized for not liking Samurai are a different story entirely. Dwarves, gnomes . . . . . . . . . . . . -1
one class or another, and were hesitant Granted the Monk is not part of Medieval Halflings, humans* . . . . . . . . . . . 0
to express their thoughts for fear I might tradition or the usual European-based Half-elves*, sylvan elves* . . . . +1
be offended. Far from it, I find such fantasy. It belongs in an Oriental-based Gray*el—vesT*r,ehatigahseslvaemse*.r.a.ce. .. . +2
comments very useful in development of Wgahmyec.oWmhpyoutnhdenernroort! iIncinlutednedstaommuroavie? The possible range of comeliness now
material. After all, while it is impossible the Monk to the appendices where Bards reaches from a low of -8 (a 2 charisma
tocogoornreeupianlldhetaatlbhesseeaehndedeestevfoiictetairdsityneiiosodnicnm-atemopr,darwcoiknrrviingititniegcagabnplaeroopicdpacpeeuirnassoi.seoaIncfowhafihsennicsyooh,-tf now reside. It is hoped that sometime half-orc) to +25 (a 19 charisma gray elf).
wanting to “offend” me with a contrary soon we can begin on another version of Considering that many other creatures
opinion, I trust the foregoing will reas- tohneSAinDo&-DJapgaanmeesesycsuteltumrew. hWichhileissbuacsheda will eventually be given a comeliness rat-
sure that the forum is an open one where work will be aimed principally for sale in sinpgre—adfowrilbl ebteterbroorawdeornseed—totrhaengpoesfsriobmle
blame as well as praise can be aired. the Far East, you may rest assured that -20 to +30. This reflects well from a myth-
an English-language version will be avail- ological base and provides a solid work-
The range of comments was astound- caoblme ptoletaell ainntedremsteeadnpinlagyfeurls,casompthaaitgna ing spread.
ing. There is absolutely no consensus of based on Oriental tradition and myth can Comeliness will have the following ef-
obplein. iFoonraesvteorywlheitctehrcwlahsischislimstoesdt Sdeasviaran-t be run. That means Ninja, Samurai, Ro- fects on creatures of human sort. (This
on the top and Jester on the bottom, I cnlienr,icYs.akNuastaur,aMllyo,ntkhse,yawndill pboessiniblay sTeatotinisgt climateitegdorytoi,nchluudmeasn,sb,udt eismni-ohtunmeacensss, ahriuly-
seemed to find another which reversed which is relative to their powers and in- tmura-e1ns6ooidofsrh,luogmwiaaennrt-:-lcikTlaehsofsso,ermavniedawnbdinipgmeoadtaivclahctairoreanac.)--
the ratings. I have gone ahead with the terrelationships, with appropriate mon- ter with comeliness this low are repulsed
TdI ehssiineccrf-iepArteicolrynobwhaoiltlpaesppaplleiltaor(fEinydoiitsuosrwu’seill#nf6oa9tve)o:,raTmnhdee sters and deities, arms and armor. The and horrified, so as to turn away or at-
with your immediate impressions and ppaorsastieblecumltuereetsingwilblebtweedeinffictuhletsteo thwaondslee-, tseivmepttottohedessigtrhot.yIfththeecinredaivtuidrueasl owiothffelonw-
considered opinions garnered from ac- and so some special rules will probably comeliness is powerful, the reaction will
tual play. Input from you is helping me in be required. That remains to be seen, so tend toward escape, or reinforcement of
let’s leave it at that for now.
E. Gary Gygax 6 7D R A G O N

79

previously determined awe (horror) re- will see him or her with comeliness ad- cahllyarbaechtearv,efofloloowlishhilmy oorrinhesro, manedmgaennneer-r
action. With creatures of like and Evil jnues++st11se;40dntbtoooy e+++f12f1e73cf::otIrnPoctnleahriaetnhsreittsomivniaaevvw.i)eeewrra.ingge
alignment, the effect is that of a positive comeli- so as to attract the attention of the char-
dcoe-mn1ce5ylinttoeos-lso9o:okDf aitshwgeuasyst,,armeevveiidleetontthcaeel.dinbdyivaiduteanl,- the indi- acter. The reaction adjustment is double
and act hostile in general. Under no cir- the score of comeliness; i.e., 22 equals
cceupmtesdtabnycethsewvililetwheisrscuhnalreascstearllbaereaco-f vaisduhael oisr esvhiedeisncgeododb-ylotohkoinseg.inThceonretaacct-, +44%. Charm- like power will affect all
those with wisdom of less than two-
tion adjustment is increased by a per- thirds the comeliness score of the char-
centage equal to the comeliness score of acter. If an individual of the opposite sex
Evil alignment, so that the negative the character. Individuals of the oppo- is actually consciously sought by a char-
caow-ma8eytliofnreo0sm:s can be regarded as positive. site sex will seek out such characters, acter with comeliness of 22-25, that indi-
Asoveurgsliyona carnedataurdeewsiilrlebetoebvei- avchindadurmatlhssepeyexlwcl eiulelndbleses5sa0fwf%eiscdoteofdmthaeosfcishfuaucrnahdceitnerdr’ais- vidual will wbiesdeofmfecistiv1e8lyocrhhairgmheedr. unless
denced by all viewers. If given an excuse, his or her Rejec-
tio+n2i6s atos a+b3o0v:e.Unearthly beauty of this
those near the individual will be hostile com+1e8lintoes+s21t:oTtahle. beauty of the character sfroormt caonthbeer ppolasnseessse—d odnelymbi-ygocrdesataurneds
and openly aggressive; otherwise they will cause heads to turn and hearts to
wil+l1mteore+ly6:teAnsdstuocwhaardn irnedjeivcidtiuoanl.is sim- race. Reaction for initial contact is at a demi-goddesses and deities of unusual
ply ugly, the reaction evidenced will tend fttspheeceecro’ritsrreceedwc.noisIamtndsdeoeimqilvfinuidueeaunsxlacdstleoestero1odtaasf5l0a.5c%nh0Inya%dromsivfoeifdscxpouthweamelilllselculbhoinneafleretaahsscfess-- oecseoqorffumerhtac.ielgtilhvitRnoeeeer7sao5swcn%tisisaodcolnloofsrmceaao.vdmaeCjluewhtslhiaantroymemssse-esan,liwltklsoeiatwihvspeswodtswihosaaeudvtrobin1mliges9
tforowmarsduuchnebarsuetisahnndesas daessiqreuictoklygeatsawpoasy-
saicbteler.’sIfcghiavreisnmtahecaonppooffrstuent ituyg,litnheessc,hbaur-t
this requires a fair amount of conversa- same sex will do likewise unless wisdom versus the power. An individual of the
tio+n7atnod+in9t:eTrahcetiohnomtoeltiankeessploafceth.e indi- tcohtaarlasctaetr’sleacosmt tewlinoe-tshsirdscsoroef. tRheejeoctthioenr obpypothseitepsoesxsewshsooirs ocfonssucciohusulynesaorutghhlyt
vidual will be such that initial contact will orefjehcatresdhtnoahtuarveecaanrecaactuiosne athseifinthdeivicdhuaarl- buenaduetrythaendscpoemll eolfintehsesinwdililvaidlwuaalyswbithe
be of a negative sort. This negative feel-
ing will not be strongly evidenced. High acter had a negative comeliness of half such beauty unless he or she has wis-
charisma will quickly overcome it if any the+2a2cttuoal+(2p5o:siTtihvee)sstucnonrein.g beauty and dom of 20 or more.
conversation and interpersonal interac- N.B.: Charm from attraction due to
tion transpires. (Consider a dwarf with gorgeous looks of a character with so comeliness does not affect the abilities
16 charisma and a base comeliness roll ohfigthhoasecoomf leelsinseesrsbewailul tbye(1s7im-2il1a)r, tboutthina-t of the individual with respect to fighting,
of 9; he or she will be at 8 when viewed by fsepcetllacliagsntminegn, te. tc. It could, however, af-
all creatures save other dwarves — who dividuals will actually flock around the

62 NOVEMBER 1982

80

by Gary Gygax stheegmspeentll atondfutnhcetniocne,ainsev.isWiblheilecruenadtueraeds,caresatwureellsawsiltlhnoostecfaruosme
other planes who are otherwise alive, will do so. Ethereal or
©1982 E. Gary Gygax. All rights reserved. afriinsatelracsolillymvepprroownjeiercent.tesdocfrtehaistusrpeesllwailrlenaottitnriyggbeerll aanndalaarmpi.eTcheeomf vaetery-

faiAr snuwmitbherilluosf inoenwistssp(eslelsewlahsicthiswsuilleb),emdaeglinice-autseedrsinatlhseo hupacvoema- Armor (Conjuration)
ing ADVANCED DUNGEONS & DRAGONS® Expansion vol-
tuomael.loTwherraenadroemcudrirsecnotlvyer6y2/doeftethrmesineatnioenw. mThaegsicekss,pdeivllisdeadresogaivs- Level: 1 CCoamstipnogneTnimtse: :V1, S, M
wenillhaeprepaefaterr,wahnedntthheey baoreoksuisbsptaunbtliiaslhlyedin. the same form as they Range: Touch round
Duration: Special Saving Throw: None
MAGIC-USERS Area of Effect: 1 creature

Number A1slat rLmevel usEexr pclraenaatteiosna/Dmesacgriicpatilofnie: lBd yofmfoeracneswohficthhissesrpveelsl, the magic-
333123 AFirremwaoterr as if it were
leather armor (AC 8). If the spell is cast upon a person already
armored, it has no effect. However, if it is cast upon a creature
3354 GMreelat se with an armor class normally higher than 9 (due to its size,
speed, skin, etc.) it will benefit the normal armor class by +1, i.e.
36 Mount AC 8 becomes 7,7 becomes 6, and so on. The magic armor spell
3378 PRruencipitation does not slow or hinder movement, adds no weight or encum-
obrraunncteil, tnhoer wdoeaerserit spurestvaeinnst scpuemlluclaatsivteingd.aImt laagsetstoutnatliilndgisgpreelaletedr
39 WTaizuanrtd Mark than 8 points +1 point per level of the caster. Thus, the wearer
40 might take 8 points from an attack, then several turns later

2N5umber 2BninddLevel 3CrldouLdebvuerlst 4DthispLeelvIelllusion sustain an additional 1 point of damage. Unless the spell were
ETveanrdta’scleBslack cast by a magic-user of 2nd level or higher, it would be dis-
26 Deeppockets Detect Illusion Lceuorme unSdh’selteSre- pelled. Until it is dispelled, the armor spell allows the wearer full
Magic Mirror benefits of the armor class gained due to the dweomer.
27 Flaming Sphere Item OietinlutkeS’pshRereesil- Note: This spell will not function in conjunction with protec-
Shout tive magic devices other than a ring of protection. The material
28 Irritation Material Stoneskin component is a piece of finely cured leather which has been
29 MAerlrf’oswAcid MMeelft’seoMr inute Ultravision blessed by a cleric.

3310 TParesshear’vse Uncon- SSeepciaretSPnaagkee Firewater (Alteration)

trollable Sigil Level: 1 CCSaoavmsitnipngognTeThnirmtoswe: ::V1,NSosn,eeMgment
HLaiduegohutesr ADRrauenraagteioo: fn1E:” f1fercotu: n1d pint
32 Whip Wind Wall of water/level

(Editor’s note: The listings and descriptions for new magic- Explanation/Description: By means of this spell, the magic-
user spells of levels 5-9 will be published next month, in issue user changes a volume of water to a volatile, inflammable sub-
#68 of DRAGON™ Magazine.) stance similar to alcohol. If this substance is exposed to flame,
ffiirree,.oCrreevaetnuraesspsaurbk,jeitctwtilol bfiurerswt aintteorfflalammese awnidll sbuurfnfewr i2th-1a2hhoitt
SPELL EXPLANATIONS points damage. Firewater will evaporate and be useless within 1
round, even if it is securely contained and sealed, so it must be
Alarm (Evocation) utilized within 10 segments of its creation. The material com-
ponents of this spell are a few grains of sugar and a raisin.
ARLDearuvenreaagl:teioo1: fn1E:” f2fe-8ctt:uUrnps CCoamstipnognTenimtse::V1, rSo,uMnd
+1 t./level Saving Throw: None Grease (Evocation)

to 20 sq. ft./level LReavnegl:e:1 1” CCoamstipnogneTnimtse: :V1, S, M
segment
Explanation/Description: When an alarm spell is cast, the ADrueraatoiofnE: fPfeecrtm: a1nesqn.t ft./level Saving Throw: Special
magic-user causes a selected area to react to the presence of
any living creature larger than a normal rat, i.e. anything larger Explanation/Description: A grease spell creates an area cov-
than about one-half cubic foot in volume and/or over about 3 ered by a slippery substance of a fatty, greasy nature. Any
tefphlovoeoounrka,edrsestaaai,nilrotsowu,uedecightcrhei.nts.AgTiistnh,gseoorwaorohnetiahcaehsorwfwaeinsifleylfebclcievtoicnncatgalneccatbrsreelyaita,thutperheoaerrtsdaaell,atwsramitfhosiesonpctetauiollpn6wo0onil’fl creature stepping upon it will have to save versus petrification
radius. (Reduce the radius by 10’ for interposing doors, by 20’ oitrcsalinp,psoksisdi,balynbdefaallv.oOidfecdo.uTrshee, sifpaellcrceaantuarlesoisbaewuasreedotfothceauasreeaa,
for substantial interposing walls.) The sound will last for 1 greasy coating on some surface other than that underfoot—a

4 NOVEMBER 1982

81

course, a caster of sufficiently high level to qualify for a camel
d(feosriri1nessstt.a—Ancv3ear)ildacblaelnevecmlh:oomuonustsleeaaorer“lloitghwheetsrehl:oervseel” mount if he or she so

4th — 7th level: draft horse or warhorse
8th — 12th level: camel
13th level & up: elephant (and houda at 18th level)
The mount will not come with any riding gear, unless it is of a
cai.lena.dsashl4aotrwhneelersvtshealonmr atahgeliigcc-huatssheteorrrcswaeonuwgldiathinnsoaarmdwdaallleryhabonersdeenhwtaiittrlhenodeusttoss.agdTadhinlee,
statistics of the animal gained are typical of all creatures of the
soarmdeuncglafsrso.mThtheemtyapteerioalf caonmimpaolnteontbeofctohnejusrpeedll. is a bit of hair

Precipitation (Alteration)

Level: 1 Components: V, S, M
Range: 1”/level Casting Time: 1 segment
Duration: 1 segment/level Saving Throw: None
(& special)
Area of Effect: 3” diam. cylinder up to 72” high

rope, ladder rungs, weapon handle, etc. Lone material objects Explanation/Description: When this spell is cast, all water
will always be subject to such a spell use, but if the magic is cast vapor in the atmosphere in the area of effect is precipitated in
seuafpfveoicnntgivaetnh.roTobwhjeevcmet rabsteueisrniagml awcgoieimcldpmeodunseotnrftaeoimlffpothlroetyhseepdegblrleyiassaeacsbrpeiteaoltluftropeo,breka the form of a light rain. (Note that low-level spell casters will
rind, butter, or other greasy material. certainly be within the area of effect of the spell.) The rain will
continue only for as many segments of time as the spell caster
Melt (Alteration) has levels of experience. As only some 1/100th of an inch of
precipitation falls during the course of a segment, the spell will
LReavnegl:e1: 3” CCoamstipnogneTnimtse: :V1, S, M have only the following general effects:
Duration: 1 round/level segment
Saving Throw: Special Thtihno,rloiguhgthmlyawteeritatlhweirlel abfetecro.me damp in 1 segment and
Area of Effect: 1 cubic yard/level — double if snow Twigs and heavy material such as canvas will be damp in

maEgxipcl-aunsaetrioenf/fDeecsticvreiplytiorna:iseWshtehne taemmpeelrtatsupreellinisthecaasrte, athoef 2 segments and wet thereafter.
effect. This sudden increase in warmth will melt ice in 1 round, Flat, relatively non-porous surfaces, such as stone floors,
osboenctahoamsteiadse1w,satintlee1vr.erlTomhueangdmicea-lutfstseeprrectlhlaenis melt a cube of solid ice, 1 yard
spell is cast, so that the ice rock, painted wood, etc., will be damp in 1 segment
not generally effective against and filmed with water thereafter.
creatures which are not composed of para-elemental cold or Seomni-pthoerosuusrfsaucrfeaciens2ansdegmmaetenrtisa,lsawndill tbheecroemafetedratmhep
which employ extreme cold. However, against such monsters damp area will progress downward/inward; after 5
as white dragons, winter wolves, yeti and the like, a melt spell segments the surface will also be wet.
will inflict 2 points of damage per level of the spell caster, or 1 Porous surfaces and materials will simply absorb the, rain
point per level if the subject creature makes its saving throw to their entire capacity.
versus magic. The material components for a melt spell are a Small flames, such as those of candles, will be extinguished
few crystals of rock salt and a pinch of soot. by 1 segment of precipitation. Small fires will slow and become
wsmillonkoyt fboer 1maroteurniadllyafateffrecptreedcipbiytatthioenshpaesll.ceased. Large fires
Mount (Conjuration/Summoning) Note that if the temperature is above 90° F., the duration of the
spell will be extended to double normal except in arid regions.
Level: 1 Components: V, S, M Also, where the temperature ranges between 31° and 33°F., the
Range: 1” Casting Time: 1 round precipitation will fall in the form of sleet. At 30° F. and below, the
precipitation will fall as rather thick snow, and most of the
ddwIfaoammullbapolngefeicfstiahrsele/w,hafeeirrtaneetebasaosolfl,faefelfalffaefmercgcettewsoatifrllrikethbeaee, iespntrecaeg.pc,apiptaleiietdacdtloiuotnuontdilpwroteihlfcleipbwiestaanrtfoimoowrnm,fmoie.egde..ltosaIf.f
magical cold is applied to the spell or the water which remains
tahserseaalaftmera,nndoerrsmawlililcseuwffeilrl b1epfooinrmt eodf .dVameraygehoitncerevaertyuresesgsmuecnht
dcrueriantgurwehsicahretheeyntaitrleedwtiothina tshaevaerevaerosfuesffemcat goifc.thTehsepemll.atSeuricahl
component of the spell is a pinch of silver dust.

ADrueraatoiofnE:f1fe2ctt:ur1nscr+ea6tutruerns/leveSl aving Throw: None Run (Enchantment)

Explanation/Description: By means of this spell, the caster RLDeauvnreagl:teio1:nT: o5u-c8h hours CCoamstipnogneTnimtse: :V1, S, M
calls a normal animal to serve him or her as a mount. The animal round
will serve willingly and well, but at the expiration of the spell Saving Throw: None
duration it will disappear, returning to its own place. The type of Area of Effect: Special (humans, demi-humans only)
mount gained by this spell depends on the level of the caster; of
Explanation/Description: The run spell enables the recipient

5D R A G O N

82

to run at full speed for from 5-8 hours without tiring. However, creases, and increase length by 50% when diameter is halved.
after so running the individual must spend a like number of TwaClhoilteihloi&fcnotKhamnebomota;aubLntood1vosepf.;poLToooshtoseopibfrl&oeapnKteyonooogt;rbivTjoeeietchute&nridnKrenooroprtaed; -ealbinrkindefdotorshbpeitjeetrlcoletvarmereeruss:pseCtsoonboidelf;
hours resting, as well as drinking plenty of liquids and eating properly, so it must usually be thrown or hurled nearby. Any
heartily. For every 2 levels of experience of the spell caster, creature affected by the rope-like object can, of course, interact
another individual can be affected, i.e. at 4th level, 2 individuals with it as if it were a normal object; the dweomer does not cause
can be touched and empowered to run; at 6th, three; etc. The the rope to have magical properties beyond its ability to obey
omfadterireiadl pcloummpsobnoeinletdofinthsipsrisnpgelwl aistearnanedlixtihr emoaidl eoffr5o-m8 btheeanjsuicoef commands. (Cf. Rope of climbing, rope of entanglement.)
a spurge (castor) plant.

Taunt (Enchantment) Deeppockets (Alteration/Enchantment)

Level: 1 hit CCaosmtipnogneTnimtse: : V,S ALDRerauevnreaagl:teoio2:fnTE:of2fue4cchttu: r1nsga+rm6etnutrns/leveCSCl aoavmsitnipngognTeThnirmtosew: ::V1,NStou,nrneM
Range: 3” Saving Throw: 1 round
ADrueraatioofnE: ffeincstt:an2talenveeolussor Neg.
dice/level

Explanation/Description: A taunt spell enables the caster to Explanation/Description: This spell allows the magic-user to
jape and jeer effectively with respect to any creature with an specially prepare a garment so as to hold far more than it
mcinreateagltilucigr-euesnoecrre’scorwefao2trudoresrsg.arnTedhaetsesoeru. nTwdhosredrssepaaelnlmld’sesadonwuinnedgosmtoweirtllhgecivhseaulslbetnjehgceet normally could. A finely sewn gown or robe of high-quality
the subject(s), be insulting, and in general cause irritation and cmoanttearinialn(uamt eleroausst 3p0o0ckgeotsld. Opineecedsozveanlueis) tishefamshinioimnuemd snoumasbetor.
anger. If the subject creature or creatures fail to save versus The deeppockets spell then makes 1 of these pockets able to
tchbmuaaarapnetgtadliebsc-ho,lewetlhicodtohef mwdtthaoienueiangnpgstowpssneipolslle,l clricl.aeeawtr.hstaielttlheirnecrl,ytayhauawasnnteidtlal actsehtkeateaecmtckhhkeittnaoognsupdrusfereseollhvmbceofaroadysryttehadwrfisfineeitfaacfnpptuecohrdeyny.ssctioOcraeanndallldyoy- hold 1,000 gold pieces weight (5 cubic feet volume) as if it were
one sort of creature can be affected by a taunt spell. It affects only 100 gold pieces weight. Furthermore, there will be no
creatures closest to the spell caster first, regardless of maxi- discernible bulge where the special pocket is. The spell can be
mum range. Thus, if a group of gnolls were being taunted by a ccahpaanbgielitdy (to1/2alclouwbic10fooptovcokleutmseeeaacchh)o.fIf1a00rogboeldorpliiekceegawremigehntt
10th level magic-user, the foremost 10 would be subject to the cisosste),w1n00wipthoc1k0e0tsocramn obree dpwoecokmetesre(1d,0to00cognotladinp1ie0cegomldinpimiecuems
sgpneollllisfihrsts,heavmeannthaotutghhe threearspoefllthceasgterroumpi.ght prefer to affect the weight each, and hold 1/6 cubic foot volume each. If the spell
duration expires while there is material within enchanted
Wizard Mark (Alteration) gpaorcmkeetnst,, tthhee mmaatteerriiaall vcaonmisphoensen—ts loofstthfiosresvpeerll. aInreadadtiitnioyngtooldtehne
needle and a strip of fine cloth given a half-twist and fastened at
the ends.

Level: 1 SCCaoavmsitnipngognTeThnirmtoswe: ::V1,NSos,neegMment Flaming Sphere (Alteration-Evocation)
ADRruaernaagtioeof:nE:TfofPeueccrtmh: a1nseqnutare foot
ARLDerauevnraeagl:teoio2f:n1E:”f1fercotu: n6d’/ldeiavmeleter Components: V, S, M
Explanation/Description: When this spell is cast the magic- Casting Time: 2 segments
urusneer isorambleartko, iansscwribeell,avsisiubplytoorsinixviasidbdlyit,iohnisaol rchhearrapcetresrosnaolf Saving Throw: Neg.

sphere

srumnaelleurposnizes.toAnew,izmaerdtaml,aorkr spell allows the caster to etch the buErnxipnlgangaltoiobne/Doef sncorirpmtiaoln-t:ypAe ffliarme itnogcsopmheerientospbeellincgauupsetos a
any softer substance without harm 1”
distant from the spell caster. This sphere will then begin rolling
to the material upon which the mark is placed. If an invisible in the direction in which the magic-user points, even though it
mark is made, detect magic will cause it to glow and be readable might be uphill. It will roll over low barriers such as walls,
(which does not necessarily imply understandability). Detect furniture, etc., as long as these barriers are not over 4’ tall.
invisibility, true seeing, true sight, a gem of seeing, or a robe of sFplahmerme.aCbrleeastuurbesstasntrcuecsk wwiillll bseuffseert2a-f8irepobinytscoonftadactmwaigthe.thAell
eyes will likewise note an invisible wizard mark. The material
components for the casting of this spell are a pinch of diamond creatures within a 5’ radius of the sphere’s center must save
dust (about 50 gold pieces worth) and a pigment or pigments svaappetonhriyrnseeturnssestoirmanmmnotadahvlgeeffliaiscrdmeiaoreetorscfa.etiioltIrsstnaectseiatitznaioeskb.feet1Tot”heh/merxeotoimunivnngeaddu,teiicsfarohaiasretlediltocdonbomdygthapteamhorsewnaeitgsshnaeeetms. msTeapehrmereeelellayfaclanasbmstsiatitnayeogssrf
fpoigrmtheentcsoalorreatsitoilnl uosfetdh,ebmutatrhke. Icfatshteermuasreksisa tsotybluesinovfissoibmlee, tshoert
rather than his or her digit.

Bind (Alteration/Enchantment) tallow, a pinch of sulphur, and a dusting of powdered iron.

Level: 2 Components: V, S, M Irritation (Alteration)
Range: 3” Casting Time: 2 segments
Duration: 1 round/level Saving Throw: None RLeavnegl:e:2 1”/level CCoamstipnogneTnimtse: :V2, S, M
Area of Effect: Special Duration: Special segments
Area of Effect: 1 creature Saving Throw: Neg.
tcmooaErbdgxe,iphclla-ianuvnesea,etarriooscnpah/eDue,seooesrrcsresiapvhnteeiyononrar:odpWecerash-b.leilkeTne.heAtohbbsisojueubcstjtep5coe0tfl’lcnoaisofnnne-bolmievrmipnsltagorilnymrgeo,adpty,eeatrrh(ina1e,l
inch diameter), plus 5’ per level of the spell caster, can be deErmxpilsanoafttiohne/Dseusbcjericpttiocnre: aAtunreir.riCtartieoantusrpeesllwaitfhfevcetsryththeicekpoi-r
affected. Reduce length proportionately when diameter in- insensitive skins are basically unaffected by the dweomer. (Ex-
amples are buffalo, elephants, scaled creatures, etc.) There are

7D R A G O N

83

two versions of the spell, either of which can be cast from the Preserve (Abjuration)
standard preparation:
insIttcahnintgitc—hinWghseennscaastito,nthoisncsaoumsees the subject to feel an Level: 2 Components: V, S, M
portion of its body. If RDaunragteio: nT:oPuechrmanent Casting Time: 2 rounds
5-8 segments are not immediately spent scratching this Area of Effect: One-half Saving Throw: None
irritated area, the subject creature will be so affected that cu. ft./level of the spell caster
the next 3 rounds will be spent squirming and twisting,
effectively lowering the subject’s armor class by 4 and its Explanation/Description: A preserve spell enables the caster
“to hit” probability by 2. tiot isrentaeiendseodmien aitesmpeflrle.sOhf acnodurwseh,otleheundtwilesoommeer liasteinretfimfeectiwveheinn
wnoilRtlicabesehgnio—nthtoiWngbhreefonarka1o-r4uatsroihnuinrseddcsa,wsbetu,ltttshthewehsreiucabhfjteefarctinitcstlryeeainttctuirher.eTswkhiienll retaining the potency of material such as mistletoe, holly ber-
rash will persist until either a cure disease or dispel magic ries, and similar stuffs which must be gathered periodically. It is
fisoucradsat yuspohnaviet. pItaslosweedr,si.ec.hamriasxmimaubmy l1ospsooinftcphearrisdmaya uisnt4il otherwise effectual. The sort of material which can be treated
points. After one week, the subject’s dexterity is lowered by a Hpraersde,rvreelsaptievlel ldyedpreynmdsatueprioanl: t2hned-le4vthelleovfethl e caster:
by 1 point also: Symptoms vanish immediately upon the
removal of the rash, all statistics returning to normal. SSeomft,i-rleiqlautiidvealyndwleiqtumidatmeraiatel:ri5atlsh:-78tthhlleevveell & up
The material component for this spell is powdered leaf from A container is necessary only in cases where a relatively high
poison ivy, oak, or sumac. degree of moisture is concerned. The material components of
the spell are a pinch of dust, a bit of resin (or amber), and a drop
Tasha’s Uncontrollable Hideous Laughter (Evocation) of brandy.

RLeavnegl:e:2 5” Components: V, S, M Whip (Evocation)
Duration: 1 round Casting Time: 2 segments
Area of Effect: 1 creature Saving Throw: Special LReavnegl:e2: 1” SCCaoavmsitnipngognTeThnimrtosew: ::V2,SSps,eecMgimalents
ADrueraatoiofnE:f1fecrot:unSdp/elecivael l
Explanation/Description: This spell enables the caster to
Tcahueseefftehcet sisubnjoetcitmtompeedriacteeiv, eanedvethryethsinugbjeacst hcirleaaritouurselywfiullnfeney.l Explanation/Description: By means of this spell, the magic-
only a slight tingling on the round the dweomer is placed, but user creates a material, whip-like substance up to 1” distant
goinggthlinegr,ocuhnudcikmlinmge,dtiiattteerliyngfo, lslonwiciknegr,initgw, igllubffeagwinings,mailnindg,finthaellny from his or her person. The spell caster can tahcetnuawl ioelnde,thfiosrwthhiep
cthoolluagphsinthgisinmtoaggicalmesirthoflausntscoonntlryolalasbilneglheidreoouunsd,ltahueghatfeferc. teAdl- by moving his or her hand as if it held an
creature must spend the next round regaining its feet, and it will Tmhaegilcaaslhocnaenwbilel ruessepdonsdo taosthtoe mmaokveembeonthtsamwahdiestlbinyg itcsraecvkokaenrd.
be at -2 from its strength on the 3rd and 4th rounds following an actual strike each turn. The sound alone is sufficient to keep
the spell casting. The saving throw depends on the intelligence annoimrmaal laactnuiamllyalsstrautckba(yasuninldeiscastethdebyysaavneorvmearsl u“tso mhiat”gdicie. Aronlly)
of the creature. Creatures with intelligence of 3 or less are must save versus magic at -1 to -4 or else slink away and not
totally unaffected. Those with intelligence of 4-8 have no saving return for at least an hour. Note that the whip does not do actual
throw; those with intelligence of 9-12 save at -4; those with damage to the creature struck. Creatures with intelligence
intelligence of 13-15 save at -2; and those with intelligence of 16 above 3 are not affected, nor are giant-sized animals above
or greater gain normal saving throw probability. The material about bear-size, nor are monsters. The whip can also be used in
cpoamddpleo,naenndtsaomf itnhuetestpoertl.l Tahree taorst misahllurfleeadthaet rt,hea stuinbyjecwt,oowdheilen melee combat, a successful “to hit” roll indicating that the lash
the feather is waved in one hand and the paddle is tapped has struck and wrapped around an opponent’s weapon. If the
against the posterior of the spell caster. enwodhnigp-eesdda,gvoeerds,vvetehrressuuwsshcniprourwsmhilialnlgtebbalolrowwit((6f1ro3omrorbthebetetteoterp)r,p),oifinftehthneet’swweheaaapnpdoonnuniiss-
less a saving throw versus magic succeeds. Magic bonuses of
Melf’s Acid Arrow (Evocation) affected weapons reduce dice score to save versus blows (Mag-
ic resistance must fail to make a “to hit” possible). The material
Level: 2 Components: V, S, M component of the spell is a small bit of silk braided so as to form
Range: 3” Casting Time: 4 segments a miniature whip.
ADrueraatioofnE: fSfepcetc:iaOlne target Saving Throw: Special
Cloudburst (Alteration)

usEexrpclarenaatteiosn/aDemsacrgipictio“na:rroBwy” mwheiacnhsspoefedthsisitsseplfetlol, itthsetarmgeatgiacs- LReavnegl:e:3 1”/leve/ CCoamstipnogneTnimtse: :V3, S, M
if fired from the bow of a fighter of the same level as the Duration: 1 round segments
magic-user casting the spell. The arrow is equal to a +1 weapon Saving Throw: None
for hit determination purposes. The effect of a hit might inflict (& special)
damage on the target even if it would not normally be harmed Area of Effect: 3” diam. cylinder up to 6” high
by an arrow or magic weapon of only +1 value. This is due to the
acid. The arrow itself does 2-5 points of damage. The acid caEuxspelsanthaetioant/mDeosscprhipetrioent:oBiynsmtaenatlnysproefctihpiitsatsepeallll,otfheitscwasatteerr
which gushes forth when it hits is equal to an acid missile of vapor into huge drops of rain, the resulting condensation not
8-ounce volume (1’ diam. area of effect, 2-8 hit points damage, voanlpyocrainutsointghea atrrueea dtoowliknebwurissteobferapinrebcuiptitaaltseodsausckrianign.mTohree
proluusnditeomf dsaamvaingge tfhorroewv)e.rTyh3e laevceidls’sosftrmenaggitch uinscereaabsoevse b3yrdo, nseo eclfofeucdtbwuritshtinwi1ll seeffgemcteivnet,lyfodrrietsncrahinevweilrlyftahllinagt twheithrianteitsofa1re/1a0othf
that double damage will occur over two rounds if the spell cast tinactihonpesrpesell.g)mAelnl tn, oorrmoanlefiirnecsh wofithraininftahlleinar1earooufnde.ff(eCcft. wpriellcbipei-
tihsefraocmidane4uthtr-a6ltizhelde.vTehl emamgaitce-ruiaslecr,omunploensesntthseotfatrhgeetspcealnl ahraevea
dart and powdered rhubarb leaf and adder stomach. (Turn to page 54)

9D R A G O N

84

e(Cxotinngtinuuisehdedfrobmy page 9) small ones instantly, medium is no great difficulty in causing common basic materials such
a cloudburst, as stone, earth (soil), or wood to appear. These sorts of mate-
ones in 3-5 segments, large ones in 8-10 segments. Magical sripaelsll.inSrimawila, rulyn,wootrhkeerdinfoorrmgaanrice oeransiolyn-gliaviinnegdmbaytemrieaalsnssuocfhthaiss
fires will also be extinguished by a cloudburst, with the follow- water, air, dung, straw, etc., can be conjured. When simple
ing general rules applying: Permanent magical fires will relight plants are concerned, such as when the caster attempts to
in 1-2 rounds. Small, rekindlable magic fires such as that of a tbortianlgfianitluoreb.eiTngheanbaasreeacohfagnrcaessis, thmeordeifiiseda dboawsenw1a0r0d%bcyha1n%cepoefr
flame tongue sword will be affected only during the actual level of the spell caster. Animal life can never be affected by this
cloudburst. Spells such as produce fire and burning hands will spell. In no event can worked, refined, or fabricated items be
be negated. Large-area spells such as efixretibnagllu, ifslahmeed,svtraikpeo, rwizaell ebnroaubglehst tihnetombaeginicg-ubsyeratmo actreeraiatlescpoemll.mTohnetshpineglsl eosfsaenbtaiaslilcy
of fire, etc. will, in the course of being nature.
the rain; a cloud of steam of quadruple area of effect volume will
be created. This steam will inflict 1-3 points of damage on
normal creatures within its area, double damage on cold- Melf’s Minute Meteors (Evocation/Alteration)
dwelling or cold-using creatures. It will persist for 2-5 rounds,
half that if a breeze is blowing, 1 round if a strong wind is Level: 3 Components: V, S, M
blowing. Range: 1“/level Casting Time: 5 segments
In arid regions, the cloudburst will act only as a double- ADrueraatioofnE: ffSepcetc:ia1ltarget Saving Throw: None
strength precipitation spell. In hot and humid areas, the dura- per
tftteeiaommlnl,ppwoeefriratahtthutueircereesspbaeenotlwlfdwe3sei0llnlu°bs3hFe1.°beaexantinneddgndlo3feo3wdr°metrFoe,.d,t2hswerleoheucetlnnodruaisdttb.haueIcnrrsctatuhbrmaeenuaclsoaramtweinesitsh.wIiaanll missile

snowburst, with one inch of snow falling per segment. Whether Explanation/Description: This spell is unusual in two re-
the cloudburst falls as rain, sleet, or snow, very hot creatures spects. First, the dweomer enables the caster to cast small
not saving versus magic within the area of the spell will suffer 10 globes of fire which burst into a 1 ft. diameter sphere upon
points of damage, plus 1 point of additional damage for every —impoarct,otihnfelicrwtinisge1i-g4npitoiningtscoofmdbaumsatigbeleupmoantethriealtsar(geevtecnresaotulirde
segment they remain within the cloudburst area. The material planks); and this ability continues from round to round until the
components for the spell are powdered silver and powdered caster has fired off as many of these “meteors” as he or she has
iodine crystals. levels of experience, until he or she decides to forego casting
any additional still remaining, or until a dispel magic spell is
Detect Illusion (Divination) successfully cast upon the magic-user. Second, once Melf’s
Minute Meteors is cast, the magic-user has the option to dis-
Level: 3 Components: V, S, M charge the available missiles at the rate of 1 every 2 segments,
Range: Touch Casting Time: 3 segments as desired, or 1 every round (beginning with the initial round of
Duration: 2 rounds + 1/level Saving Throw: #one casting).
Area of Effect: Line of sight 1” wide, 1”/level long
In the first option, the caster must point at the desired target
Explanation/Description: This spell is exactly the same as the on the 2nd segment of the round the spell was cast, and a
1st level illusionist spell detect illusion (q.v.) except with regard missile will be discharged. This process is repeated every 2
to duration, as shown above. segments thereafter until all of the missiles are so released.
Naturally, this usually will mean that the spell actually carries
Item (Alteration) over into at least the following round.
walitsShoihmohlidlaasrolyrth, deifistbchheeanrsegeefcitomonifdsseoinlepastiboalnisnigshetchhoeorsssephnee,lltshceeaessmteafitgr. itcTo-huaisscetorupcatiaollnyn
RDLeauvnreagl:teio3: nT:ou6chturns/level* Components: V, S, M discharge one of the “meteors” and conjure some other spell as
SCaavsitningg TThirmoew:: 3 segments well. The additional spell must be of such a nature as to not
Special require the continuing concentration of the spell caster, or else
Area of Effect: 2 cu. ft./level of the spell caster he or she will involuntarily forego the casting of any further
* — Non-living material allow quadruple duration. missiles from the original spell. However, considering that the
magic-user will have had the opportunity to have discharged a
Explanation/Description: By means of this spell, the magic- missile and cast a spell in the same round is of such benefit that
user is able to touch any normal, non-magical item of a size the potential loss is not of concern. (Note that if the magic-user
appropriate to his or her area of effect and cause it to shrink to fails to maintain an exact mental count of the number of mis-
one-twelfth its normal size. Optionally, the caster can also siles he or she has remaining, this is an unfailing indication that
change its now-shrunken composition to a cloth-like one. Only he or she has involuntarily foregone the remaining portion of
living things are entitled to a saving throw versus magic, but the spell.)
each such save is at +4 Objects changed by an item spell can be
returned to normal composition and size merely by tossing The components necessary for the casting of this dweomer
them onto any solid surface or by word of command from the are nitre and sulphur formed into a bead by the admixture of
original spell caster. Note: It is possible to affect a fire and its pine tar, and a small hollow tube of minute proportion, fash-
fuel with this spell. ioned from gold. The tube costs no less than 1,000 gold pieces
to construct, so fine is its workmanship and magical engraving,
Material (Evocation-Conjuration) sbpuetllit—reumnaleisnss dpaomteangtetdhrboyugahccoiduetnntuomr earbouusse.castings of the

Level: 3 CCoamstipnogneTnimtse: :V1, S Secret Page (Alteration)
Range: 1” round
Duration: Permanent Saving Throw: None Level: 3 CCaosmtipnogneTnimtse::V1, S, M
RDaunragteio: nT:oUucnhtil dispelled turn
Area of Effect: 1 cu. ft./level Saving Throw: None
Area of Effect: 1 page of any size up to 2 ft. square
Explanation/Description: A material spell allows the magic-
user to actually bring into being certain common things. There Explanation/Description: When cast, a secret page spell al-

54 NOVEMBER 1982

85

ters the actual contents of a page to appear to be something alansdtsafopru1ff roofudnudn. -Tcohleortehdresemaopkpelicwahtiiocnhsisar1e”: i1n) daisamaegtelorwainndg
ternetairteislye doinffebruernnti.shTihnugse, baonmyawpaclkainngbesticchkas;ngtheedtetoxtboefcoamsepeall sinigteilndinedthtearagiertd; r2a)wans baygtlhypehsopfeullmcbaesrtemr aarnkdedpooinntseodmaet sthuer-
can be altered to show a ledger page or even another form of tfaocper;oatencdt 3it). Tahseacsommaplloncehanrtascftoerr twherittsepnelilntaoreso1m00e gmoaldgicpiewcoersk
spell, etc. The caster is able to reverse the effect of the spell by worth of powdered amber, a scale from any snake, and a pinch
the mere utterance of a command word, then peruse the actual of mushroom spores.
page, and return it to its secret page form thereafter. The caster
can also remove the spell by double repetition of the command Dispel Illusion (Abjuration)
wfcsaplooilesrald,lk,.tihonOengtlyhpiteaswgristlerl-unoweo-iwltcliinosbgpnetteedhsenesstesdtrniocmcyaeenmdwa.ailtSlgterhicemovropetfatoalaf tpahdnaeisgpatreleutelewrmirnteahaagtlituicthyr,iesboorusftwptieifhslehilt
sdhuiesbrprjeienlcgmt aosgcficaa.leTsshe. ceremt apategreiasl pceolml, pifotnheanttpoafgteheisspneoltl sisubpjoewctdeedretdo ALDReruaverneaagl:toeio4f:nE½: f”fPe/leecrtvm:eSlapneecnita.l SCCaoavmsitnpingognTeTnhitrmso:weV:: ,4NSosneegments

Sepia Snake Sigil (Conjuration/Summoning) luesvEeexrlpailltaltuensmaiotipontniisn/tDgsetposecdlrliipsoptifoetnlh:tehTeshaiilslmusseiponenallimsisec.othnHesoidsweaermveeder,aattshtwethomelea3vgeridcls-,
obfelsopwellhsiscaascttubayl alenveillluwsiiothnisret.spect to illusion-phantasm types
Level: 3 CCoamstipnogneTnimtse: :V3, S, M
Range: ½” segments
Duration: Special Saving Throw: None
Area of Effect: 1 sigil
Wind Wall
Explanation/Description: There are three forms of this spell,
sbnuat keea-clikheefvoercnetu.aTllhyiscasuos-ceasllethdesceopniajusrnaatikoensopfrinagdseienptobbreoiwnng LDReuavrneaglt:ieo3:n:11”/lerovuenl d/level SCCaoamvsitnpingogneTTnhitmrso:ewV::,3SSps,eeMcgimalents
and strikes at the nearest living creature. Its attack is made as if Area of Effect: An area 1” wide and ½” high per level of caster
it were a monster with hit dice equal to the level of the magic-
vuiscetirmwishoencgausltfethdeindwa esohmimemr.eIrfinitgisamsubcecrefsieslfduloifnfosrtcriek,infgro, ztehne cuErtxapinlanoaf twioinn/dDeosfccriopntiosind:eTrahbislesspterellnbgrthing—s forth an invisible
and immobilized until the caster releases the dweomer or until a sufficient to blow
dispel magic spell does so. Until then, nothing can get at the vbmeiarrdtsesurisaalssmlafargormigceduaenssteucrsmrpoeiwncetsisngugprhwaasanpdrd.s),. No(Irof rtimon atdeloaiunrbstpe,acatpse.sracsvaianngn’tdtphlariokswes
voitistchtetiamrwrg,iesmet,oiatvfefdeiscthst iepthasethefsiimeilnmd eaorrifnltahgsehfovoriccf tebimrso.uwIrfnrothluigenhdst,ienwpgiiathhsimanalkooeurdmhenisros,iesoesr such a barrier. Loose material, even cloth garments, caught in a

5 5D R A G O N

86

fwainndawndallawfeillaftlhyerupowf aerxdo.ticThoerigmina.terial components are a tiny of tentacle from a giant octopus or giant squid. (The casting of
tlhinekesdpetlol rtehqeuimreesacgoenrscidoemrapbolenetnimtse.,) but it is unlikely that this is
Evard’s Black Tentacles (Conjuration/Summoning)
Leomund’s Secure Shelter (Alteration-Enchantment)
Level: 4 Components: V, S, M
RDaunragteio: n3:” 1 round/level Casting Time: 8 segments LRDeauvnreagl:teio4: n2:” 6 turns/level SCCaoavmsitnipngognTeThnirmtosew: ::V4,NSotu,nrenMs
Saving Throw: Neg.
(see below)
Area of Effect: 1 tentacle/level of the caster in a 10’ r. Area of Effect: 30 sq. ft./level

Explanation/Description: By means of this spell the caster Explanation/Description: This spell enables the magic-user
creates many rubbery, black tentacles in the area of effect of tmoamteargiaicl awllhyicchalilsinctoombmeionng ainstthuerdayrecaottwahgeereorthloedgsep,elml iasdceaosft
the dweomer. These waving members seem to spring forth — stone, timber, or (at worst) sod. The floor area of the lodging
from the earth, floor, or whatever surface is underfoot — includ- will be 30 square feet per level of the spell caster, and the
ing water. Each tentacle is 10’ long, AC 4, and takes as many surface will be level, clean, and dry. In all respects the lodging
points of damage to destroy as the magic-user who cast the will resemble a normal cottage, with a sturdy door, two or more
spell has levels of experience. Furthermore, there will be one shuttered windows, and a small chimney and fireplace.
scuacshtert.enAtnayclecrfeoartueraechwoithf itnheralenvgeelsoof ftheexpwerriitehnincge otefntthaeclespseilsl
subject to attack. If more than one target is within range of a While the lodging will be secure against winds of up to 70
tentacle, the probability of attack on each is determined and the miles per hour, it has no heating or cooling source (other than
result found by die roll. A victim of a tentacle attack must make natural insulation qualities). Therefore, it must be heated as a
a saving throw versus magic. If this succeeds, the victim takes normal dwelling, and extreme heat will certainly affect it, and its
1-4 hit points of damage from initial contact with the tentacle, occupants, adversely. The dwelling does, however, provide
and it then is destroyed. Failure to save indicates that the acosnasindoerrmabalel ssteocnueribtyuioldthinegrwreisgea,radsleistswoilfl aitsctumaalltyerbiael acsomstproonsgi-
damage inflicted will be 2-8 points, the ebon member is tion, resist flames and fire as if it were stone, and be generally
wrapped around its victim, and damage will be 3-12 points on impervious to normal missiles not of the sort cast by siege
the second and succeeding rounds. As these tentacles have no machinery or giants. The door, shutters, and even chimney are
einntetwlliigneencaenytoogbujeidcet t—hema,ttrheeer,episostht,eppilolasrsi—bilitoyrthcaotntthineuyewtioll secure against intrusion, the two former being wizard locked
squeeze a dead opponent. Once grasped, a tentacle remains and the latter being secured by a top grate of iron and a narrow
wrapped around its chosen target until the thing is destroyed flue. In addition, these three areas are protected by an alarm
tbhyesdowmeeomfoermr’s odfuaratttaiocnk. oTrhiet dcisoampppoenaersntdfuoer ttohisthsepeelxlpiisrataiopniecoef spell (q.v.). Lastly, an unseen servant (q.v.) is called up to
provide service to the spell caster.

The inside of Leomund’s Secure Shelter will contain rude

66 NOVEMBER 1982

87

ftruersntilsehtianbglse aasnddbeesnircehdesb,yatshemasnpyelal sca4stcehra—irs ourp8tost8ooblsu,naknsd, aa Otiluke’s Resilient Sphere (Alteration-Evocation)
writing desk. The material components of this spell are a square
chip of stone, crushed lime, a few grains of sand, a sprinkling of RLeavnegl:e4: 2” SCCaoavmsitnipngognTeThnirmtoswe: ::VN4, eSsg,e.Mgments
water, and several splinters of wood. These must be augmented Duration: 1 round/level
by the components of the alarm and unseen servant spell if Area of Effect: 1 ft. diameter per level of the caster
these are to be included in the spell; i.e., string and silver wire
and a small bell. Explanation/Description: When this spell is cast, the result is
a globe of shimmering force which encapsulates the subject
Magic Mirror (Enchantment-Divination) creature — if it is small enough to fit within the diameter of the
sphere and it fails to successfully save versus magic.
Level: 4 Components: V, S, M The resilient sphere will contain its subject for as long as its
Range: Touch Casting Time: 1 hour dweomer persists, and it is not subject to damage of any sort
Duration: 1 round/level Saving Throw: None except from a rod of cancellation, a wand of negation, or a
Area of Effect: Special ddiessintrtoeygeradtewiothroduitsphealrmmatogicthsepseullb.jeTcht.eTsheewsiullbcjeacutsmeaiyt to be
strug-
Explanation/Description: By means of this spell, the magic- gle, but all that will occur is a movement of the sphere.
user changes a normal mirror into a scrying device similar to a The material components of the spell are a hemispherical
crystal ball. The details of the use of such a scrying device are piece of diamond (or similar hard, clear gem material) and a
found in tsheectiDounn, guenodnerMCarysstetarlsBGallu.idTeh,e Miscellaneous Magic matching hemisphere of gum arabic.
Treasure mirror used must be
of finely wrought and highly polished silver of a minimum cost Shout (Evocation)
not less than 1,000 gold pieces. This mirror is not harmed by
casting of the spell as are the other material components — the Level: 4 CSCaoavmsitnipngognTeThnirmtoswe: ::VN1, eMsge.gment
eye of a hawk, an eagle, or even a roc, and nitric acid, copper Range: Self
and zinc. (Cf. fifth level cleric spell, magic font, and second ADrueraatoiofnE:fIfnesctta:n1t”anxe3o” ucsone
level druid spell, reflection pool.) (Editor’s note: Descriptions of
these two new spells will be published in upcoming issues of
DRAGON™ Magazine.) Explanation/Description: When a shout spell is cast, the

DRAGON 57

88

magic-user empowers himself or herself with tremendous vo- Ultravision (Alteration)
cal powers. With the dweomer of the spell the caster releases an
ear-splitting noise which has a principal effect in a cone shape Level: 4 Components: V, S, M
craredaiatutirnegwfritohmin tthheismaroeuathwoillf btheedceaasfetenredtofoar 32”-1t2errmoiunnudss. aAnndy Range: Touch Casting Time: 4 segments
tsaimkeilaar sliukbesatamncoeunstub(2je-c1t2toposionntsic) voibf rdaatimonasgwe.illAbneysbhraittttleereodr Duration: 6 turns + 6 turns/level
ebmy palosyheodutb,uet.go.ncaewpaellrodfaicye,.foAr soptheellrwofistehitshenactausretercamnigbhet Area of Effect: One creature Saving Throw: None
permanently deafen himself or herself. The material compo-
nents for casting the shout spell are a drop of honey, a drop of usEexrpelamnpaotiwone/rDsetshcerirpeticoinp:ieBnyt tmo esaeensraodfiathtiiosnsipnetlhl ethueltrmavaigoilce-t
citric acid, and a small cone made from a bull’s or ram’s horn. spectrum. In night conditions this means that vision will be
clear, as if it were daylight, to a range of 100 yards, and shadowy
Stoneskin (Alteration) and indistinct from beyond 100 yards to about 300 yards dis-
tance. If the night is very dark, with thick clouds overhead,
Level: 4 Components: V, S, M reduction of ultravisual sight is 50%. Where more than about 6
Range: Touch Casting Time: 1 segment fsineioedntivoiadfluleoaawlr,tshsouoncr hl3y favesiestiiononfvsoitroftunthaeelliyndteaimrnpymoseuensbdt eestrowgrertoeiunnnatdhbeoasruektyaa,a3nudl-tfroathvoeit-
Duration: Special Saving Throw: None radius, since the ultraviolet rays are screened out. (Of course, if
Area of Effect: One creature an emission source is nearby, the visual capabilities improve
amcacgoircdiitnegmlys.,) tNenedasrbtyo lsigphoti,l uinltcraluvdisiniognt,hteherabdriigahntcneesssheodf thbey
creEaxtpularenagtioanin/Dseascrvipirttiuoan:l Wimhmeunnitthyistospaenlyl iasttcaacskt,btyhecuat,ffebclotewd, rays “blinding” the eyes to dimmer areas more distant. The
projectile or the like. Thus, even a sword of sharpness would material component for this spell is a crushed amethyst of at
fhnruoortmleadfsfuebccyht aasgpcieraelnlsat,tuaarsesfnpiraerokbetae’lslc,tmsetdraikgbeicy, mestticsos.nielHes,okwilnige,hvntenoirnr,gwmboaougltli,dcaaanttdraocsckoks least 500 gold pieces value.
forth would have normal effect. Any attack or attack sequence
from a single opponent dispels the dweomer, although it makes MELEE: THE INTELLIGENT DM
the creature proof against that single attack or attack se- coOmnesocucpaisniorneltahteionqutoestthioennoufmthbeerleonfgatthtaocfkas dmeelilveeererodu.nOdf
qhuaenndcse, .aAnttoagcrkilslonw’sithfisret,laetitvce.lywislloifntflwiceta1p-o2nsp,oisnutschofasdaamamgoenko’ns necessity, a game of role playing adventure which has elements
tphreotaetctatecdkerbfyortheeacshtonseusckhinasttpaeclkl. wThhiele mthaeteartitaalcckoemd pcorenaetnutrse oisf soafym. Faogricthinecsluadkeedofinthceopmabceatoifsthgeoignagmteo, btheealobnsgtreavcitty, sohf aplllayweer
the spell are granite and diamond dust sprinkled on the recip- bcheakreapcttetors,aafansdt ttheempinoclwuhsiiloenaot fthmeasgaimc,ewtiemaepoanllocwoinmgbcaotmmbuast-t
ient’s skin. caantllsedleefowra. yThtousb,raeaoknoef-fm, cinhuatnegreoutancdticwsi,thorawshinagteleveerffeelcsetivies

58 NOVEMBER 1982

89

weapon blow is the norm. Likewise, damage is kept minimal, so death, and miraculous escape are part of the adventure in the
that a carefully advanced character will not generally be slain AD&D™ game system. While some prate about “realism” in
by a single stroke of some kobold’s axe. Weapon blows, just as fantasy, it is a DM’s duty to provide fun!
hit points, are scaled to a real individual.
THE WHOLE TRUTH AND NOTHING BUT
For example, a single swing of a broadsword will slay a There are many active rumor-mongers in the hobby, and
normal person. Armor helps only in determination of a hit, not
in damage, although armor could actually reduce damage as it some attempt to parley scraps of inside information into a few
took damage itself, eventually being totally ruined. That latter dollars for themselves. Actually, if you ever wish to know about
method adds unneeded complication to the combat system, so something that TSR is doing or planning, it is about 90% likely
forget it! Hit points and their accumulation make up for much. that you can find out by asking — personally or in writing.
As I have often stated, no human can actually withstand dam- (Those readers who have attended one of my seminars will
age which would fell a rhino. Damage above 12 points or so is understand what I mean). There have been some rumors about
not actually withstood — the points inflicted are mere scratches, TSR acquiring Grenadier. Well, TSR has been talking to
bruises, misses which remove a few hairs, etc. Similarly, armor miniature-figure manufacturers now for about five or six years,
class assumes the defender is active and doing his or her best to off and on. We are interested in doing metal miniatures. Gren-
stay out of the way. So to handle melee intelligently, the DM adier and TSR have been in discussion regarding some form of
must know the reasoning behind it all and keep it in mind when close affiliation for about two years. These talks have now
adjudicating situations. reached a serious negotiation stage. Nothing is yet certain, but
I am hopeful that agreement can be reached before the end of
One evidently thick-headed writer once wondered about the the year. If Grenadier becomes a part of TSR, it will mean even
difficulty of killing an unarmored character with some powerful closer co-operation, better figures, and figures released con-
weapon. After all, this marvel of intellect stated, a medium-level currently with games and modules.
character would have to be struck many times in order to
reduce his hit points to zero. Any DM could give such a person Anyone familiar with high-impact dice knows that TSR’s
the lie easily, once the concepts of melee are understood. Can DRAGON DICE™ random number generators are about the
magically sleeping creatures be slain at a stroke? You know it, best that can be found — but only for long wear and true shape.
even if they have several hit dice. Likewise, the helpless charac- We were well aware that the material, color, and overall appeal
ter is subject to easy execution — provided the character is of the dice we offered was not high, despite their features of
truly helpless, of course! Can he or she break free and escape? durability and exactness of casting/molding. For the last year
Grab a nearby weapon and attack? Whatever, we have all read we have been busy making dice as fast as we could, for we were
about or seen heroic characters who manage to escape from short hundreds of thousands of sets for games and orders.
certain doom. If your players are really into role playing, they Well, we caught up a while ago, and then our people went to
should bombard you with a host of ways and means by which work on the development of high quality dice with more attrac-
they can escape impending death. As a good DM, you should tive features — color, transparency, translucency, and size
consider each such suggestion on the merits of the situation variation. Expect to see some fine offerings soon.
and adjudicate accordingly. Intelligent melee combat, certain
We were disappointed to lose the design staff of SPI, but it

DRAGON 59

90

was by no stretch of the imagination a serious blow to TSR’s of Ijusstitllhfeoewl ibtaadllawbooruktst.hIesftiillml f,eCelOgNoAodNaTbHoEutBoAuRr BmAoRviIeA!N. My
plans for production of the general game line offered by SPI in review of the film brought letters in response. One suggested
the past. We have designers of high caliber on our staff in Lake tahgaet,hIadwoI unlodt hreaavde tlhikeedREthHebfoilmok.s,Haendis wperorebaIbalbyoruigt h1t4. Ayenaortsheorf
Geneva, and they are itching to do simulation games. We also letter suggested that I did not actually review the film properly
get many applications for design staff positions, because we abredc’asuwseorIkw, aansdjuIdfgaiinlegdittofrotrmeatthietsbciaosmopfobneeinngtsa, sfuanchoaf sHothwe-
offer our personnel excellent benefits and high salaries. How- bmeuesnictitalendd “cIRinVeImNaGtoTgHraEphByARofBADReIALNau”rIewntoiius.ldHnaodt hthaevemboeveine
ever, we have a New York office, and I personally desire to wquhiatet Dsoe rLaasuhreinntimisyprcoodmucpeadri.soAnssittois,whhoawt eHvoewr,amrdyworpointeioannids
maintain an SPI presence there. Not only is the Big Apple the uranpcehathnegeHdo.wIatrwdawsoarkstefrorribalefefiwlmnwamhiecsh. dAicdtinngotwhiansgbmado,reantdhasno
original home of SPI, but there are many highly talented de- was characterization. The film dragged — even the orgy scene
signers and writers there. With a liaison in New York, I believe wbeatsterb.oIrirnegg.reTthtoe spaloytthwaatswtihthinalal totfhtehabtewgoinrknininggaagnadinsnteivt,eIr cgaont
that we will be better able to employ that talent pool. That is still snaoyt ethvaetninrecmayll aopbinaiornofththeecminuesmica.toAglrsaop,hwyitmhartecghreedt, tIhceaonvoenralyll
in the works, by the way. quality of the balance of the film. Aristotle says in POETICS that
tetohfpefelqceutasaslwtitiyem.rpeInosnrttoeatandtb,aasIdp!seaFcwrtaoanfktaylypt,riaccaghleadDpyesi,sLIaitdusirdsepneetixicsptaepccrloet d.auSfcpitleimocnioa. lf
Speaking of free-lance designers, all of you Good Readers
should keep in mind that TSR is looking for excellent module Regarding my review of Games Day 82, one letter writer
submissions for any of our RPG systems. Be sure and get a spulagygeers-oteridenttheadt obnoeths hthaeveexthheibiritp-olariceen.teIdtoctaolnlyvceonntiocunrs, faonrdhothbe-
release, sign it, and mail it in with any submission. Material byists need to meet the manufacturers and view their latest
submitted must be typewritten, complete, and in manuscript awnadres“f,ujnu”stgaasmeinngth. uTsSiaRstsdoneeesdruton gtherteteogsemthaelrl fcoorntvoeunrntiaomnsenitns
form. The format for any module should strictly adhere to that RLaekveelG).eTnheivsalisetacshhoyueldare(xApuatunmdntoRfeovuerl,soWoinn,tearnFdaantllasayre, Sgparmineg
used in the latest TSR module for the same game system. Maps events with no exhibitors at all. However, the reader proposed
need only be rough. Artwork will be added by TSR. Artists tp.h.laa. tywethhre-aotrRsiePanGyteAthd™egpanotehwteweroirnrskga.mtIitgthhhaitnt bkaesthstehoecidialoetgiaoicnisa?l wSsoptarotynhstocuornnefosdri,dafeorbliknigsg,.
should also remember TSR as a market for their work. For
details of current needs contact Kim Mohan (DRAGON™ Mag-
azine) or Dave Sutherland (TSR). Rates of pay for modules run
from about $2,000 up. Artwork is by type and size, of course, but
pay is highly competitive. Check all this out!

And speaking of New York City, we also have our Entertain-
ment Media Office there. James Goldman is coming along very
well with the script for the film to be based on the AD&D™ game,
and all concerned are pleased with events so far. I have been a
fan of the film medium for well over 30 years, but I didn’t know a
thing about the business until three years ago when we first
began to negotiate with producers and agents for some TV or
feature film use of our property. After many trips to Los Angeles
and New York City, and after even more meetings, phone calls,
letters, and rough-deal memos, I am beginning to get some idea

60 NOVEMBER 1982

91

SPELL EXPLANATIONS

FIFTH LEVEL SPELLS:

Avoidance (Abjuration/Alteration)

Level: 5 CCoamstipnognTenimtse::V3, Sse,gMments
RDaunragteio:n1:” Permanent until dispelled
Area of Effect: Up to 3’ cube Saving Throw: Special

by E. Gary Gygax seEtsxpulpanaatnioantu/Draelsrcerpiputilosino:nBbyetwmeeeannsthoefatfhfeisctesdpeollb, jethcet acnadstaelrl
ocrtheeartulirveinagtttehminpgtsinegxctoeptot uhcimhstehlef oarffheecrtseedlf.oTbjheucst,wainllybleivirneg-
©1982 E. Gary Gygax. All rights reserved. apfufelscetedd(oubnjaecbtl,edteopecnodminegcolonsteher trhealantiv1e’)m, oarsswoilfl trheeputwlsoe; it.hee.,
waanolcouenldesfphineadlllfliutnhpgeomnatstieet mlwvepilsltinbugenattohbrltoeowutncohbcaaoncmkei;roawnditchohizneesn1t’wsouitfchhthaehnacalfhvlineogsidts-,
This month’s installment finishes up the presentation of new washiltehethcerecahteusret waopuplrdoasckhitetedr. aTwhaey mfraotmeriaalgciaonmt-psoizneedntcrfeoartuthree
mrualegsice-uxspearnsspioenll.sNselawtedspfeolrlsinocflulseivoenlsin5t-h9e, uspucpopmleimngenAtiDng&Dth™e asupppepolalnriselilvaoinrmgpatoghsnisneetgizsses,dioannnseyebadoltetren. meBepbctyatuoasecliavtishnetgascvproeeilaldtacuanrenceneonuttpitbloeenscttahhseet
lists in the Players Handbook, are these: subject creature to a saving throw.

No. 5th Level 6CthhaLinevLeilghtning
2265 ADviosmidiasnsacle Contingency
2287 FDaoblorircate EEnyesnbaiterement
Dismissal (Abjuration) Reversible (Conjuration/Summoning)
29 Leomund’s Lamentable Mordenkainen’s Lucubration ALDRerauevnreaaglt:eioo5:fn1E:”ffPeectr:mOanneenctreature CCoamstipnogneTnimtse::V1, Sro,uMnd
Belabourment Saving Throw: Neg.
30 Sending Transmute Water To Dust

N1o7. 7BtahnLisehvmelent Mansion 8th Level Explanation/Description: By means of this spell, the magic-
1189 MFoorrcdeecnakgaeinen’s BDienmdianngd oufseerxisseteenkcsetotoforerctuernortoaliltoswpsroopmeer pclraenaetu.r(eCffr.ofmourathnoltehveerl pcllaenriec
20 SeqMueasgtneirficent OtilSukpeh’esreTelekinetic smpuesllt, bAebjkunreo.w) nT,haenndaimf iet hoaf sthae gtyivpeeno, fpcrorepaetru,roertosubrnearmeteu,rntheids
21 TTeolrempeonrtt Without Error Sink too must be known and used in the spell. Magic resistance, if
2232 Truename sapneyl,l cisascthereciskecdomfoprareefdfetcot timhemleevdeial toerlyn. uTmhbeenr, othf ehitledviceel ooff tthhee
24 Volley cnruemabtuerre, thbeeindgiffedriesnmceissbeedtw. eIfenthheismoarghice-rulseevrelhisassuabthraigchteedr
fdsdhriaoiistsmvmmdiniicsitgshesseattelhh.sdaraIo,nfvwtitnhthhgeesencthcloeorrrveoneeawl.lytuEosrafecxnotchhreueeapnsoctmiafoasotnhtdhe:eiirgfI,ifchetrethdehraaesttleuadcvrvierfefieenltargooetruntbhcrheeeriogadihwsfeeferasicsditnredneudeemsdebbtdytoeoertbhditoese.f
No. 9th Level Certain arcane works are reputed to allow greatly enhanced
1134 CEnryesrtgayl bDrritatlien cishainnscteasntfloyr wspheisllkesudccaewsasy. ,Ifbtuhtethsepesllpiesllshuacsceass2fu0l,%thcehcarnecaeturoef
1156 MSourcdceonrkainen’s Disjunction acTtuhaellyresveenrdseingofthtehesusbpjeelcl,t btoecakopnla,naetteomthpetrsthtoancoitsnjuorwenu. p a
Sknuocwcenssanodr nfaaimlureedis(ifdaepteprlimcainbeled) icnrethaetusreamfreommaannnoethrearsplfaonrea.
WhCerreedictrefodritoirsigidnuael conception or inspiration for certain of the dismissal spell, but in this case magic resistance is only
snheowuldspbeellsdi(sitnricbluutdeidngassofomlleowpsr:esMenetlfed—inLulakset Gisysguaex’;sLceoolmumunnd) cswhuaecsccektoeeddthsi,fetthhpeelacncrreeeaaottfuurrtheeeihsasipsnesnltloacnkatnlsyotetwrran.nTpshrpoiospretderodnefasrmonmeo.twIgfhuteharereavsneptreeeiltl
A—vGKmiDsirenee&LngydetsDh.nbab™MuwyLroykaDMr,kdCaaoaevasfnnkitmddkeaar;ptWsihanEeieaTvgnkasonspru;idmserCnlaalmhannwamy,dioneoonOnvLwteati;ginlruha1likcktlslnehetiwanwpargilianrasecnewctee,eaNrrsCiP.nooCdftnehttvchienihesg5aeetrsdhanaccbmItynyeevrwJisttoaaoohtsuifonrnndthRaaeel-.-

24 DECEMBER 1982

92

that the beckoned creature will be kindly disposed to the Leomund’s Lamentable Belabourment
omracgoicm-umsear,ndnsorwwitihlloitutinsaonmyewaadydbiteionsuabl jeccotnstotrahiinst.orBheecrauwsiseheosf (Enchantment/Evocation)
twhhise,nvuasriinogusthsisorftosrmofopfrothteecstipveell,maenadseuvreesn awrieth gceanreefrualllpyretapakrean- LDReuavrneaglt:eio5:n1: ” Special more creaturSCCesaoavmsiintnipngaogn1TeT”hnimrrtoasewd::i:uV5sSspeegcmiael nts
tioTnh, ethemaretesruialtlscmomighptonbeenutsnwohf othleesosmpeel.l vary with the type of Area of Effect: 1 or
cinriemaitcuarel atondbedidstisamstiesfsuel dtoorthcealsleudb.jeInctgcerneeartaulr,eitaermesuwsehdichfoarrae
dismissal, and for a beckon spell materials which are pleasing, uupsEeoxrnpcl1aanuoasretimosnoa/rDeceoscmcrerbiapinttuiaortneio:snBaoybflemfatesoacniunsnadtoieofrnst,htacisnodnsfputheselilo,lnat,hnaegnumdagareaggicien-
desirable, and rewarding must be used. which the spell caster speaks. Upon casting the spell, the
cmreaagtiucr-eusoerrcbreeagtiunrsesdistocubsesiaofnfeoctfesdo. mTheotsoepincogt esramvainngevteorsthues
Dolor (Enchantment/Charm) amgargeiecinwgilloirmdmiseadgiraeteeilnygb,eagllinmtoosctopnovleiterslye. wAisthlothneg sapsetllhecasspteerl,l
cwaitshtetrhcehsouobsjeesc,t(hse). oAr sshloencganasmtahienrteainisthneo saptetallcbkymcoandveeurspinogn
RLeavnegl:e:5 1” CCoamstipnognTenimtse::V5, S them, they will ignore all else going on around them, instead
segments “chIfoothseinsgp”etlol isspmeanidntathineeirdtifmoremeoxrceluthsaivnel3y rtaoulknindgs, aenadcharsguubijnegct.
ADrueraatoiofnE: f2fercot:unOdnse creature Saving Throw: Special tcoresaatuvreetmhisusttimaettewmilpl twaannodtheerrosffavine cvoenrsfuussiosnpefollr. T3-h1o2serofuanilidnsg,
aamvlsaookidesinatghveepircnooxnthimfueist4yiothno,fs5tahthvee, saapnredell6sctthaillsrtkoeeurpnitndisna(nfoayrsefcovinreaantstio. nlTohnaognsdaesmwtuhhseot
usEexrpalattneamtiopnts/Dteoscforirpcteionc:oBmyplimanecaensorofotbheisdiespnecell, ftrhoemmsaogmice- tchaestsepr eclol nistinmueasinttahieneddwefoormmero)retothaavonid6throeucnodnsf,uesiaocnhesffuebcjte.cItf
oppositely asqlpuigeenslleticdoanosrdteuhrr.oinsTgthileietsdcmrweeearoteumrreeearfrdcoinamgu,saaenspdlaunoneneatfhosereeriigonnutnhtdeo omnuessteslaf,vief ovenresuiss tshpeelsl otoleaovbojiedcgtooinf gthientospaelrla, goer a—t aelilthoethr eart
tchreaat toufrethien subjects of the spell — and attack suicidally (regular “to hit”
wthheirleeafotenr,ththeelassutbrjeocutndbeocfomefefescnt ethrveoucsreaantudrefillaecdtuwailtlhy dfeoeulbstsa, optrhoebrabsiulibtyje) catgoafintshteodnwe’esoomwenr wpeitrhsoinnt,eonrt ftaollkuilpl.oTnhtihserangeearwesillt
tduurlel, asull-bejencctomtopamsaskinegadllolsoar.viTnhgethinriotiwalsevffeercstusscacuosmemthaendcsr/erae-- rlaasgtefocrh2e-c5krowuilnldrse.aTlizheostehastubthjeecytshwahveo sfaalvleenveprrseuystosptehlleoBnetlhae-
quests at -1 on the dice rolled to determine whether or not it bourment, and will collapse onto the ground, lamenting their
ereffseicsttss,cathueseathdejusatdmjuesntmt efanvt otoringgo tcoom-2p. lTiahnecete.rtTiahrye esffeeccotnisdaarny fdoisotluisrbhende.ss, for 1-4 rounds unless attacked or otherwise
aadnjdusittmmeankteosf f-u3r.thTehresreaavfitnegr,tthhreowcsrewatiuthreouits andojulostnmgeenr ta.ffected is Iaf tdtaucriknegdthaendc/oourrsoethoefrwthiseemdaisinttreancatendce, hoef tohre sshpeellisthsetilclapsrtoer-
The verbal component of the spell must deal with the class of tuesceter dc,anforletahvee sautbajencyt toimr esuabftjeercttshewcilal sntointgnaonticdet.heThseubmjeacgt(ics-)
acrbeoauttutrheeinsuqbujeecstticornea, twuriteh. as much information as possible will continue on for 1 full round as if he or she were still there to
asWsahileedn buyttethreingcrethaetursepeifllt,hethseumbjeacgtich-aussearhcigahnerbeintmelleignetancllye scpoenlvleforsrecownitthin.uIanntcheesoef tchaessepse, lhl oawreevneort,aspapvliincagbtlher,oewvsenveifr,sfuosr
tchhaannctehepsepr eplol icnatsotef rs.uIpnesruiocrhinatecllaigseen,cteheocf reefafetcutrievehlyaschaa5rm%- ainvsotaidncceo,nftuhseiosnubojrercat(gse).wNoouteldthoathtetrhweissepehlal vise ehnatdiretloy vsearvbealt.o
ing and dominating the magic-user. In the case of such control,
ttdhhiceetacctareessat.itnuIgfretohfwetihllsepthseepllnecllda, osthteweritshiusbtdhjeiescttsracpcreetleladtcuaroserteiisrntaaebsrrleuitpstoteaadligudntoummrienangt-t
cally effect the charm and domination.

Fabricate (Enchantment-Alteration) Sending (Evocation)

RDLuearnvagetieol::n:½5”P/leervmealnent CCSaoavmsitnipngognTeThnirmtoswe: ::VS,NpSoen,ceMial Level: 5 SCCaoavmsitnipngognTTehnimrtosew:::V1,NStou,nrneM
Area of Effect: 1 cubic yd./level DRaunragteio: nS: pSepcieaclial
Area of Effect: 1 creature

usEexrpislanaabtlieont/oDceoscnrvipetriot nm: aBteyrimaleoafnosnoef sthoirst isnptoella, pthreodmuactgiocf- Explanation/Description: By means of this spell, the caster is
desired nature which is of basically the same material as was efammpiloiawrearendd twohcoosnetancatmaesainngdleacprpeeaaturarencweitahrewhwoemll khneowonr.sIhfethies
cinaitnialflyabursiceadtewahewn otohedefnabbrircidagtee wfraosmcaastc. luTmhups,ofthteresepse, llacraospteer creature in question is not on the same plane of existence as the
fMroamgicaalpoartclhivionfghtehminpg,sccloatnhneost fbroemcrfelaaxteodrbwyoaolf,aabnridcasteo sfoprethll.. ssrepemenldol ivcneagdstwethri,ellrtehneowrteoauirslrdiavbe5e;%ia.ec1.h,0a%inf ctchehepaensrcuebpljaeonfcetfawrileuemrreeo.vtTewhdoethpmalaatngtheices-
The quality of items made by means of the spell is commensu- unreosset prceoccnatsntidoseterhenedd;meoe.ngse.s, awag,oeardns,epnaent.rdAletlhtvheeolauorgefhentoxhpteetrsreieeanntedcdien,gaswisiwthroercaderstiivcweleitdhs,
frisaabtrereidcwuaicttiheodnth.beIyf qmauifnaaelcitrtyoarlomof fmantaeintreeia;rliai.isel .u,ws1oerdckueabdsicwtyhiatehrd,btabhseeicsaormfeoearstoh1feecnfufeebwicct tmhaensnuebr.jeTchtecrseeantduirneg,isif nsoutccoebslsigfualt,ewdiltlobaecut nudpeorsntoitodineavneny
foot. tphooiungt,h othr eancrimeaatlurientehlalisgeanncein)t.elligence of as little as 1 factor (1
(jeAwreticlrlye,ssgweonrdesra, llgylarsesq,ucirriynsgtaal, heitgch.) cdaengnreoet boef cfarabfrtiscmataendsuhnip- cyTlinhdeerms,aetearcihalwciothmopnoeneopnet nfoerntdh,iscosnpneellccteodnsbiystas sohfotrwt opiteincey
elersesd.thCeamstainggic-ruesqeuriroetshe1rwfiuslel rhoausndgrpeeatr sckuibllicinytahred c(roarftfocoont)siodr- of fine copper wire.
material to be affected by the spell.

DRAGON 25

SIXTH LEVEL SPELLS: 93

Chain Lightning (Evocation) nearest target, and the target that saved takes no damage.
The arcing bolt will continue until it has struck the appro-
LReavnegl:e:6 4” + ½/level CSCaoavmsitnipngognTTehnirmotswe:::V6½, Ssoe,rgMNmeegn.ts
ADrueraatioofnE: ffIencstt:anStpaenceioaul s sparivaeteonrulamcbkeor fotfheobojepcptos,rtausnitinydtiocadtoedsoby(aas ftoarrgaent’sinfaaniluimreatteo
tsoiotbrnijkeeicnst paolfotanttriongnge-tmththaeagtpicgaarthol unonafdtutshreiet.)a,Drucirnientcgiltiotchnheaiisnstnrlioegvkheetnrifnaagdc.eoDsnissoitduaentrcoaer-
caEl xdpislacnhaatrigoen/Dbeegscinrsiptaiosn:aWsihnegnlethstisroksepeollf ilsigchatnsitn,gt,he¼”elwecidtrei-, is a factor, though; a single arc can never be longer than the
tchoempmriemnacriyngtafrrgoemt, twhehicfihngmeurtsiptslieofwtihtheincathsetemr aanxidmeuxmternadningge otof draisntagnecelimthiat.nIfi,tsinmoarxdimerumto raarncg,et,hetheboslttromkeusftadtreasveinltoa gnorethaintegr.
theCshpaeinll laigshdtnicintagteddiffbeyrsthsehlaervpelyl offrothme caasntoerrm. al lightning bolt A tree or a substantial piece of conductive metal — such as
(spell) in that when it strikes its intended target, it does not then tinhteerlcigohntnneincgtinsgtroirkoen abnadrsporfevaelnatrgfeurtcheellr oarrcciangge. — will ground
vdeisrssiupsates.peIfll,thoenep-hrimalfardyamtaarggeet fmroamketshea bsoultccoefsscfhualinsalviginhgtnitnhgroiws hitTshaefteligrhsttnriiknigngintfhliectsproimnearlyestasrgde6t ofofrdtahme afigrset otimn ee;aicfhthtearigneittiailt
tcaaksetenr;)owthiellrbweisein,flfiucltledda. mage (1d6 points per level of the spell target was struck by a 12d6 bolt, the next target struck takes an
tf1oo1rd1h6da6blfo—dlt,atmthheeanglae1s0tadsp6pp,uli9ertdso6o,f ne8nde6ea,rcg7hyd6sfrt,oriamkned,thdseoiffbeoornlet.na(tlAl ftrhoseamvwitnahgyetdhsoarowvwen
In addition, after striking the initial target, the bolt arcs to the vs. spell to see if the lightning actually hits a secondary target.)
cnheaairnesotfosthtreikrinogbjceocnt,tibneueist afrnoimmaol,nveegoebtjaebclte,tooranmoitnheerralo. bTjehcist The caster can be struck by an arc from his or her own spell.
snuemaraebsltyits, tpaotisosniabrlyy soerttiimngmuopbilaiznedo)scoilblajeticotns,boertwaeerengtuwlaor(ppraet-- Tcrhyestaml arotedr;iaalncdoamspmonaenyntssilvaerer painbsitaosfthfuer;spaenllacmasbteerr,hgalsaslesv, eolsr
ttaerrgneitnsvaorlevienqgutihdriseteanot,r tmheorcehaoinbjeligchtstn.inIfgtwwoilloarrcmtoorme eptoasl sfiirbslte, of experience.
then to the one with the most fluid, otherwise at random.
iniTtiahletachrgaeint)kaesepthsebsupiledlilncgausptetrohaass mleavneyls.“liTnhkus”s,(inac1lu2dthinglevtheel Contingency (Evocation)
tmaarggeict-ufisrsetr, cthaesntin1g1thoethsepre(lnl owtonueldcehsitsa12rilytadrgifefetsr:enthte) tparrigmeatrsy.
After the initial strike, each object subsequently struck is en- Level: 6 SCCaoavmsitnipngognTeThnimrtosew:::V1,NStou,nrneM
ttihtliesdstaovea isnadvicinagtetshrtohwatvtehresusstrsopkeella, ciftuaaplplylicaarbcleed. Stoucthceesnseoxnt RDaunragteio: n0: 1 day/level
Area of Effect: The magic-user

Explanation/Description: By means of this spell, the magic-
user is able to place another spell upon his or her person so that

26 DECEMBER 1982

94

the latter spell will come into effect upon occurrence of the cdaespteern. dTsheonbathsee cmhaanncneerfoirnawnheicnhsntahreedcocrnefaintuinreg tdoebsriegankwfraese
sTihtueatcioonntdinicgteantecdy dsupreinllgatnhde tchaestsinpgelloift tihsetocobnrtininggeinntcoy esfpfeecllt, mhaasdeo.nlAy haabnads-deoonfe1o0n%e,haansdathbaatsfeor2t0h%e,fiorsntetiimnleaidonolyr c(warhviecdh
—(thethe1 “tcuormn pcaansiotinngsptiemll”e—indaircea, tiendefafebcot,vceasist aat ttohetalsafomrebtoimthe cinhdaicnacteesiswmhoedthifeierdorbynotht ethteotjaolbswcoarse doofntheepmroapgeircly-u).sTerh’se cboamse-
castings). The spell to be brought into effect by the prescribed bined intelligence and experience level compared to the intelli-
scoonnti(nfegaetnhecyr fmallu,slet vbiteatioonne, fwly,hiscthatuaeff,efcetisgnthdeeamtha,geict-cu.)searn’sd ipseor-f gtheencceresactuorree saunmd mthoeneedxp. eIfritehnecespleevlleclaosrtenruhmabseraohfighhitedr ictoetaol,f
a level no higher than one-third of the experience level of the that difference is subtracted from the percentage chance for
acat s1t2etrh,,r1o3utnhdoerd1d4othwnle:vael4othf elexvpeelrie“cnocme;paan5itohnlesvpeelllm” maxaimxiummumat tdhieffecrreenactuereistoadbdreedaktofreites. cIfhathnececrteoatburreeahkafsreae.higher total, that
15Tthh,e1s6itthu,atoiorn17ptrheslecvriebleodf teoxbpreinrigenthcee,sapnedll sinotofoertfhfe.ct must be theThperoctehcatnivcee smyamybboel. Ifuf rtthheerhmanodd-ifmieaddbeypcroatreecitnionpriespainrsactiorinbeodf
gsecinclneesrgniatbaucre,nylfatetlhclydtaahtcsoinotuamngwwyhieathtittiimenacrteanoontarehbiefrsfeyeimmcrwaati.ltagahLtirecei-rklruieqgs“wuceeroniidsemi,esrap,thplat.lehunFenioaogricneroyedsnxwpiatniemnatolgtlpe”eolermnr,scioagpythheccetlolropnwwutriisleindlel-- co(1rve,e0ar0tua0relgo.nbpgr.eeparekprinetgruiorfnrdeoeoffisatimprepedli,cuuacsteiiodnngb),yspt1he%ecicafohllryanepcvreeerpoyafrtueardnnpesinpgsemnnaetrnsetosd
2ibn’rtiondgiestfaafenfcectaett.hheeInrsfaealcllloicnnatdosesespf,feeltlch,tetahnceoyltnaimttitneegrethbneeciynmgiamg“cmicae-sudts”iaeintresfltayallnsbtraoinnvgees-r tphreepcahrianngc; ei.eo.,f abnreeaxkpinegndfirteuereboyf 11%tu.rnThainsdc1a,n00b0ringg.p.threedbuacsees
ously when the prescribed circumstances occur. Note that clehvaenl/cheit todic0e%s, tbillutmtuhset fubrethmeradmeodthifeicraetaioftnesr, foarndintneolligaemnocuenat nodf
tctpihooaenmnsiwopnfhloeormxle,eafcgfseoipccme)tilpnltoglcicostamhimteeppdlpel,ylxaafya(ntihdol ef/wothrhceoecnnodtnicwnvageolelolenumdcteeyudrpsaopprnreee.llsliacknreidlbyettdhoeccocanoudmsei-- special preparation can negate that risk. Similarly, an inlaid or
thoTsheeomf tahteerciaolmcpoamnipoonnsepnetsll)o1f0t0higsosldpeplilecaeres w(inorathddofitiqounictko- binrsecarikbiendg pfrreoetebctyivienldaeysiniggnwciathn vbaeriobruosugmhetttaolsa, m0%inecrhaalsn,ceetco.f
esiylveelars;hanofealenpohgarnet mivaogryi, sktia-rtiun,etotresoimf tihlaer mspaeglli-cu-suinsgerc;raenadturaen. Tahdids ncootstlewsisll trheaqnuir5e0,a00m0ingim.pu.mtootfheonbeafsuicll cmoosntthofohfatviminegatnhde
Note that the ivory statuette is not destroyed by the spell cast- plinroetsecotfiopnrointelacitdionoroirnsbclurirbriendg ionftothsetognlyep.hAsn,yrubnreesa,kainngdosfigthiles
ibnegc(aarltrhieodugohn itthme ipgehrtsboen soufbthjeectsptoelwl ceaasrtaenr dfotretahre),caonndtinitgmenucsyt wmheirchangduaarlldowthethemacrgeicaatul rbeatroriebrresapkoiflretheeaeuftfoicmacayticoaflltyh.eEdvweneoa-
spell to perform its function when called upon. straw dropped across the lines of a circle destroy its power.
sFtorarwtunuaptoenly,atnhyepcorretiaotnuroef wthitehiinnsccarinbneodt psrootmecuticvhe adsevpiclaec,efoar
tthheeOnmscpaeeglslicacfoealfsytteherensdbnaaarrreresied.,r absolutely prevents it.
Ensnarement (Conjuration/Summoning) (tRheemcreematbuerer cthaen bdeankgeeprt foofr saosmloenthginags
pbrroemaiksiensg, othremianksecrthipretiaotns!)inTohredecr atosteexraccat nonoeffseerrvbicriebefrso,mutshee
Level: 6 CCoamstipnogneTnimtse::V1, Stu,rnM cmaapgtiicv-euscerreahtausres.aTidhetoDthMe weinllsnthaerendacsrseiagtnurae,vraaltuinegtoit fwrohmat 0thteo
Range: 1” Saving Throw: Neg. 6. This rating is then subtracted from the intelligence score of
ADrueraatioofnE: ffSepcet:ciSapl ecial tehqeucarletaotuorrel.eIsf sthtehacnreiatstuaredjmusatkeedsinittseslliagveinngcet,hritoww,illarescfuosree

daEnxgpelraonuastioanc/tD: ethsecrilputriionng: oTfhea cpaoswtienrgfuol fcrtehaistusrpeeflrloamtteamnpottshear sree-rovfifceer.eNd e2w4 ohfofeurrss, lbartiebre,sw, heetcn. cthaen cbreeamtuardee’s, ionrtethlliegeonldceonheass
apglarneeestotoapseprefocrimallyonperespearrveidcetrainprwethuernrefoitrwfriellebdeomhefldromunttihl eit durnotpilptheed cbryea1tuproeinptrodmueisetos tcoonsfeinrveem, eunntt.ilTithbisrecaakns bfreeer,eoper autnetdil
ensnarement spell. The spell causes an awareness of a gate- the caster decides to loose it by means of some riddance spell.
slipkeecoiaplesnaivnigngonthtrhowe pislatnheenofmthadeecrtoeadteutreermtoinbeeifetnhsencarreeadtu. rAe fIot rnceeead ncoatptbiveestcrreesasteudrethinattocesrutbaminisosthioenr.spells can be used to
dtiotestbeinectteasllgtihgaeetenn.caTetousrsecaovorefe,thtwheeitphclar3endaat6ru.roeTphmeenuisnstgcrooarlsleeaiqsutrmaalpotodoirofirbeedlelisbesvyethtshaenit Once the single service is completed, the creature need only
sdpiffeellrecnacseterb’se.twIfetehne cthreeacturereathuares’sa ihnitgehlleigresnccoerea,nthdethdaiffteorefntchee wsPloohlnaeyginne.cfroeRsremitHvceatannhmdgebee.oscopFakeon,lrlcAbecedearssisatoeelrurvSgictehoertv.bias(enCrtefi.nsaMsentndaotennIdtsnl.ytveMisrtriebMamlneaosnrSpieuotsaarlltk,aeerEderf.)rfoerfoIetmemtni-;
is subtracted from its dice roll to save. If the spell caster has a possible or unreasonable commands will never be agreed to.
higIfhethrescsoarvein,gthtehrdoiwffesreucncceeediss,adthdeedcrteoattuhree tomtearleolyf tihgeno3reds6.the
tshproewll-cisrenaotet dmoapdee,nitnhge,carenadtuthree sdtewpesominteor tfhaeilso.pIef nthinegsaanvdinigs Eyebite (Enchantment/Charm, Illusion/Phantasm)
aaennlsWdsonhsametranuetsdeat.dcb,Tteuahaneuldlstyyeifpdeeintinshonafcascarrseaetdains,tpugterheocefitfoticchr,ebepeaertnouesprnenesanrc,raoeormmer diegnnimgvteusfnrspotnemballe.makenn,ootthhweisnr
plane to that of the spell caster is not constrained from harming LReavnegl:e:6 20’ CSCaaosmvtiinpngognTTenhimtrsoe:w:V1:, SSsepgemcieanlt
cthirecleon(feorwchroeattruarepspefrdomit. tThheeureppfoerrep,ltahneescaosrtethreuAsestsraal Pmlaangei)c, ADrueraatoiofnE: ffSecpte:c1ialcreature
amethnataulm, oartuCrgoinccotrriadnagnlteO(pfoproscirteioantuprelasnefrso)m, orthaepEetnhteargeraalm, E(fleo-r
scurecahtuprreostefcrotiomn,ththeerloewiseraacnhdanincfeertnhaalt pthlaeneenst)r.aRppeegdarcdrleeassturoef to Emxeprlealnyastitoanre/Daetshcrisipotiornh:erAsnuebyjeecbtitaendspseplleaeknaabsleinsgtlheewcoardstteor
will be able to break free and wreak its vengence upon the spell jccoeaancusets,teeobrfutchittasetnhfdeocwuheeroyopoemosbeseitrseiwbtoslhepibceeehllffieepsfcafettrshtciectwuunaelatdrereidse.sufisWfpeeacidtthte. dist,hitesovsesinntrgiktlheeosuthpgeehll,soutnhbley-

(Turn to page 54)

DRAGON 27

(From page 26) 95
TChhgmeaaarfzmokeue: raTthenhefdefecvcmhtosaacrgoamifclie-ztuhdasetseiousrnpbcejeaollcnftaacraehbsasitnhromgelusleteae:lwypoelorrdsyoa. nlTahonerdmedfoofenccsiletteisrwibttohy
respect to the charmer. It is otherwise the same as a charm Mordenkainen’s Lucubration (Alteration)
Fetpaioernr:sToohnfeaomrsiacnhggailcer-muwsomerrdoc.nasTntheercassupusebeljle.fcetawr ibllyagcat zaes aifnsdtrvuocckabliyzaa- RALDerauevnreaaglt:eioo:6fn0E: ffIencstt:aTnhtaenemoaugsic-user SCCaaovsmitnipngognTTehnimrtosew:::V1N, Ssoengement
Sicsfnekueeabsnrjse:sctpTto,ehsslilswpueepnaeolkepwsaeosrvwaeeornsraatdhb,veilanesngsudttbhhcjereaocuwcts’asevsbetseorursddutydos.eTmsnpheneeralelvuliiysscetgsiamauzcawecneidlalstbssifetcuhakle.-t isEaxbplelantoatiionns/tDanestlcyrirpeticoanl:l Banyyussepeollf htheisosrpsehlle, thhaesmuasgeidc-uasnedr
one-half normal abilities (strength, intelligence, etc.) from otherwise forgotten during the past 24 hours. The spell must
trhaete paalsino, aanndd ftehevevri.ctMimovweilml heanvtewtioll rbeest ahtalofnoef-ehaaclfhntourrnmainl hMpaaneovyreridofeidbrnes,ketaantnihndmreoneiut’msgcohlaruinzfcienfutdobhrtaalebtnivoedenloaecsf tnpugaearbellllylaeptsureesrtcehpidesoedwsluypereiarnllsgthcitaafhsniettehfsriafttatdhotendlreeevtcviemaell.rel
woridllenretogabtee athbeleptoowmeorvoef atht ealdl.wAeosamveinrg. Othtrhoewrwviesres,usthemavgicic- lbueceunbrcaatisotn. Odnwlyeoomneer.suTchhessppeellllcarencableledsocraencatlhleedrebayfteursebeofctahset
tim will remain struck by the sickness, losing one actual snpoermll caollmy poonnethnetsfooflloawminagteroiarlsnuactucreessmivuestrboeunadv.aiAladbdleitiiof nthael
cpooninsttitouftiocnonpsotiintutsti.oTnhpeeerffdeacyts uanretilndeegaatthedobccyuarssuactczeesrso- spell recalled requires such, or else the remembered spell is
fnwuolisndh-ish,puaemnl admnaw,giisnchosnwp-edillell maolris-hbouyrmeaamnho,evaealntsdhpeenlls.oincA-klhtneuremsreasa.nloiNtyido, tleicm:reiAtealdl- fruitless until the material components are available.
Sletuerpe:sTshaevemaatg+ic4-uvseerrsucsanthcisauesffeecat.ny individual to fall into a
comatose slumber by means of gaze and a single word, Transmute Water To Dust (Alteration) Reversible
uCnreleastusrethsenosrumbajellyctsmubajekcetstoitsasfairsvtinlgevtehlrsolweepvesrspuelsl smavaegica.t ALDRerauevnraeaglt:eioo6:fn6:E”fPfeecrtm: a1necunbt ic”/level SCCaoavmsitnipngognTTehnimrtosew::V:6,NsSoe,ngMem(esnptescial)
-2. Undead are not subject to this power. Affected crea-
tbuarceks tmoucsotnbsecisohuaskneensso.r otherwise shocked to bring them Explanation/Description: When this spell is cast, the subject
aNroetae itnhsattainftltyheunwdaetergr oisesalarecahdaynmgeudfdroym, thliequaidreatoopfoewffdeecrtywdilul sbte.
expanded to double normal, while if wet mud is concerned the
area of effect will be quadrupled. If water remains in contact
with the transmuted dust, the former will quickly permeate the

54 DECEMBER 1982

96

latter, turning the dust into silty mud if a sufficient quantity of effect of the dweomer are caught and contained unless they are
water exists to do so, otherwise soaking or dampening the dust faaroenbrsdlceiesbttaoroenfacptetahhsceswaneftohararpcopoeupncglayshgtcehtah.anetFrpoueaprstseihssnetiarnthmngrcsooeru—egto,hcaatrnhesdeaintoggufalreepcssaotuwtinersimtethhpeataltlbomaspprasaegsloilcssf
tahcecomrdoimngelny.t Oofnslypeliqlluciadsaticntguaisllyaeffxeicstteindg. Liniqtuhiedsarwehaicohf aerffeecotnalyt through the walls of the cage. If resistance fails, then the crea-
cpoanrtciaelrlynewda.tIefrawliivllinbge carfefeactuterde iinsscoofanrcearsnethde, aacstuaavilnwgattherroiws touthreerincrqeauteusretiosnalissociangtehde. aRreeagaorfdleefsfesctoof fstuhcecesspse,ll aanrey taranpdpaedll
tvaergrseut sfomr saugcihc issperellquusiareged,, raengdardolnelsysoonfethceresaizteuroef cthaencbreeattuhree eusncleaspse.thTehye aflosrocehcaavgee misagaliscoreusnilsiktaencthee wshoilcidh-waalllloewdsptrhoetemctivtoe
cnpooewnncte.ereErnditehcder.er aTuthseeawgreaetvereer rqssupeiereollsf wtmhheiacthesprrieeaqllluciisoremssipmdoupnsleytnaatssvoaefrcyaohbmiigtphoo--f dmeevaicnes,ocfuabdeisopfeflomrcaeg,icinspthealltoirt bcyanexbpeiragtoiotnteonf rtihdeodfwoenolmy ebry.
seashell and diamond dust of at least 500 gold piece value. altBeryedmteoanasfoorfcespcuebciealsppreellp.afroartcioencu, baefoisrcoencea-ghealfsptheell acarenaboef
tehfafetcotf(aa ccuubbee o1f” foonrcea isnidaell),reasnpdectthsesdawveeothmaet rofthtehne dreifsfeermenbcleess
SEVENTH LEVEL SPELLS: between a cast spell and the magic of a device.

Banishment (Abjuration-Evocation) Although the actual casting of either application of the spell
tproeoqwcudoiremersmanitdoiiamtmtaootnemdriaeolmfcaootmrylepaodsnotee1ns,t0,d0teh0emgsaotlnudddpytiehocafettshtehveaslpumee,lal ugresiciqn-uguirsteheder
ALDRerauevnreaaglt:eoio7:fn2E:”ffPeecrtm: 2anleevnetls/hd of SCCaoavmsitnipngognTeThnimrtosew::V:7,SSspe,egMcmiael nts diamond dust to trace the outlines of the cage or cube he or she
creature(s) per level of the caster mdeesmireosriztaoticorne,attheevidaiasmpeolnl dcadsutisntgisatesmompleoyleadterantimd ee.xTpheunsd,eidn,
tfhoer udpuosnt inctoomtphleetaioirnaonfdsittuwdyill, dthiseapmpaegairc.-user must then toss
caEstxepr ltaonfaotricoen/sDoemsecrcipretaiotunr:eAfrobmanaisnhotmheernpt lasnpeelltoenreatubrlnestothites
cowomn eabboadcek. Twhiethoefufetcstoismeinsstapnetcaniaelosuus,mamndonthinegsourbjmecet acnasnnooft Mordenkainen’s Magnificent Mansion (Alteration/Conjuration)
eisghreeds.sMfrooremthitasnowonnepclarenaetutroetchaenobneefforrocmedwinhtiochmiat gwicaasl bbaann-- ALRDerauevnreaaglt:eoio:7fn1E:”ff1echt:ou3r0/0levseql. ft./level CCSaoavmsitnipngognTeThnimrtosew::V:7,NSroo,nuMends
ishment, providing the spell caster is of sufficient strength
s(luebvjeelcstsofareexpweitrhieinncraen)gtoe doof tshoe, sapnedll.pTrohveidsinpgellthreaqt uthireesptohtaetnttihael Explanation/Description: By means of this spell, the magic-
gmivaegicits-upserorpbeorthnanmaemeasthweetlyl,paenodfccarlelautpuoren(sp)otwoebrse ospepnot saewdayto, wusheicrhccoannjubreesgauinpedanonelyxtarat-adimsinegnlseiopnoainlt dowf eslpliancge, oennttrhaencpelantoe
the creature(s). fcrroematuwrehsicohbstheervisnpgetlhl ewaarseacawsitll. sFereomonltyhea feanintrtyshpiominmte, rtihnogsien
fulT, hheatmefautle, raianldc/oormoppopnoesnetsd otof tthheesnpaetlul raereofsuthbestasunbcejescth(sa)rmo-f the air, an area of some 4’ in width and 8’ in height. Once
the dweomer. For every such substance included in the casting, ombasgenrvifeicresnhtafoveyepraasnsdednbuemyeornodusthceheanmtrbaenrcseb, ethyeoyndw.ilTl bheehpolladcae
stmhtoeinneseu,sbaajvneedctvacersrespaurtisgurmeo(fasgr)oicslo.esFmeoasrrye-2xwafemrorpemleu,tshiefedirdoininc,echarosotlylilnegwdaattoebra,dnesiutsenhr--- wniinlleb-ceoufursrneisbhaendquaentdtocoasntmaiannsyudffoiczieennst ofofopdesotpulfefsatsothseersvpeeall
ment upon a demon, its saving throw versus the spell would be tcraasntseprahreanstlesevervlsanotsf ,elxivpeerrieiedncaen.dTohbeerediewniltl, btheeraesttoafwf aoift nuepaorn-
imteamdse, asut c-h8 (afsouhrasirufbrosmtanthceestatiilmoefsathkie-rifnacotrocrooufa2tl).feSaptheecrisa,l all who enter. The atmosphere and temperature will be clean,
ccoounltdraaslts,oabdeeavidl’dsesdctaoleborinr gtittahne’sfahcatoirr, uopr mtois-t3leotore-4blpeesrseitedmb.yIna freSshin,caentdhewpalramc.e can be entered only through its special por-
druid might lower the factor to -1 with respect to a demon. If the ttaiol,nosuitnssidideeciotnpdaitsiosntso dthoenpoltaanfefebcet ythoendM.aRnessiotna,nndorredloaxcaotniodni-
csausbtjeerctwicllrebaetusrteunmg abkyesa ibtsacskalavsihngofthernoewrgvy,ertsaukes 2th-1e2sppoeilnl,tsthoef within the place is normal, but the food is not. It will seem
daNmoatgee:,Ifatnhde bpeowsetursnnceadllefdoru2p-o1n2wsheegnmecnatsst.ing the banishment eOxncceelleonuttsaindde,bheoqwueivteerf,illiitnsgeaffseclotsngdiasaspopneearisimwmitheindiathteelyp,laacned.
sbpaenlilshaered,doirreciftlytheayndaraectfiavevolyraobplypoasnedd atoctitvheelycrceoantcuerern(se)dtowibthe nraovremnaoul sfohoudn.gFeorrweiallcshtrimkeeaulneleastsentheinsiniddeivitdhuealMs aanctsuioalnly, tahtee
ethfeficiancteyreosftsthoef sthpeellspceolml cpaosnteenr,tsthbeysefrpoomwe-1rs(lceaanstaucognmceenrnt ethde) fianrdeiv.idFuaailul rleeatvoindgomsuosmt sepaennsdth1aht ohuer osrittsinhge ahnads eloastitnagsnmoramnayl
to -6 (most concerned). Specifics of this effect are left up to the points of strength as he or she ate meals when in the mansion-
judgement of the referee. slnitkoreetensgdpt,habcwueitl.l tShbeiuscphmerusmtsratenbneegntt.hdoTlonhseescwiosimthrpeinosnt6oenrhatsobulfeorsrutpohorisnthseepaeltlolinsagsreaosaf
miniature portal carved from ivory, a small piece of polished
Forcecage (Evocation) marble, and a tiny silver spoon. These are utterly destroyed
jwTuhhn(eeIctnrteiiosthniswewoesrivptthhiedlamel insencnocetraiomtshnta.ianltgptohthretaatdl,ethasissigsnwpeaelnllldahsainswtebitrheioeirnlluousfsiotehndeminsapcgaoicnce-.
ALRDerauevnreaaglt:eioo:7fn7E:”f6fpeecturt:r2n2s”le+cvue1bl/sleevel SCCaoavmsitnipngognTeThnimrtosew:::V3N,-4Sons+eegspmeecniatsl ncroeteawteodrthcyanthbaet ealvlteesrehdavtoe ssuoimt tehevecrasisotnero’sf twhiisshsepse.llItwihsicahlsios
castable at a lower level.)
Explanation/Description: This powerful spell enables the
caster to bring into being a cube of force, but it is unlike the DRAGON 55
mcaaggeicdoiteesmnooft thhaavtensaomlide winalolsneofimfoprcoer;taint tharesspaletecrtn: aTtihneg fboarncdes-
of force with ½’ gaps between. Thus, it is truly a cage rather than
an enclosed space with solid walls. Creatures within the area of

97

Sequester (Illusion/Phantasm-Abjuration) anything other than immense hatred for the magic-user. The
faolrlcseudcsheravgicreeewmillebnetsc,arbruietdthoeut etonttihtye wleitltlemr, oasstiscethrteaicnalysesweeithk
Level: 7 Components V, S, M whParteepvaerrarteiovnenfogretihtecacna.sting of a torment spell requires either
Range: Touch Casting Time: 1Srpoeucniadl
ADrueraatioofnE: f1fewcte:e2k’ +cu1bed/aleyv/levll of cSasatveirng Throw: tihnescsreibceredt innatmhee ftoerxtthoef ttyhpeeinocf acnretaattuiorne.oTrhites cgaivsetnernmamuesttoalbsoe

dvloeecEnrastxtseptlhdatheenetaeatciofoftbneioj/cenDtceetasdsncadorifpbfletojiecoctcnaet:td(isoW)bnyhinsetpvnhieeslcilsbasleseftqr,outomtehsiastwenorsyrpskfepoinlelrgmlnl,otoiott faodslnesiltgoyehcrptternoeo-r-r identify himself or herself. This establishes the link and allows
seeing. Thus, a sequester spell can mask a secret door, a trea- the dweomer to be efficacious. However, for every 1 point of
sepuyroreeosfvoafrruoalmt,goetarmcwtiohleaf tsedeviseecirno.gvO.efIrfyccooaursrstfreuo,pmiot nddoeaevcsicreenasottusrrueecnhndeoartsdtheaesrisoriubnbegjetocoft iinstaell1ig%enccheaonfcethtehactrethaetucreapatbivoevecrtehaattuoref twhiell sgpaeinll ccoansttreorl,, tdhrearwe
be affected and able to resist and avoid the spell, a normal tthoeitscaoswtenr ipnltaonetheancdonwfhinaetsevoefr iftastepriissotnh,usanddeccraereryd.hIifmthoer mheargiocf-f
asaffveicntgedthbroywaissegqiuveens.teLrivsipngellcbreeactoumrees c(aonmdaetovseen aunnddeaarde etyfpfeecs-) 5us%erchisanincteerprueprtpeodinotrodfisintrtealclitgeedndceuroinfgthtehecarepativdeingcr,etahteurree itshaat
tively in a state of suspended animation until the spell wears off it will gain control. The merest mispronunciation of a single
olisrkisedyeislpaeshlle, dg.uTmhearmabaicte,raianldcoamdpraomneonftswohfittehweassphe. ll are basi- wpooTinrhdteionmf taihnteteertlileaigxletcngocimeveposofnthegneatincoianfpgtthivceoensctprroeella.l tiusrethae 1% chance per
aforementioned
“specially prepared writing” (in the form of a scroll). Its special
piniekcseswipllerrehqituidriee aonf tehxepcerneadtiutureretoofbenoatffleecstesdthbaynth1e,0d0w0eogmoledr
of the spell.
Teleport Without Error (Alteration)

RLeavnegle7: Touch CCoamstipnogneTnimtse:: V segment Truename (Enchantment/Alteration)
Duration: Instantaneous 1
Area of Effect: Special Saving Throw: None Level: 7 CCoamstipnogneTnimtse: :VS, pSecial
ARDrauenraagteioo:fn3E:”ffSepcet:ciTahl ing named Saving Throw: Neg.
spEelxl.pTlahneatciaosnt/eDreisscaribpletiotno: tTrahnisspsoprtelhliimssseimlf iolarrhteorsaeltfe, laelpoonrgt
with the material weight noted for a teleport spell, to any known gtoeEnhxeaprvilceanogarrteiionandt/iDvpioedswucaerlri,pkotinovonew:r naTnhtyoistlihvseipnegslpltehelilnncgaabswletehsric.htNheahtaumsraaalglyin,ca-mumsoees,rt
ltsoepcneacltlieoa,nlbsouonteahnniasybosleruschhethrpehlaocnameseteispr,lataontetbrawevsiteth,l “ntSootuocdthhiaeendrcpeclaafronerefuselrlyoro.f”r.eTxThihsise- true names are not known, for the common names of most
oakansnusodtuwemclreareodrserg.fteuhTlaloyhtfetpthheteaerubcaslaeresedtfaeorartonhteawalserh,peiicoanhrtffoatirsrcatn,eusvaspeceontdurt,tuaalawltyiloitthbneelieteshpnedoteroatsapittrphieorednoppuwrlsaiiaetnhtdee- ettnhrnauicnmeognemsaopmafaretsehsesnepossetutlhtblhejreeecniqrtautatruinurredeestaahtnnheddne/osbmreeahcgirgisneitctoa-rnuyraseomecfriettahtsote.ioTcnsahuoleblfjeocvcuaettsr.sttTiehnhegwishtorwifucihaell
tuosedretseprmelli,nesucchcaonr,cedeosfcerribroerd. (Exception: See 9th level magic- require 3 segments. Thereafter, still in verse (and preferably
below.) rrheysmulitngof othr enetraure-rnhaymmeings)p, etlhl.eEcaacshtepromssuisbtlederesscuriblteditfhfeersdeinsirthede
lengtttEohioaMnco4hfussltptviuimepegllrelegs.)eenSIsneurtiecogaqengusteoisprsteaoatsirowlyno1et:frossT7,eehsgjfeufemesgvcetmetnuartesasnettoetissf ,ricete:4aacncistehuc.gow(gnSeetearseeitnioasnfursosgpmgceeals1nl.-
Torment (Evocation-Alteration)
abreWecctuiemtaaaaltkidolnoenes..sssWoaiftnh1dtphSoeuinrlortesonsfdoseftrr:eeTnaghchtehpvfoeoirrnseteasocfrhestcsrieetengdgmtchea,nutthsoeef
Level: 7 CCoamstipnogneTnimtse::V1, Sro,uMnd subject must save versus paralyzation or meekly sur-
ARDrauenraagteioo:fn1E:”ffSepcet:cOianl e creature Saving Throw: Special Sretrnednegrt.hEloascshisvreercsoevemreudstincforonmtin2u-e8 rfoour n1dsseagftmerethnet.
screuhPcbaijnoteaglcytetimorinneotgrocpaehsinao:ssmTeihetsste,hwaivnnielgldrtesowelsisreteh,csjriausenstc.tocavaseuirsfyeaoptfhoselytrmseunobgrpjtehhctathnteoy
Explanation/Description: When this spell is cast, the magic- tohbrjoewct isspneelledheadd. bTeheenlecnagstth. Nofotismyesteinmvesrhsoecsk(1sasveingg-
dcureseemaratsunerdeeekdfsro(tsmoeefaodrncooeltohsre,urbenmpsliansnsaieroenmfroaemnndt wsophbeeolldmsi)e.anTcsheeefrrvionimcitieaalisuctabtepertiiinnvgge hmoewntrapdeircavletrhsee)cthoancgaeu:se the polymorph depends on
of the spell causes a link from the caster to the captive creature
Tbhoeurnedaftienr,athmeagmicagcicir-culsee,rthcoanutminauteusrgtioc rteriaadngtlhee, obralapnecnetagofratmhe. mmiinneerraall ttoo avengimeatalb=le 1=0 9vevresersses
csappetciviaellyfeperlsepparroegdrewssriitvinegly, awnodrseea—ch driosucnodmftohrist acnodnttihneunesp,athine. vegetable to animal = 8 verses
oToffhTerreehafaeirddsicintnrggtewacbotaruiurnroseguenrsaedhcfsouhosbetirisnninggagnptdtoawicnisnrsuag,mbeamspn,sidtt.htteohetthhfiriefdthpaeanrndfdofrosmuixratthhncrreoouuonnfddass mmoonnsstteerr ttoo nmoormnsatler==76vveersresess
service is given a straight saving throw versus magic, adjusted other to human = 5 verses
eTahceh sraouvnedinfotrhtehefirisntternosuitnydofisthmeaddweeoamt e-1r ttoo btheeadffeiectreodll,bythiet. vameniginmeeatraalbltloetoatomniimvneeagrlea=tla=b4le2vev=resr3essevserses
sseixcthonadt -a6t -a2n,dth-8e rtheisrpdeacttiv-3e,lyt.he fourth at -4, and the fifth and
daIrtdiss wlikilel lsyutbhmatitaonnycientietlrliegaelniztecsretahteurneawtuirthe olofwthmeosrpael lsl tiat nis-
being subjected to. Naturally, this does not cause the creature

56 DECEMBER 1982