The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.

17.11325.2018 SealRite InStock_LR

Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by pongsak.klailee, 2018-05-10 14:09:20

2018 SealRite InStock

17.11325.2018 SealRite InStock_LR

Keywords: sealrite door,beautiful door

ConcordeTM 5G1GG

KensingtonTM

Kensington Black Nickel Brushed Nickel
TM

Clear bevels, glue chip glass, granite glass

52 and caming.

Fiber-Classic® Mahogany CollectionTM

FCM148 FCM626 FCM156 FCM149 FCM8149 FCM6036 FCM6056 FCM151 FCM789
2'8"x 6'8" 2'8"x 6'8" ‡ 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'10"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8"
3'0"x 6'8" 3'0"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"

Key Vented Sidelite 7'0" Height Available
Stock
No Stile Lines (6'6" & 6'8" only in 12" & 14") Standard Lead Time +1 Week
Black Nickel Caming (1D) (8'0" only in 14")
Brushed Nickel Caming (1C)

Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

Fiber-Classic® Oak CollectionTM KensingtonTM

FCM150 FCM813SL FCM1442SL FCM149SL FCM867SL FC148 FC626 FC20042 81961P FC156
2'8"x 6'8" 10"x 6'8" 12"x 6'8" 12"x 6'8" 12"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8"
2'10"x 6'8" 12"x 6'8" 14"x 6'8" 14"x 6'8" 14"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8"
3'0"x 6'8" 12"x 7'0" 2'10"x 7'0" 2'10"x 7'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8"
14"x 6'8" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡
14"x 7'0"

5G3GG

FC149 FC8149 FC152 FC709 FC151 FC798 FC150 FC148SL FC813SL FC1442SL 81961PSL
2'6"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 10"x 6'8" 12"x 6'8" ‡ 12"x 6'8" 12"x 8'0"
2'8"x 6'8" ‡ 2'8"x 8'0" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 12"x 6'8" 14"x 6'8" ‡ 14"x 6'8" 14"x 8'0"
2'10"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 14"x 6'8"
3'0"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8"

Smooth-Star®

FC149SL FC8867SL S160 S626 S20042 S902 S156 S161 S8149 S6036
12"x 6'8" 12"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" ‡
14"x 6'8" 14"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡
2'10"x 7'0" 2'10"x 7'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'10"x 7'0" 2'10"x 8'0" 2'10"x 6'8"
3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 8'0" 2'10"x 7'0"
3'6"x 6'8"
3'0"x 6'8" ‡

DeKceornastiinvgetoGlnTaMss Smooth-Star® (cont.)

S6056 S162 S709 S163 S1001 S6119 S160SL S6132SL
2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 12"x 6'8" 10"x 6'8"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 14"x 6'8" 12"x 6'8"
12"x 7'0"
14"x 6'8"
14"x 7'0"

GG5G4 S1442SL S902SL S161SL S867SL
12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"

Key

No Stile Lines Vented Sidelite 7'0" Height Available
Black Nickel Caming (1D) Stock
Brushed Nickel Caming (1C) (6'6" & 6'8" only in 12" & 14") Standard Lead Time +1 Week
(8'0" only in 14")

Above: Fiber-Classic Oak Collection, Kensington Glass, Door – FC148, Sidelites – FC813SL
Right: Fiber-Classic Mahogany Collection, Kensington Glass, Door – FCM148, Sidelites – FCM813SL, Transom – KNRT
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

KensingtonTM 5G5GG

PembridgeTM

Pembridge Black Nickel Brushed Nickel Brass
TM

Hammered glass, gray baroque glass, multifaceted

56 bevels and caming.

Fiber-Classic® Mahogany CollectionTM

FCM6550 FCM6500 FCM86500 FCM6560 FCM6565 FCM6568 FCM6520
2'8"x 6'8" 2'4"x 6'8" 2'6"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'6"x 6'8" ‡ 2'8"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8"
3'0"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" ‡

Key Vented Sidelite Optional Dentil Shelves

No Stile Lines (6'6" & 6'8" only in 12" & 14") 4-Block Dentil Shelf*
Black Nickel Caming (1D) (8'0" only in 14") Available for all Craftsman-style Fiber-Classic
Brushed Nickel Caming (1C) Mahogany Collection doors.
Brass Caming (1A) 7'0" Height Available
Stock 4-Block Dentil Shelf*
Flat Lite Frame Available for all Craftsman-style
Smooth-Star doors.

Smooth-Star® PembridgeTM

FCM86550SL FCM6500SL FCM6565SL FCM86560SL S6550 S6500 S6560
12"x 8'0" 10"x 6'8" 2'6"x 6'8" 2'6"x 6'8" ‡ 2'6"x 6'8"
14"x 8'0" 12"x 6'8" ‡ 12"x 6'8" 12"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8"‡
14"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 2'10"x 6'8" ‡ 2'10"x 6'8" ‡ 2'10"x 6'8"‡
3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 6'8" ‡

S6565 S6568 S2640** S6550SL S6500SL 5G7GG
2'6"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 12"x 6'8" 10"x 6'8"
2'8"x 6'8"‡ 2'10"x 6'8" 2'10"x 6'8" 14"x 6'8" 12"x 6'8" ‡
2'10"x 6'8"‡ 3'0"x 6'8" 3'0"x 6'8" 14"x 6'8" ‡
3'0"x 6'8" ‡

Above: Fiber-Classic Mahogany Collection, Pembridge Glass, Door – FCM86550
*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.

**Available with flat lite frame or Impact-rated lite frame only.

Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be

more or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller

or visit www.thermatru.com for details on glass privacy ratings and glass designs.

EnLitenTM Flush-Glazed Privacy & Textured Glass Geometric (XG)^ Chinchilla (XJ)

Satin Etch (XE)^^ Rainglass (XR)

Chord (XC) Granite (XN)

EnLitenTM Flush-Glazed

Privacy & Textured Glass

GG5G8

Classic-Craft® American Style CollectionTM

CCA220 CCA8220 CCA230 CCA8230 CCA240 CCA8240 CCA87400XG CCA260 CCA8260 CCA3450 SL CCA220 SL CCA210 CCA8210
(XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, CCA87400XR (XG, XC, XJ, (XG, XC, XJ, (XG, XC, (XG, XC, (XG, XC, XJ, (XG, XC, XJ,
XR, XN) XR, XN) XR, XN) XR, XN) XR, XN) XR, XN) 3'6"x 8'0" XR, XN) XR, XN) XJ, XR, XN) XJ , XR, XR, XN) XR, XN)
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" XN ) 3'0"x 6'8" 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 12"x 6'8"
14"x 6'8" 12"x 6'8"
14"x 6'8"

Key Stock Optional Dentil Shelves Classic-Craft American Style 16-Block
Standard Lead Time +1 Week
Flush-Glazed Glass (FG) Available for Craftsman-style doors.
Simulated Divided Lites (SDL) Classic-Craft American Style 4-Block
4 Simulated Divided Lites (SDLF4)
Removable Wood Grilles (RG) Classic-Craft American Style 4-Block* Classic-Craft Canvas 4-Block

Classic-Craft® American Style CollectionTM Shaker Doors EnLitenTM Flush-Glazed Privacy & Textured Glass

CCA87100XG CCA3400 SL CCA3500 SL CCA210 SL CCA2300 SL CCA82300 SL CCA2310 SL CCA82310 SL CCA2400 SL CCA82400 SL
CCA87100XR (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC , (XG, XC , (XG, XC , XJ , (XG, XC , XJ , (XG, XC , XJ , (XG, XC , XJ ,
3'6"x 8'0" XR, XN) XR, XN) XR, XN) XJ , XR , XJ , XR , XR , XN ) XR , XN ) XR , XN )
XN ) XN ) XR , XN )
12"x 6'8" 12"x 6'8" 12"x 6'8" 4 12"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 6'8" 14"x 6'8" 44 4 14"x 6'8" 14"x 8'0"
12"x 6'8"
12"x 6'8" 12"x 8'0" 14"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 8'0" 14"x 8'0"

Classic-Craft® Classic-Craft® Classic-Craft®
Mahogany CollectionTM Rustic CollectionTM Oak CollectionTM

5G9GG

CCM3400 SL CCM8000 SL CCR3400 SL CCR8000 SL CC2025 SL CC2020 SL CC8000 SL
(XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, (XG, XC, XJ, (XG, XC ,
XR, XN) XR, XN) XR, XN) XR, XN) XJ, XR, XN) XR, XN) XJ , XR ,
12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 6'8" XN )
12"x 6'8" 12"x 8'0" 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 8'0" 14"x 8'0"

Classic-Craft® Canvas Collection®

CCV920 CCV930 CCV940 CCV960 CCV950 SL CCV920 SL CCV910 CCV100 SL CCV910 SL
(XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, XJ, (XG, XC, (XG, XC, (XG, XC, XJ, (XG, XC , XJ , (XG, XC , XJ ,
XR, XN) XR, XN) XR, XN) XR, XN) XJ, XR, XN) XJ, XR, XN) XR, XN) XR , XN ) XR , XN )
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 12"x 6'8" 12"x 6'8"
12"x 6'8" 12"x 6'8" 14"x 6'8" 14"x 6'8"
14"x 6'8" 14"x 6'8"

Privacy & Textured Glass Options XG = Geometric^ XJ = Chinchilla
XE = Satin Etch^^ XR = Rainglass
Add the code to the blank in the style number for the desired door and glass combination. XC = Chord XN = Granite

*Pairs with 3'6" wide doors.
^Geometric glass available in flush-glazed Classic-Craft doors and sidelites, as well as Fiber-Classic, Smooth-Star, Steel and Pulse doors and sidelites.
^^Satin Etch only available in Fiber-Classic, Smooth-Star, Steel and Pulse.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

EnLitenTM Flush-Glazed Privacy & Textured Glass Fiber-Classic® Smooth-Star®
Oak CollectionTM

2000XE 8000XE 2000XESL S1207 S2010 S4812 S84812 S4813 S84813
2000XC 8000XC 2000XCSL (XG, XE, XC , (XG, XE, XC , (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
2'0"x 6'8" 2'0"x 8'0" 12"x 6'8" XJ , XR , XJ , XR , XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'6"x 6'8" 2'6"x 8'0" 14"x 6'8" XN ) XN )
2'8"x 6'8" 2'8"x 8'0" 2'6"x 6'8" 2'6"x 6'8" 1 1 1 1
2'10"x 6'6" 2'10"x 8'0" 2'8"x 6'8" 2'8"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0"
3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

GG6G0

S4814 S84814 S4816 S84816 S2000 SL-2C S2000 SL-4C S4812 SL S84812 SL S5700 S85700
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC , (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ , XR , XJ, XR, XN)
10"x 6'8" 10"x 6'8" XN )
1 1 1 1 12"x 6'8" 12"x 6'8" 1 1 2
14"x 6'8" 14"x 6'8" 2
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 12"x 6'8" 12"x 8'0" 2'6"x 8'0"
2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 14"x 6'8" 14"x 8'0" 2'6"x 6'8" 2'8"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 2'8"x 6'8" 2'10"x 8'0"
2'10"x 6'8" 3'0"x 8'0"
3'0"x 6'8"

Privacy & Textured Glass Options XG = Geometric^ XJ = Chinchilla
XE = Satin Etch^^ XR = Rainglass
Add the code to the blank in the style number for the desired door and glass combination. XC = Chord XN = Granite

Key 2 Simulated Divided Lites (SDLF2)* Stock Optional Dentil Shelf
Standard Lead Time +1 Week
Flush-Glazed Glass (FG) Vented Sidelite Available for Craftsman-style doors.
Simulated Divided Lites (SDL)*
1 Simulated Divided Lites (SDLF1)* (6'6" & 6'8" only in 12" & 14") Smooth-Star® 4-Block*
(8'0" only in 14")

Right: Smooth-Star, Satin Etch Glass with SDLs, Door – S5710XE, Sidelite – S5710XESL, ©TheHouseDesigners.com
*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
^Geometric glass available in flush-glazed Classic-Craft doors and sidelites, as well as Fiber-Classic, Smooth-Star, Steel and Pulse doors and sidelites.
^^Satin Etch only available in Fiber-Classic, Smooth-Star, Steel and Pulse.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

S5710 S85710 S5720 S85720 S5700 SL S5710 SL S5720 SL S2000 S8000 EnLitenTM Flush-Glazed Privacy & Textured Glass
(XG, XE, XC , (XG, XE, XC, (XG, XE, XC , (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ , XR , XJ, XR, XN) XJ , XR , XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
XN ) XN )
2 2 2 2 2 2'0"x 6'8" 2'0"x 8'0"
2 2 2'6"x 6'8" 2'6"x 8'0"
2'6"x 8'0" 2'6"x 8'0" 10"x 6'8" 10"x 6'8" 10"x 6'8" 2'8"x 6'8" 2'8"x 8'0"
2'6"x 6'8" 2'8"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 12"x 6'8" 12"x 6'8" 12"x 6'8" 2'10"x 6'8" 2'10"x 8'0"
2'8"x 6'8" 2'10"x 8'0" 2'8"x 6'8" 2'10"x 8'0" 14"x 6'8" 14"x 6'8" 14"x 6'8" 3'0"x 6'8" (XG, 3'0"x 8'0" (XG,
2'10"x 6'8" 3'0"x 8'0" 2'10"x 6'8" 3'0"x 8'0" XE only) XE only)
3'0"x 6'8" 3'0"x 6'8"

6G1GG

S4810 S84810 S2000 SL S8000 SL S4810 SL S84810 SL
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, XJ, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
12"x 6'8" 12"x 8'0"
2'8"x 6'8" 2'8"x 8'0" 10"x 6'8" 12"x 8'0" 14"x 6'8" 14"x 8'0"
2'10"x 6'8" 2'10"x 8'0" 12"x 6'8" 14"x 8'0"
3'0"x 6'8" (XC only) 3'0"x 8'0" 14"x 6'8" (XG only)

Privacy & Textured Glass with Divided Lites Geometric (XG)^ Chinchilla (XJ)

Satin Etch (XE)^^ Rainglass (XR)

Chord (XC) Granite (XN)

Privacy & Textured Glass
with Divided Lites

62

Classic-Craft® Classic-Craft® Canvas Collection®
Oak CollectionTM

CC102 CC92 CC892 CCV10015 CCV05012 CCV805015 CCV822012 CCV820512
(XC, XJ, XR, XN) (XC, XJ, (XC, XJ, (XC, XJ, XR, XN) (XC, XJ, (XC, XJ, (XC, XJ, XR, XN) (XC, XJ, XR, XN)
3'0"x 6'8" XR, XN) XR, XN) 3'0"x 6'8" XR, XN) XR, XN) 3'0" x 8'0" 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0"

Key Stock Optional Dentil Shelves Privacy & Textured Glass Options
Standard Lead Time +1 Week
No Stile Lines Available for Craftsman-style doors. Add the code to the blank in the style number for
Simulated Divided Lites (SDL)* Fiber-Classic® Mahogany 4-Block* the desired door and glass combination.
Removable Wood Grilles (RG) Smooth-Star® 4-Block*
7'0" Height Available XG = Geometric^ XJ = Chinchilla

XE = Satin Etch^^ XR = Rainglass

XC = Chord XN = Granite

Fiber-Classic® Mahogany CollectionTM Fiber-Classic® Privacy & Textured Glass with Divided Lites
Oak CollectionTM

FCM138 FCM18 FCM65 FCM605 FCM606 FCM607 FCM608 FC138 FC18
(XG, XE, XC, (XG, XE, XC , (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC ,
XJ, XR, XN) XJ, XR , XN ) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR , XN )
2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'6"x 6'8" 2'6"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" ‡ 2'10"x 6'8" ‡
3'0"x 6'8" ‡ 3'0"x 6'8" ‡

Smooth-Star®

6G3GG

FC65 FC18 SL S128 S141 S108 S6063 S262 S605 S606
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'6"x 6'8" 10"x 6'8" 2'6"x 6'8" 2'8"x 6'8" ‡ 2'6"x 6'8" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8" 2'8"x 6'8"
2'8"x 6'8" ‡ 12"x 6'8" 2'8"x 6'8" ‡ 2'10"x 6'8" ‡ 2'8"x 6'8" ‡ 2'10"x 6'8" ‡ 2'10"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8"
2'10"x 6'8" ‡ 14"x 6'8" 2'10"x 6'8" ‡ 3'0"x 6'8" ‡ 2'10"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8"
3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'6"x 6'8" 3'0"x 6'8" ‡ 3'6"x 6'8"

Traditions Steel

S607 S608 S308 SL TS108 TS263 632 SL TS263 SL
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'8"x 6'8" 2'8"x 6'8" 12"x 6'8" 2'6"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 14"x 6'8" 2'8"x 6'8" ‡ 2'10"x 6'8" 10"x 6'8" 10"x 6'8"
3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 3'0"x 6'8" 12"x 6'8" ‡ 12"x 6'8"
3'0"x 6'8" ‡ 14"x 6'8" ‡ 14"x 6'8"

*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
^Geometric glass available in flush-glazed Classic-Craft doors and sidelites, as well as Fiber-Classic, Smooth-Star, Steel and Pulse doors and sidelites.
^^Satin Etch only available in Fiber-Classic, Smooth-Star, Steel and Pulse.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller or visit
www.thermatru.com for details on glass privacy ratings and glass designs.

Privacy & Textured Glass Geometric^ Satin Etch^^ Chord Chinchilla Rainglass Granite

Privacy Privacy Privacy Privacy Privacy Privacy
Rating: 7 Rating: 10 Rating: 10 Rating: 10 Rating: 8 Rating: 10

Privacy & Textured Glass

Each design enhances a home with privacy, peace of mind and the beauty

64 of textured glass while still allowing natural light to brighten the interior.

Classic-Craft® Classic-Craft® Rustic CollectionTM
Mahogany CollectionTM

CCM100 CCM200 CCM300 CCR30020 CCR04020 CCR804020 CCR20520 CCR820520 CCR20020 CCR820020
(XC , XJ, XR, XN) (XC, XJ, XR, XN) (XC, XJ, XR, XN) (XC, XJ, XR, XN) (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ,
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" XR, XN) XR, XN) XR, XN) XR, XN) XR, XN) XR, XN)
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

Key Stock Optional Dentil Shelf Privacy & Textured Glass Options
Standard Lead Time
No Stile Lines Available for Craftsman-style doors. Add the code to the blank in the style number for the
Vented Sidelite +1 Week Fiber-Classic® Mahogany 4-Block* desired door and glass combination.

(6'6" & 6'8" only in 12" & 14") XG = Geometric^ XJ = Chinchilla
(8'0" only in 14")
XE = Satin Etch^^ XR = Rainglass
7'0" Height Available
XC = Chord XN = Granite

Classic-Craft® Canvas Collection® Privacy & Textured Glass

CCR820530 CCR820030 CCV10020 CCV05020 CCV805020 CCV20520 CCV820520 CCV22020 CCV822020 CCV820530
(XC, XJ, XR, XN) (XC, XJ, XR, XN) (XC, XJ, XR, XN) (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, (XC, XJ, XR, XN)
3'0"x 8'0" 3'0"x 8'0" 3'0"x 6'8" XR, XN) XR, XN) XR, XN) XR, XN) XR, XN) XR, XN) 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

Fiber-Classic® Mahogany CollectionTM

6G5GG

FCM10 FCM870 FCM1283 FCM32 ) FCM62 FCM862 FCM6021 FCM6041 FCM104
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC , (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR , XN ) XJ, XR , XN XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'8"x 6'8" 2'8"x 8'0" 2'4"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'4"x 6'8"
2'10"x 6'8" 2'10"x 8'0" 2'6"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'6"x 6'8" ‡
3'0"x 6'8" 3'0"x 8'0" 2'8"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 2'8"x 6'8" ‡
2'10"x 6'8" ‡ 2'10"x 7'0"
3'0"x 6'8" ‡ 3'0"x 6'8" ‡

FCM601 FCM61 FCM12101 SL FCM81200 SL FCM32 SL FCM881 SL FCM62 SL FCM862 SL
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR , XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'8"x 6'8" 2'8"x 6'8" 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0"
2'10"x 6'8" 2'10"x 6'8" 10"x 6'8" 12"x 8'0" 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"
3'0"x 6'8" 3'0"x 6'8" 12"x 6'8" ‡ 14"x 8'0"
14"x 6'8" ‡

*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
^Geometric glass available in flush-glazed Classic-Craft doors and sidelites, as well as Fiber-Classic, Smooth-Star, Steel and Pulse doors and sidelites.
^^Satin Etch only available in Fiber-Classic, Smooth-Star, Steel and Pulse.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

Privacy & Textured Glass Fiber-Classic® Oak CollectionTM

1283 81200 FC10 FC766 81943P FC32 ) FC62 81929P
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR , XJ, XR, XN) XJ, XR , XN XJ, XR, XN) XJ, XR, XN)
2'4"x 6'8" 2'6"x 8'0" 2'6"x 6'8" XN ) 2'8"x 8'0" 2'8"x 6'8" 2'6" x 6'8" 2'8"x 8'0"
2'6"x 6'8" ‡ 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0"
2'8"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" ‡ 2'10"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'10"x 6'8" ‡ 3'0"x 8'0"
2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8" ‡
3'0"x 6'8" ‡

GG6G6

FC104 FC61 12101 SL 81200 SL FC47 SL FC32 SL 81943P SL FC48 SL 81929P SL
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR , XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'4"x 6'8" 2'6"x 6'8" ‡ 12"x 6'8" ‡ 12"x 8'0" 10"x 6'8" XN) 12"x 8'0" 12"x 6'8" 12"x 8'0"
2'6"x 6'8" ‡ 2'8"x 6'8" ‡ 14"x 6'8" ‡ 14"x 8'0" 12"x 6'8" 12"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"
2'8"x 6'8" ‡ 2'10"x 6'8" ‡ 14"x 6'8" 14"x 6'8"
2'10"x 6'8" ‡ 3'0"x 6'8" ‡
3'0"x 6'8" ‡

Smooth-Star®

S118 S140 S8140 S90 S880 S80 S206 S81929P S6021
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC , (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, XJ,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ , XR , XN ) XJ, XR, XN) XJ, XR, XN) XR, XN)
2'8"x 6'8" ‡ 2'4"x 6'8" 2'0"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'6"x 6'8" 2'8"x 8'0" 2'6"x 6'8"
2'10"x 6'8" ‡ 2'6"x 6'8" 2'6"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0" 2'8"x 6'8" ‡
3'0"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'10"x 6'8" ‡ 3'0"x 8'0" 2'10"x 6'8" ‡
2'10"x 6'8" ‡ 2'10"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡
3'0"x 6'8" ‡ 3'0"x 8'0"
3'6"x 6'8" 3'6"x 8'0"

Key Optional Dentil Shelf

No Stile Lines 7'0" Height Available Available for Craftsman-style doors.
Stock Smooth-Star® 4-Block*
Vented Sidelite Standard Lead Time +1 Week

(6'6" & 6'8" only in 12" & 14")
(8'0" only in 14")

Privacy & Textured Glass

S6041 S104 S601 S8600 S296 S601 SL S81086 SL S751 SL S880 SL S210 SL S85910 SL
(XG, XE, XC, XJ, (XG, XE, XC, XJ, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XR, XN) XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'8"x 6'8" 2'6"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'6"x 6'8" 10"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0"
2'10"x 6'8" 2'8"x 6'8" ‡ 2'10"x 6'8" 2'10"x 8'0" 2'8"x 6'8" ‡ 12"x 6'8" ‡ 14"x 8'0" 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"
3'0"x 6'8" 2'10"x 6'8" ‡ 3'0"x 6'8" 3'0"x 8'0" 2'10"x 6'8" ‡ 14"x 6'8" ‡
3'0"x 6'8" ‡ 3'0"x 6'8" ‡

ProfilesTM Steel Traditions Steel

118 206HD 100 SL 210SLHD TS118 TS206 TS104 TS296 100 SL TS210 SL 6G7GG
(XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC, (XG, XE, XC,
XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN) XJ, XR, XN)
2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 10"x 6'8" 12"x 6'8" ‡ 2'4"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 10"x 6'8" 12"x 6'8"
2'10"x 6'8" ‡ 2'10"x 6'8" ‡ 12"x 6'8" ‡ 14"x 6'8" ‡ 2'6"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 12"x 6'8" ‡ 14"x 6'8"
3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 14"x 6'8" ‡ 2'8"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 14"x 6'8" ‡
3'6"x 6'8" ‡ 2'10"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
3'0"x 6'8"

Privacy & Textured Glass Options XG = Geometric^ XJ = Chinchilla
XE = Satin Etch^^ XR = Rainglass
Add the code to the blank in the style number for the desired door and glass combination. XC = Chord XN = Granite

Above: Fiber-Classic Oak Collection, Chord Glass, Doors – 81943PXC
*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
^Geometric glass available in flush-glazed Classic-Craft doors and sidelites, as well as Fiber-Classic, Smooth-Star, Steel and Pulse doors and sidelites.
^^Satin Etch only available in Fiber-Classic, Smooth-Star, Steel and Pulse.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

Internal Blinds

Internal Blinds

A single-hand operator opens, closes and tilts the blinds to

68 control the desired level of privacy and light.

Fiber-Classic® Mahogany CollectionTM

FCM141 FCM8115 FCM1286 FCM81225 FCM5425 FCM678 FCM8678 FCM6035 FCM6055 FCM116 FCM1286SL
2'4"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'4"x 6'8" 10"x 6'8"
2'8"x 6'8" 2'8"x 8'0" 2'6"x 6'8" ‡ 2'6"x 8'0" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'6"x 6'8" ‡ 12"x 6'8" ‡
2'10"x 6'8" 2'10"x 8'0" 2'8"x 6'8" ‡ 2'8"x 8'0" 2'10"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 2'8"x 6'8" ‡ 14"x 6'8" ‡
3'0"x 6'8" 3'0"x 8'0" 2'10"x 6'8" ‡ 2'10"x 8'0" 3'0"x 6'8" 2'10"x 7'0"
3'0"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡

Key 7'0" Height Available
Stock
No Stile Lines
Low-E Glass (LE)

Vented Sidelite

(6'6" & 6'8" only in 12" & 14")
(8'0" only in 14")

Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass designs may differ from depiction due
to size and hand craftsmanship of glass. See your Therma-Tru seller or visit www.thermatru.com for details on glass designs.

Fiber-Classic® Oak CollectionTM Internal Blinds

FCM5425SL FCM678SL FCM8678SL FC141 81225P 1286 1964P 81964P FC5425
12"x 6'8" 12"x 6'8" 12"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8"
14"x 6'8" 14"x 6'8" 14"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 2'4"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8"
2'8"x 6'8" ‡ 2'10"x 8'0" 2'6"x 6'8" ‡ 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0" 2'8"x 6'8" ‡
3'0"x 6'8" ‡ 2'10"x 6'8" ‡
3'0"x 6'8" ‡

6G9GG

FC678 FC8678 FC116 FC8971 FC141SL 81225PSL 1286SL FC5425SL 81964PSL FC678SL FC8678SL
2'6"x 6'8" 2'8"x 8'0" 2'4"x 6'8" 2'8"x 8'0" 10"x 6'8" 12"x 8'0" 12"x 6'8" ‡ 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0"
2'8"x 6'8" ‡ 2'10"x 8'0" 2'6"x 6'8" ‡ 2'10"x 8'0" 12"x 6'8" 14"x 8'0" 14"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"
2'10"x 6'8" ‡ 3'0"x 8'0" 2'8"x 6'8" ‡ 3'0"x 8'0" 14"x 6'8"
3'0"x 6'8" ‡
2'10"x 6'8" ‡
3'0"x 6'8" ‡

Smooth-Star®

S130 S829 S682 S8682 S5425 S132 S8132 S6035
2'6"x 6'8" 2'8"x 6'8" 2'6" x 6'8"
2'8"x 6'8" ‡ 2'6"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'10"x 6'8" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡
2'10"x 6'8" ‡ 2'8"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 3'0"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" ‡
3'0"x 6'8" ‡ 2'10"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡
3'0"x 8'0" 3'0"x 6'8" ‡

Internal Blinds Smooth-Star® (cont.)

S6055 S131 S8971 S130SL S829SL S6128SL S5425SL S8682SL S132SL S8132SL
2'8"x 6'8" 2'6"x 6'8" 2'8"x 8'0" 12"x 6'8" 12"x 8'0" 10"x 6'8" 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0"
2'10"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0" 14"x 6'8" 14"x 8'0" 12"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0"
3'0"x 6'8" 2'10"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" ‡ 14"x 6'8" ‡

Traditions Steel

70 TS132 8132 130SL TS132SL
2'8"x 6'8" 2'8"x 8'0"
TS130 3'0"x 6'8" 2'10"x 8'0" 12"x 6'8" 12"x 6'8"
2'8"x 6'8" 3'0"x 8'0" 14"x 6'8" 14"x 6'8"
3'0"x 6'8"

EnLitenTM Flush-Glazed Low-E & Clear Glass

EnLitenTM Flush-Glazed 7G1GG

Low-E & Clear Glass

Classic-Craft® American Style CollectionTM

CCA220 CCA8220 CCA230 CCA8230 CCA240 CCA8240 CCA87400 CCA260 CCA8260 CCA3450SL CCA220SL
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'6"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 12"x 6'8" 12"x 6'8"
14"x 6'8" 14"x 6'8"

Key Vented Sidelite Optional Dentil Shelves

No Stile Lines (6'6" & 6'8" only in 12" & 14") Available for Craftsman-style doors.
Flush-Glazed Glass (FG) (8'0" only in 14") Classic-Craft American Style 4-Block
Low-E Glass (LE) Classic-Craft American Style 16-Block
Simulated Divided Lites (SDL) 7'0" Height Available
Stock

Left: Smooth-Star, Internal Blinds, Doors – S130, Transom – 19200T 4-Block Dentil Shelf*
*Pairs with 3'6" wide doors.

Note: Contact Distributor Representative for stock grid patterns. Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show

exterior side of door. Glass privacy ratings may be more or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand

craftsmanship of glass. See your Therma-Tru seller or visit www.thermatru.com for details on glass designs.

EnLitenTM Flush-Glazed Low-E & Clear Glass Classic-Craft® American Style CollectionTM (cont.) Classic-Craft® American Style CollectionTM
Shaker Doors

CCA210 CCA8210 CCA87100 CCA3400SL CCA3500SL CCA210SL CCA2300 CCA82300 CCA2310 CCA2300SL CCA82300SL
3'0"x 6'8" 3'0"x 8'0" 3'6"x 8'0"
12"x 6'8" 12"x 8'0" 12"x 6'8" 4 4 4 4 4
14"x 6'8" 14"x 8'0" 14"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 12"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 8'0"

Classic-Craft® Canvas Collection®

GG7G2

CCA2310SL CCA2400 CCA82400 CCA2400SL CCA82400SL CCV920 CCV930 CCV940 CCV960
3'0"x 6'8" 3'0"x 8'0" 12"x 6'8" 12"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
4 14"x 8'0"
14"x 6'8"
12"x 6'8"
14"x 6'8"

Fiber-Classic® Oak CollectionTM

CCV950SL CCV9020SL CCV910 CCV100SL CCV8100SL CCV9010SL 2010 FC1204 2050
12"x 6'8" 12"x 6'8" 3'0"x 6'8" 2'6" x 6'8" 2'6"x 6'8" 2'6" x 6'8"
14"x 6'8" 14"x 6'8" 12"x 6'8" 12"x 8'0" 12"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
14"x 6'8" 14"x 8'0" 14"x 6'8" 2'10"x 6'6" 2'10"x 6'6" 2'10"x 6'6"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"

Key Removable Wood Grilles (RG) Optional Dentil Shelves
Vented Sidelite
Flush-Glazed Glass (FG) Available for Craftsman-style doors.
Low-E Glass (LE) (6'6" & 6'8" only in 12" & 14")
Simulated Divided Lites (SDL)* (8'0" only in 14") Classic-Craft American Style 4-Block Classic-Craft Canvas 4-Block
1 Simulated Divided Lites (SDLF1)* Classic-Craft American Style 16-Block Smooth-Star® 4-Block*
2 Simulated Divided Lites (SDLF2)* Stock 4-Block Dentil Shelf**
4 Simulated Divided Lites (SDLF4)
Flat or Contour, White or Color Grilles Standard Lead Time +1 Week

Between Glass (GBGF / GBGC)

2150 FC5700 FC85700 FC5710 FC85710 FC5720 FC85720 FC5700SL FC5710SL FC5720SL EnLitenTM Flush-Glazed Low-E & Clear Glass
2'6"x 6'8" 2 2 2 2 2 2 2 2 2
2'8"x 6'8"
3'0"x 6'8" 2'6" x 6'8" 2'6"x 8'0" 2'6" x 6'8" 2'6"x 8'0" 2'6" x 6'8" 2'6"x 8'0" 12"x 6'8" 12"x 6'8" 12"x 6'8"
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 14"x 6'8" 14"x 6'8" 14"x 6'8"
2'10"x 6'6" 2'10"x 8'0" 2'10"x 6'6" 2'10"x 8'0" 2'10"x 6'6" 2'10"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

Smooth-Star®

7G3GG

2000 8000 2100 2000SL 2100SL S2010 S1204 S2050 S2150 S2010SL
2'0"x 6'8" 2'0"x 8'0" 2'6"x 6'8" 12"x 6'8" 12"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 10"x 6'8"
2'6"x 6'8" 2'6"x 8'0" 2'8"x 6'8" 14"x 6'8" 14"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 12"x 6'8"
2'8"x 6'8" 2'8"x 8'0" 3'0"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 3'0"x 6'8" 14"x 6'8"
2'10"x 6'6" 2'10"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
3'0"x 6'8" 3'0"x 8'0"

S4812 S84812 S4813 S84813 S4814 S84814 S4816 S84816 S4812SL S84812SL S5700 S85700
2 2
1 1 1 1 1 1 1 1 11
2'6"x 6'8" 2'6"x 8'0"
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 12"x 6'8" 12"x 8'0" 2'8"x 6'8" 2'8"x 8'0"
2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 14"x 6'8" 14"x 8'0" 2'10"x 6'8" 2'10"x 8'0"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
**Pairs with 3'6" wide doors.
Note: Contact Distributor Representative for stock grid patterns. Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show
exterior side of door. Glass privacy ratings may be more or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand
craftsmanship of glass. See your Therma-Tru seller or visit www.thermatru.com for details on glass privacy ratings and glass designs.

EnLitenTM Flush-Glazed Low-E & Clear BGlelalsaTMs Smooth-Star® (cont.)

S5710 S85710 S5720 S85720 S5730 S85730 S5700SL S85700SL S5710SL S85710SL S5720SL S85720SL
2 2 2 2 2 2 2 2 22 22

2'6"x 6'8" 2'6"x 8'0" 2'6"x 6'8" 2'6"x 8'0" 2'6"x 6'8" 2'6"x 8'0" 10"x 6'8" 12"x 8'0" 10"x 6'8" 12"x 8'0" 10"x 6'8" 12"x 8'0"
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 12"x 6'8" 14"x 8'0" 12"x 6'8" 14"x 8'0 12"x 6'8" 14"x 8'0
2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 14"x 6'8" 14"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0"

GG7G4

S2000 S8000 S2200 S82200 S2100 S4810 S84810 S2000SL S90SL S4810SL S84810SL
2'0"x 6'8" 2'0"x 8'0" 2'6"x 6'8" 2'6"x 8'0" 2'6"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 10"x 6'8" 12"x 6'8" 12"x 6'8" 12"x 8'0"
2'6"x 6'8" 2'6"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 12"x 6'8" 14"x 6'8" 14"x 6'8" 14"x 8'0"
2'8"x 6'8" 2'8"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 14"x 6'8"
2'10"x 6'8" 2'10"x 8'0" 3'0"x 6'8" 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0"

Key Vented Sidelite Optional Dentil Shelf
Flush-Glazed Glass (FG)
Low-E Glass (LE) (6'6" & 6'8" only in 12" & 14") Available for Craftsman-style doors.
2 Simulated Divided Lites (SDLF2)* (8'0" only in 14") Smooth-Star® 4-Block*

Stock

Right: Smooth-Star, Clear Glass with SDLs, Door – S85720
*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

EnLitenTM Flush-Glazed Low-E & Clear Glass 7G5GG

Clear Glass with Divided Lites

Clear Glass with Divided Lites
Enhance the beauty of any home with a variety of divided lite options for entry
and patio doors. Low-E glass is standard on all Classic-Craft® premium entryways.

GG7G6

Classic-Craft® Oak CollectionTM Classic-Craft® Canvas Collection®

CC102 CC92 CC892 CCV10015 CCV05012 CCV805015 CCV820512
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0"
3'0"x 6'8" 3'0"x 8'0"

Key Flat or Contour, White or Color Fixed Grilles (FXG) 7'0" Height Available
Grilles Between Glass (GBGF / Stock
No Stile Lines GBGC) Vented Sidelite
Low-E Glass (LE) Standard Lead Time +1 Week
Simulated Divided Lites (SDL)* Removable Wood Grilles (RG) (6'6" & 6'8" only in 12" & 14")
(8'0" only in 14")

*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

Fiber-Classic® Mahogany CollectionTM Clear Glass with Divided Lites

FCM138 FCM18 FCM81208P FCM82 FCM65 FCM6022 FCM6042 FCM8321
2'8" x 6'8" 2'8" x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0"
2'10" x 6'8" 2'10" x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0"
3'0" x 6'8" 3'0" x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0"

Fiber-Classic®
Oak CollectionTM

7G7GG

FCM752 FCM8752 FCM12102SL FCM92SL FCM8101SL FCM65SL FCM704 FCM8704 FC138 FC18
10"x 6'8" 12"x 6'8" 2'6"x 6'8" 2'6"x 6'8"
2'8"x 6'8" 2'8"x 8'0" 12"x 6'8" ‡ 14"x 6'8" 12"x 8'0" 12"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡
2'10"x 6'8" 2'10"x 8'0" 14"x 6'8" ‡ 14"x 8'0" 14"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" ‡ 2'10"x 6'8" ‡
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡

81208P FC82 FC92 81946P FC65 FC8321 FC752 FC8752
2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 8'0"
2'10"x 8'0" 2'10" x 6'8" 2'10" x 6'8" 2'10"x 8'0" 2'8"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" ‡ 2'10"x 8'0"
3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" ‡

Clear Glass with Divided Lites Fiber-Classic® Oak CollectionTM (cont.) Smooth-Star®

FC18SL 12102SL FC92SL 81946PSL FC63SL FC704 FC8704 S128 S108
10"x 6'8" 12"x 6'8" ‡ 12"x 6'8" 12"x 8'0" 12"x 6'8" 2'6"x 6'8" 2'6"x 6'8"
12"x 6'8" 14"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 14"x 6'8" 2'8"x 6'8" ‡ 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡
14"x 6'8" 2'10"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" ‡ 2'10"x 6'8" ‡
3'0"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡

78 S82 S92 S8310 S882 S6097 S262 S6022
2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 8'0" 2'8"x 6'8" ‡ 2'6"x 6'8" 2'6" x 6'8"
S808 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 8'0" 2'10"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8" ‡
2'6"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0" 3'0"x 6'8" ‡ 2'10"x 6'8" ‡ 2'10"x 6'8" ‡
2'8"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡
2'10"x 8'0"
3'0"x 8'0"

S6042 S8321 S752 S8752 S308SL S1170SL S82SL S881SL S263SL
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 8'0" 12"x 6'8" 10" x 6'8" 12"x 6'8" 12"x 8'0" 12"x 6'8"
2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" ‡ 2'10"x 8'0" 14"x 6'8" 12"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 14"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 8'0" 14"x 6'8" ‡

Key

No Stile Lines Flat or Contour, White or Color Fixed Grilles (FXG) 7'0" Height Available
Low-E Glass (LE) Grilles Between Glass (GBGF / Stock
Simulated Divided Lites (SDL)* GBGC) Vented Sidelite

Removable Wood Grilles (RG) (6'6" & 6'8" only in 12" & 14")
(8'0" only in 14")

Right: Smooth-Star, Clear Glass with SDLs, Door – S92, Transom – 19200T
*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller or visit
www.thermatru.com for details on glass privacy ratings and glass designs.

Traditions Steel Clear Glass with Divided Lites

TS128 TS108 808 TS262 8321 TS752 8752 TS255 632SL TS263SL
2'4"x 6'8" 2'4"x 6'8" 2'6"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8"
2'6"x 6'8" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 10"x 6'8" 10"x 6'8"
2'8"x 6'8" 2'8"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 12"x 6'8" ‡ 12"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 14"x 6'8" ‡ 14"x 6'8"
3'0"x 6'8" 3'0"x 6'8"

7G9GG

Low-E & Clear BGlelalsaTMs

Low-E & Clear Glass

More energy efficient than traditional clear glass, Low-E glass is standard on all

Classic-Craft® premium entryways and available as an option for other doors.

80

Classic-Craft® Mahogany CollectionTM Classic-Craft® Rustic CollectionTM

CCM200 CCM891 CCM300 CCM700 CCM800 CCR04020 CCR804020 CCR804030
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0"

Key Stock
No Stile Lines Standard Lead Time +1 Week
Low-E Glass (LE)
7'0" Height Available

Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller or visit
www.thermatru.com for details on glass privacy ratings and glass designs.

Classic-Craft® Oak CollectionTM Low-E & Clear Glass

CCR20520 CCR820520 CCR820530 CCR20020 CCR820020 CCR820030 CC100 CC90 CC890
3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0" 3'0"x 6'8"
3'0"x 6'8" 3'0"x 8'0"

Classic-Craft® Canvas Collection®

8G1GG

CC70 CC10 CCV10020 CCV05020 CCV805020 CCV20520 CCV820520 CCV22020 CCV822020 CCV820530
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0"

Fiber-Classic® Mahogany CollectionTM

FCM10 FCM870 FCM32 FCM62 FCM862 FCM6021 FCM670 FCM80 FCM160
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'4"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'6"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'8"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8"
2'10"x 6'8" ‡
3'0"x 6'8" ‡

Low-ED&ecCloreaatirvBeGlelalGlsaTaMsss Fiber-Classic® Mahogany CollectionTM (cont.) Fiber-Classic® Oak CollectionTM

FCM601 FCM132 FCM708 FCM8708 FCM12101SL FCM32SL FCM62SL FC10 81200P FC32
2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 10"x 6'8" 12"x 6'8" 12"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 12"x 6'8" ‡ 14"x 6'8" 14"x 6'8" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 14"x 6'8" ‡ 2'8"x 6'8" ‡ 2'10" x 8'0" 2'10" x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8"
3'0"x 6'8" ‡

GG8G2

FC766 81943P FC62 81929P FC670 FC710 FC160 FC789 FC132
2'8"x 6'8" 2'8"x 8'0" 2'4"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8"
2'10" x 6'8" 2'10"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 2'6"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8"
3'0"x 6'8" 3'0"x 8'0" 2'8"x 6'8" ‡ 2'10"x 8'0" 2'8"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0" 2'10"x 6'8" ‡
3'0"x 6'8" ‡ 3'0"x 6'8" ‡

Smooth-Star®

FC708 FC8708 FC47SL 81200PSL 12101SL FC32SL 81943PSL FC48SL 81929PSL S118 S818 S140
2'8"x 6'8" ‡ 12"x 6'8" ‡ 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 8'0" 2'6"x 6'8"
2'10"x 6'8" ‡ 2'8"x 8'0" 10"x 6'8" 12"x 8'0" 14"x 6'8" ‡ 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 8'0" 2'8"x 6'8" ‡ 2'6"x 8'0" 2'0"x 6'8"
3'0"x 6'8" ‡ 2'10" x 8'0" 12"x 6'8" 14"x 8'0" 2'10"x 6'8" ‡ 2'8"x 8'0" 2'6"x 6'8"
3'0"x 8'0" 14"x 6'8" 3'0"x 6'8" ‡ 2'10" x 8'0" 2'8"x 6'8" ‡
3'0"x 8'0" 2'10"x 6'8" ‡
3'0"x 6'8" ‡
3'6"x 6'8"

Key Vented Sidelite 7'0" Height Available Optional Dentil Shelves
Stock
No Stile Lines (6'6" & 6'8" only in 12" & 14") Available for Craftsman-style doors.
Low-E Glass (LE)
(8'0" only in 14") Fiber-Classic® Mahogany 4-Block* Smooth-Star® 4-Block*

*Not recommended for use behind storm doors or to be painted dark colors, if exposed to direct sunlight.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass privacy ratings may be more
or less than indicated, based on glass design and size of glass. Glass designs may differ from depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller
or visit www.thermatru.com for details on glass privacy ratings and glass designs.

Low-E & Clear Glass

S80 S90 S880 S206 S81929P S6021 S6041 S104 S770
2'8"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'6" x 6'8" 2'6" x 6'8" 2'6"x 6'8" 2'8"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'6"x 6'8" 2'8"x 8'0" 2'8"x 6'8" ‡ 2'8"x 6'8" 2'8"x 6'8" ‡ 2'10"x 6'8"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 2'8"x 6'8" ‡ 2'10" x 8'0" 2'10"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8" ‡ 3'0"x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 6'8" 3'0"x 6'8" ‡
3'0"x 6'8" ‡

8G3GG

S6080 S992 S601 S8601 S10 S708 S8708 S100SL S8601SL S601SL S751SL S880SL
2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 12"x 6'8" 12"x 8'0"
2'10"x 6'8" 2'10"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'10"x 6'8" 2'8"x 6'8" ‡ 2'8"x 8'0" 12"x 6'8" 12"x 8'0" 10"x 6'8" 14"x 6'8" 14"x 8'0"
3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 3'0"x 6'8" 2'10"x 6'8" ‡ 2'10"x 8'0" 14"x 6'8" 14"x 8'0" 12"x 6'8" ‡
3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" ‡ 3'0"x 8'0" 14"x 6'8" ‡

Traditions Steel

S210SL S85910SL TS118 TS206 TS289 TS708 TS256 TS296 100SL TS210SL
12"x 6'8" 12"x 8'0" 2'6"x 6'8" 2'6"x 6'8" 2'6"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'6"x 6'8"
14"x 6'8" 14"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'8"x 6'8" 10"x 6'8" 10"x 6'8"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 12"x 6'8" 12"x 6'8"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 14"x 6'8" 14"x 6'8"

Solid BPeallnaTeMl

Solid Panel

Classic-Craft®, Fiber-Classic®, Smooth-Star® & Steel

84

Classic-Craft® American Style Classic-Craft®
CollectionTM Shaker Doors Mahogany CollectionTM

CCA1100 CCA81100 CCA1145 CCA81145 CCM890 CCM60 CCM701 CCM801 CCM3400SL CCM8000SL
3'0"x 6'8" 3'0"x 8'0" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"
4 4 12"x 6'8" 12"x 8'0"
14"x 6'8" 14"x 8'0"
3'0"x 6'8" 3'0"x 8'0"

Key Optional Clavos & Strap Hinges

Flush-Glazed Glass (FG) 20-Minute Fire-Rated
Low-E Glass (LE) NOT Available Fire-Rated
4 Door Divider Bars (DDBF4) Stock

Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door. Glass designs may differ from depiction due
to size and hand craftsmanship of glass. See your Therma-Tru seller or visit www.thermatru.com for details on glass designs.

Classic-Craft® Rustic CollectionTM Solid Panel

Pair flush-glazed Pair flush-glazed
sidelites with sidelites with
solid-panel doors solid-panel doors
for natural light in for natural light in
the entry. the entry.

CCM3300SL CCM3500SL CCR205 CCR8205 CCR040 CCR200 CCR8200 CCR3400SL CCR8000SL
10"x 6'8" 12"x 6'8" CCRF205 CCRF8205 3'0"x 6'8" CCRF200 CCRF8200
12"x 6'8" 14"x 6'8” 3'0" x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 12"x 6'8" 12"x 8'0"
14"x 6'8" 3'6"x 8'0" 14"x 6'8" 14"x 8'0"

Classic-Craft® Oak CollectionTM

Pair flush-glazed 8G5GG
sidelites with
solid-panel doors
for natural light in
the entry.

CC91 CC40 CC11 CC60 CC860 CC2020SL CC8000SL CC2270SL CC1010SL
CCF91 3'6"x 6'8" 3'0"x 6'8" CCF060 3'6"x 8'0" 12"x 6'8" 12"x 8'0" 12"x 6'8" 12"x 6'8"
3'0"x 6'8" 2'8"x 6'8" 14"x 6'8" 14"x 8'0" 14"x 6'8" 14"x 6'8"
3'0"x 6'8"

Classic-Craft® Canvas Collection®

CCV400 CCV205 CCV8205 CCV220 CCV8220 CCV200 CCV060 CCVF8060 CCV050
CCVF400 CCVF205 CCVF8205 CCVF220 CCVF8220 CCVF200 CCVF060 3'0"x 8'0" CCVF050
3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8"

DecSoroliatidvBePeallGnlaTeaMlss Fiber-Classic® Mahogany CollectionTM

FCM31 FCM220 FCM205 FCM755 FCM600 FCM134 FCM60 FCM860 FCM1000 FCM81000
2'8"x 6'8" FMF220 2'8"x 6'8" 2'8"x 6'8" FMF600 FMF134 2'8"x 6'8" 2'8"x 8'0" FMF100 2'0"x 8'0"
2'10"x 6'8" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'8"x 6'8" 2'8"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'0"x 6'8" 2'4"x 8'0"
3'0"x 6'8" 2'10"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 2'4"x 6'8" 2'6"x 8'0"
3'0"x 6'8" FMF205 3'0"x 6'8" 3'0"x 6'8" FMF60 2'6"x 6'8" ‡ 2'8"x 8'0"
2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0"
2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" ‡

Fiber-Classic® Oak CollectionTM

GG8G6 FC809 FC862 FCF808 FC755 FC134 FC60* FC860 1000 81000
2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 6'8" 2'8"x 6'8" FCF160 2'8"x 8'0" FCF1000 2'0"x 8'0"
FC31 2'10"x 6'8" 2'10" x 8'0" 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8" 2'6"x 6'8" ‡ 2'10"x 8'0" 2'0"x 6'8" 2'4"x 8'0"
2'8"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8" 3'0"x 6'8" 2'8"x 6'8" ‡ 3'0"x 8'0" 2'4"x 6'8" 2'6"x 8'0"
2'10"x 6'8" 2'10"x 6'8" ‡ 2'6"x 6'8" ‡ 2'8"x 8'0"
3'0"x 6'8" 3'0"x 6'8" ‡ 2'8"x 6'8" ‡ 2'10"x 8'0"
2'10"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" ‡

Smooth-Star®

S93 S220* S8200 S1100 S81100 S120 S8120 S200 S897 S205 S8201
2'8"x 6'8" SSF220 SSF8200 SSF1100 SSF81100 SSF120 SSF8120 2'6"x 6'8" 2'8"x 8'0" SSF205 2'8"x 8'0"
2'10"x 6'8" 2'8"x 6'8" ‡ 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'10"x 8'0" 2'8"x 6'8" 2'10"x 8'0"
3'0"x 6'8" 2'10"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 3'0"x 8'0" 2'10"x 6'8" 3'0"x 8'0"
3'0"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 3'0"x 6'8"

Key NOT Available Fire-Rated
Stock
No Stile Lines
7'0" Height Available
20-Minute Fire-Rated

*Available with elevated 10" bottom rail.
Note: Finish colors may vary from an actual application due to fluctuations in finishing or printing. Product images show exterior side of door.

Solid Panel

S831 S960 S755 S4800 S84800 S600 S8600 S11 S210* S810
2'8"x 8'0" SSF960 2'8"x 6'8" SSF4800 SFS84800 SSF600 2'8"x 8'0" 2'8"x 6'8" SSF160 2'6"x 8'0"
2'10"x 8'0" 2'8"x 6'8" 2'10"x 6'8" 2'8"x 6'8" 2'8"x 8'0" 2'8"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 2'6"x 6'8" 2'8"x 8'0"
3'0"x 8'0" 2'10"x 6'8" 3'0"x 6'8" 2'10"x 6'8" 2'10"x 8'0" 2'10"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'8"x 6'8" ‡ 2'10"x 8'0"
3'0"x 6'8" 3'0"x 6'8" 3'0"x 8'0" 3'0"x 6'8" 2'10"x 6'8" ‡ 3'0"x 8'0"
3'0"x 6'8" ‡

Traditions Steel

8G7GG

S100 S81000 TS214 TS210 TS100
SSF100 2'0"x 8'0" 2'8"x 6'8" 2'6"x 6'8" 2'0"x 6'8"
2'0"x 6'8" 2'4"x 8'0" 2'10"x 6'8" 2'8"x 6'8" 2'4"x 6'8"
2'4"x 6'8" 2'6"x 8'0" 3'0"x 6'8" 2'10"x 6'8" 2'6"x 6'8"
2'6"x 6'8" 2'8"x 8'0" 3'0"x 6'8" 2'8"x 6'8"
2'8"x 6'8" ‡ 2'10"x 8'0" 2'10"x 6'8"
2'10"x 6'8" ‡ 3'0"x 8'0" 3'0"x 6'8"
3'0"x 6'8" ‡ 3'6"x 8'0"
3'6"x 6'8"

90-Minute Steel Edge

SE100 SE210HD SE514 SE978HD SE969HD
2'0"x 6'8" 2'6"x 6'8" 2'8"x 6'8" ‡ 2'8"x 6'8" ‡ 2'8"x 6'8"
2'4"x 6'8" 2'8"x 6'8" ‡ 2'10"x 6'8" 2'10"x 6'8" 2'10"x 6'8"
2'6"x 6'8" 2'10"x 6'8" 3'0"x 6'8" ‡ 3'0"x 6'8" ‡ 3'0"x 6'8"
2'8"x 6'8" ‡ 3'0"x 6'8" ‡
2'10"x 6'8"
3'0"x 6'8" ‡
3'6"x 6'8" ‡

Pulse®

Pulse
®

Clean lines. Crisp angles. Sleek designs. Vintage style. Fiberglass

It’s your decision, by design.

88

1 Start with a STYLE. 2 Choose a MATERIAL.

Combine doors & sidelites to create an entrance that fits your vision. Each style is available in any of these material choices.

Ari Línea Echo Wood-Grained Fiberglass: Smooth
Mahogany or Oak Fiberglass

(Shown in Autumn Harvest 4 Select a FRAME.
and Barley stains.)
Choose the flat profile for
3 Select a GLASS. modern appeal or scrolled
Find an available glass design to complete the statement you want to make. profile for vintage style.

Privacy & Textured Glass Decorative Glass
Available for all Pulse doors. Available for Línea.

Geometric Satin Etch Chord 12

Chinchilla Rainglass Granite 34 3 SaratogaTM Flat Profile
5 PembridgeTM Lite Frame
1 Blackstone® Scrolled Profile
2 Sedona Lite Frame

Low-E

Ari Línea Pulse®

FCM2
(XG, XE, XC, XJ, XR, XN)
FC2
(XG, XE, XC, XJ, XR, XN)
S2
(XG, XE, XC, XJ, XR, XN)

FCM1LBS FCM1BS FCM1RBS FCM1LSN FCM1SN FCM1RSN
FC1LBS FC1BS FC1RBS FC1LSN FC1SN FC1RSN
S1LBS S1BS S1RBS S1LSN S1SN S1RSN

FCM1LSG FCM1SG FCM1RSG FCM1LPB FCM1PB FCM1RPB FCM1L FCM1 FCM1R
FC1LSG FC1SG FC1RSG FC1LPB FC1PB FC1RPB (XG, XE, XC, XJ, (XG, XE, XC, XJ, (XG, XE, XC, XJ,
S1LSG S1SG S1RSG S1LPB S1PB S1RPB XR, XN, CL ) XR, XN, CL ) XR, XN, CL )
FC1L FC1 FC1R
Echo (XG, XE, XC, XJ, (XG, XE, XC, XJ, (XG, XE, XC, XJ, 8G9GG
XR, XN, CL ) XR, XN, CL ) XR, XN, CL )
S1L S1 S1R
(XG, XE, XC, XJ, (XG, XE, XC, XJ, (XG, XE, XC, XJ,
XR, XN, CL ) XR, XN, CL ) XR, XN, CL )

FCM5L FCM5 FCM5R Pulse® Size Options Mix and match door
(XG, XE, XC, XJ, (XG, XE , XC, XJ, (XG, XE , XC, XJ, and sidelite styles,
XR, XN) XR, XN) XR, XN) material choices and
FC5L FC5 FC5R glass designs to create
(XG, XE, XC, XJ, (XG, XE , XC, XJ, (XG, XE , XC, XJ, a modern entrance
XR, XN) XR XN) XR, XN) without missing a beat.
S5L S5 S5R
(XG, XE, XC, XJ, (XG, XE, XC, XJ, (XG, XE, XC, XJ,
XR, XN) XR, XN) XR, XN)

Wood-Grained Fiberglass Smooth Fiberglass

6'8" 8'0" 6'8" 8'0"

Contact us for stock availability Doors 2'6" x 6'8" 2'6" x 8'0" 2'6" x 6'8" 2'6" x 8'0"
on our Pulse Collection. 2'8" x 6'8" 2'8" x 8'0" 2'8" x 6'8" 2'8" x 8'0"
2'10" x 6'8" 2'10" x 8'0" 2'10" x 6'8" 2'10" x 8'0"
3'0" x 6'8" 3'0" x 8'0" 3'0" x 6'8" 3'0" x 8'0"
3'6" x 6'8" 3'6" x 8'0"

Available in Línea and Echo only.

Key Privacy & Textured Glass Options

Low-E Glass (LE) Brushed Nickel Caming (1C) Standard Lead Time +1 Week XG = Geometric XC = Chord XR = Rainglass CL = Clear
Black Nickel Caming (1D) Brass Caming (1A)
XE = Satin Etch XJ = Chinchilla XN = Granite

Note: Available door sizes and glass options may vary based on door style and material choice. Finish colors may vary from an actual application due to fluctuations in finishing or
printing. Product images show exterior side of door. Glass privacy ratings may be more or less than indicated, based on glass design and size of glass. Glass designs may differ from
depiction due to size and hand craftsmanship of glass. See your Therma-Tru seller or visit www.thermatru.com for details on glass privacy ratings and designs, limited warranties,
ENERGY STAR qualified products and to confirm available product sizes and options.

HingeDdecPoartiatoivDBeoellGolraTaMsss Hinged Patio Door Systems

8 1 9
4 7 1 Multi-Point Locking
1 System (Recommended)

10 2 Bottom Sweep
3 Sill
4 Hinges
5 Corner Seal Pads
(Inswing Only)
6 Sill Pan (Recommended)

9 7 Astragal
8 Frame Components

1 9 9 Multi-Point Locking
6 5 System (Included)

10 Removable Screens

23

90 A Therma-Tru® patio door with genuine Therma-Tru Vented Sidelites

components is a complete door system with doors, Enjoy the view – and a fresh breeze, too.
glass and components engineered to work together

for durability and reliability through the years. Constructed to provide ventilation without sliding screens

Patio Transoms blocking the view, vented sidelites work as small swinging
doors with convenient removable screens — available in

Transoms can be stained or painted to match a bronze and white.

Fiber-Classic® or Smooth-Star® door system. Engineered for durability and safety with wide patio
Available for 5'0", 5'4", 5'8" and 6'0" patio openings. mullions for strength, and multi-point locking gears

Note: Patio transoms are designed for a unit with a mullion. and recessed strike plates for security.

Available Configurations

19250T 19050T

Single Door with Double Doors with
Vented Sidelites Vented Sidelites (Inswing Only)
(Inswing Only)

Internal Blinds Hinged Patio Doors

Available Door Styles
Fiber-Classic® Mahogany / Fiber-Classic® Oak /
Smooth-Star® / ProfilesTM / Traditions
See previous product page for door styles and sizes.

4'8" (Can be used as a 5'0" replacement size)
5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

Available as Patio Unit Only 9G1GG

Low-E with Grilles Between Glass /
Low-E with Fixed Grilles*

Available Door Styles
Fiber-Classic® Mahogany / Fiber-Classic® Oak / Smooth-Star®
See previous product page for door styles and sizes.

4'8" (Can be used as a 5'0" replacement size)
5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

Available as Patio Unit Only
*4'8" is not available in Low-E with Fixed Grilles. NOTE: For patio transom availability, please contact your sales representative.

HingeDdecPoartiatoivDBeoellGolraTaMsss Low-E Glass

Available Door Styles
Fiber-Classic® Mahogany / Fiber-Classic® Oak / Smooth-Star®
See previous product page for door styles and sizes.

4'8" (Can be used as a 5'0" replacement size)
5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

92 Available as Patio Unit Only
EGnlaLssitewnitThM Flush-Glazed Low-E
Simulated Divided Lites

EnLitenTM Flush-Glazed Designs

Provides a clean, seamless look and superior
boundary against the elements, with glass
built directly into the door at the factory.
Available in Classic-Craft®, Fiber-Classic® Oak
and Smooth-Star®. Look for the ( ) icon.

Available Door Styles
Fiber-Classic® Oak / Smooth-Star®
See previous product page for door styles and sizes.

5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

Available as Patio Unit Only

GEnlaLssitwenithTM Flush-Glazed Low-E Hinged Patio Doors
Grilles Between Glass

Available Door Styles
Fiber-Classic® Oak / Smooth-Star®
See previous product page for door styles and sizes.

5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

9G3GG

Available as Patio Unit Only

Low-E Glass

Available Door Styles
Fiber-Classic® Oak / Smooth-Star®
See previous product page for door styles and sizes.

5'0"
5'4"
5'8" (Can be used as a 6'0" replacement size)
6'0"

Available Configurations

Available as Patio Unit Only

For white back ground_Gradated Full color

Best SellersSchlage® F Series Quick Ship ProBgrellaaTMm BBBBeeeesssstttStSSSeeeelllelleelrerrsrsss

otogcrkaimFnQQQgSuuuPeiiccirrciokkekgsSSSrhhQahiimppiupicSSSktttoooSccchkkkiiipinnnggPgrPPPorrgrooorggagrrmraaammm Styles shown in Satin Nickel but
are available in all 4 finishes

DECORATIVE ROSE HANDLESETS HANDLESETS
DDHEDEACENCOCDROOLARETRSAITEVAITEVSTERIORVSOEESEHRAHONADNSLDEELSEESHTHESATASNNDDLELSEETSS ETS HHAAHNANDNDLDELLSEEESTESSTES TS

F58 Addison Ext. F58 Wakefield Ext. F58 Camelot Ext. F58 Plymouth Ext. F58 Century Ext.
x F59 Accent Int. x F59 Sienna Int. x F59 Georgian Int. x F59 Plymouth Int. x F59 Latitude Int.
716 AgedABddroisnonzeBackplate 605 BrighWtaBkerfaieslds Backplate 619 Satin NCicamkeelot Backplate 716 Aged Bronze 619 Satin Nickel

7Ad176d1is6AongAxegdAecdBcerBnotrnLozenvezere 6W0a6k50ef5BielrBdigrxihgStiheBntnrBaarKsanssosb C6a169m1e9SloaSttxaintGienNoirNcgiikacenklKenl ob 7Pl1y76m16oAugAthegxdePdBlymrBoornuotznhezKenob C6e169n1tu9SryaStxainLtainNtitiNucdikecekLleevler
Brass 67A11d9A6ddSisAdoaisgntoiexnndAxNcABcicecrcnoketennLtlzeLveevrer WaWkae6k7fie1e19fl6ideSlxAdaSxgtieSeinnidennNanBKiacrnoKkonnebozlbe CaCmaemloetloxt6Gx1e9GoerSgoiraagtniainKnnKNonbiocbkel
PlyPmlyomuothutxh PxlyPmlyomuothutKhnKonbob CeCnetunrtyurxy LxaLtiatutidtuedLeeLvevr er
nnaobKnob
Century x Latitude Lever
GG9G4 DECORATIVE ROSE KEYED LOCKSDECORATIVE ROSE KEYED LEVERS & KNOBSCPalmymeloouttxh GxePolyrgmiaonutKhnKonbob
CPelynmtuoryutxh LxaPtiltyumdeouLtehvKernob KKKEEEKYYYEEEYEDDEDDLLOOLCCOLKKCESSKVSERS & KNOBS

DKEDECYEOCERDOARLTAOITVCIEKVSERORSOESEKEKYEEYDEDLOLCOKKCESKYSED LOCKS

7F1561 AAcgceedntBLreovnerze 6F0515 SBieringnhatKBnroabss 6F1591SGaetoinrgNiainckKenlob 71F651APgleymd oBurtohnKzneob F51 L6a1t9ituSdaetiLnevNeirckel
A7Ad1d76dd1isi6AsoongAnxegBdAeacdcBckerBpnotlranLotzeenvezere 6WW0a6ak50kefe5BiefilreBdilgdrxihgBStiahecBntknrBpaalrKasatnsesosb C6Ca169ma1me9SloeaStlotxaitntGBienNaocirNkcgpiikacleanktlKeenl ob 7Pl1y76m16oAugAthegdedBrBornozneze 6La16t9it1u9SdaeStaintinNiNcikceklel
Brass 6A71d19A6ddiSsdAoaisngtoxiennAdxNcAcBicecrcnoketnenLtlezLveevrer WaWkae6k7fie1e19fl6ideSlxAdaSxgtieSeinnidennNanBKiacrnoKkonnebozlbe CaCmaemloetloxt6Gx1e9GoerSgoiraagtniainKnnKNonbiocbkel
PlyPmlyomuothuth LaLtiatutidtuede
nnaobKnob Latitude
DECORATIVE ROSE DEADBOLTSCPalmymeloouttxh Georgian Knob LPaltyimtuodueth DEADBOLTS
DDEEDAAEDADBDOBBLOTOLSTLSTS
DDDEDEECAECOCDROBOAROTRALITTVASIEVTERIORVSOEESEDREDAOEDASBDOBELOTLDSTDSEEAADDBOBLTOS LTS

716 Aged Bronze 605 Bright Brass 619 Satin Nickel 716 Aged Bronze 619 Satin Nickel
717616AgAegdedBBrB6o0rnozneze 616919SaStaintinNiNcikceklel
Brass A7Bd1676d01is6AAondgAdegidseodBnrBDorenoazndezbeolt 6WB0a66k500ef5WBielraBdikgreihgfitheBltdrBarsasss C6a16B9m16e9S0loaStCtaaintminNeliNoctikceklel
6A71d19A6ddiSsdAoaisngtoienndNBicrokenlze WBaWakcae6kk7fie1ep19fl6lidaeSltAdeagDteiendaNdBbicrookltnezl e CaCBmaaemcloektloptl6a1t9e DSeaatdinboNltickel
S
CamKeEloYtLESS TOUCHSCREEN DEADBOLTS
KKEKEYEYLYELLSEESSSTOTSUOCUTHCOSHCSURCECREEHNENDSEDCAEDARBDEOBLOETLSNTS DEADBOLTS

Brass 716 Aged Bronze 605 Bright Brass 619 Satin Nickel 716 Aged Bronze 619 Satin Nickel
C6CC7C7a1CBaa1e19m7C6mm6Enaa1etm4eeS6muAlAo6llreooaeyt9gAgltttlooNieegtntXddEeNldeBBiccrrBtoorkornenonzlzinceezDeB 6CCaa06Cmma50eemCBC67Cll5BooeE1eee1tt9nlnr6n4Botitt6utguSruAr9irrhyagyNygtthXEeiBntlderBcNaBtrrsioacrsonskisneczlDeB 6Ca169m1e9SloaSttaintinNiNcikceklel C7e176n1tu6ArygAegdedBrBornozneze C6e169n1tu9SryaStaintinNiNcikceklel
CaCmaemloetlot619 Satin Nickel
Finish Options (not available in Bright Brass) CeCnetunrtyury CeCnetunrtyury
Century

Note: Seal-Rite can key your locks alike.
Contact for more information.

Matte Black Aged Bronze Satin Nickel Bright Brass

For white back ground_Gradated Full color Styles shown in stock finish Schlage® J Series Stock Options

BestSellers LEVER SETS

J Series Stock Options

HANDLESETS

J10 Lasalle Lever / JD60 Deadbolt
Satin Nickel

J10 Seville Lever / JD60 Deadbolt
Satin Nickel

J10 Torino Lever / JD60 Deadbolt 9G5GG
Satin Nickel
JH58 Barcelona JH58 Paris
Aged Bronze Satin Nickel Finish Options
J10 Seville Lever J10 Stratus Knob

KNOB SETS Aged Bronze

J10 Corona Knob / JD60 Deadbolt Satin Nickel
Satin Nickel
Bright Brass
J10 Stratus Knob / JD60 Deadbolt
Satin Nickel

Note: Schlage hardware is not covered under Therma-Tru’s warranty, visit www.sealritedoor.com/warranties for more information.
Finish colors may vary from an actual application due to fluctuations in finishing or printing.

Multi-Point Locking SysBtellmaTMs Multi-Point Locking Systems Side
view
Engages the door and frame at three critical points from top to bottom for of door.

enhanced stability compared to traditional deadbolt assemblies. Features

premium stainless steel construction that resists corrosion.

Lever-Style MPLS

Lever-style handlesets bring form and function together with

decorative styles. Engage three points with a convenient upward 1
turn of the handle. 2
3
Grip-Style MPLS
Engages at
New grip-style handlesets offer an intuitive approach with three critical
points.
on-trend aesthetics. Simply use the thumbturn (interior) or 1 Self-lubricating locks.
Interior view
a key (exterior) to engage the door frame at three points. 2 1 " premium stainless of door.
steel deadbolt.
Finish Options
(Highly recommended for 8'0" and double fiberglass 3 Integrated mishandling
doors. Strike plate package available. Not recommended device.
for steel doors.)

Handleset Options Not Available for Double Doors

GG9G6

Interior Interior Bright Antique Brushed
Forte Prospect Brass^ Brass^ Nickel

Heirloom Venture Millennium

Backplates: Wide / Narrow; Locking: Active / Inactive (Not Shown)

Hinges & Strike Plate Black Polished Oil-Rubbed
Nickel Chrome^ Bronze

n = Available Hinges
• = Not Applicable
Adjustable
Classic-
Craft®
Ball-
Bearing
Self-
Aligning
Ball-
Bearing
Self-
Aligning
Self-
Aligning
NRP

(Non-Removable
Pin)

Security
Tab
Spring-
Loaded
Adjustable
Security
Strike
Plate

(For Latch &
Deadbolt)

Hinge Finish
Options

Bright Brass n n n • • • • •

Antique Brass n n n • • • • n

Brushed Nickel n n n n n n n n

Black Nickel n n n • n • n n

Polished Chrome n n n • n • n n

Oil-Rubbed Bronze n n n n n • n n

Stainless Steel • n n • n n n n

Zinc Dichromate • n n n n n n n

Hinges position the door to properly compress the weatherstrip and help ensure smooth operation. Features options to suit various applications and mate with
mortise pockets machined into our doors. Adjustable security strike plate wraps around the jamb and engages the frame for added support and strength, and
resistance against forced entry.

•  Is a 12 mil rigid PVC film bonded •  Two Finishes: Available in UV Frame Options
with permanent waterproof exterior resistant white and embossed tan.
polyurethane glue to the Dura-Frame™
substrate system. Dura-Tech™ White

•  Durable: Thick, rigid, impact-resistant
PVC finish. Permanent waterproof
adhesive.

Dura-Tech™ Finishes:

Woodgrain UV Resistant Dura-Tech™ Wood Grain Stain
Can be stained or painted with White Stipple Finish
the Seal-Rite Finishing System Can be painted

•  Made of Alaskan Yellow Cypress wood, •  End-sealed with DURA-SEAL™, and 9G7GG
one of the planet’s most durable rot- primer coated with DURA-PRIME™ for
resistant woods. exceptional value and rot-free perfor-
mance.
•  Finger jointed to the bottom of a
premium pine frame component. •  Can be cladded to match exterior trim
and protect the jamb from weather
elements. Dura-Frame™

Premium Frontline® The perfect complement for your maintenance-
Deluxe Clad free entry doors. Recognized for its ease of ap-
plication, we offer five nosing profiles in twelve
Note: White and Sandstone are stocked. colors. This attractive .062 extruded aluminum,
Additional colors available by special order. known as the “Classic Clad” entry system, is
designed for new or existing construction.

The “Classic Clad” product does not have
any exposed fasteners, does not require any
painting, will not dent or wave like roll formed
material and is more durable than vinyl.

Coil Clad Door Jambs • Aluminum trim coil with a PVC coating.

• Protects exterior door jamb from weather.

• Available in 10 stock colors.

• Less maintenance than a painted
or stained wood jamb.

^Not available for Forte and Prospect handlesets.
Note: Dura-TechTM, Dura-FrameTM, Dura-Seal ,TM Frontline® and Schlage hardware are not covered under Therma-Tru’s warranty. See www.sealritedoor.com/warranties for
warranty information. Larson is not covered under Therma-Tru's warranty, visit www.larsondoors.com and www.sealritedoor.com/warranties for more information. Finish
colors may vary from an actual application due to fluctuations in finishing or printing. Color matching is available when samples are submitted at time of order.

Storm Doors Easy Vent® Selection QSTOQuCKiuIcNGikcPRkSOhGSRiAhpMip
Easy Vent® Selection STOCKING PROGRAM

1 C1hCoohoseosyeouyroudrodoor or • 1-7/8" thick aluminum frame
• Ov•er1la-p7p/8in"gthfriacmk aelusmeainlsuomutfrwameaether
Low • Do•ubOlevewrleaaptphienrgstfrriapmpiengseals out weather
• Sc•reeDnouAbwleayw®eraetthraecrstatrbiplepisncgreen with
E ELowGLASS
GLASS Ea•sySVcerenet®nbAawlaanyc®edretwraincdtaobwlessycsrteeemn with
• Two EcalossyeVr esnyst®tebma:labnoctetodmwicnldoosewr system
146-FV 146-FVE 146-MV 146-HV
fea•tuTrewsoHcololdseOrpseynstbemut:tobnottom closer
• BottofemateuxrepsanHdoeldr aOdpjuesntsbtuottuonneven sills
• De•sigBnoetrtosmcreewxpcaonvdeerrsacdojunsctesatloexutneerivoern sills

mo•unDteinsgigsncerreswcsrew covers conceal exterior
• REVEmRoSuAn-tHinIgNsGcErefworsright or left mounts

• REVERSA-HINGE for right or left mounts

INSTALLATION

Clear1G4l6a-sFs V High1P4e6rf-oFrmVaEnce Low-E Midv1ie4w6-MV Highv1i4ew6-HV INSTALLATION

H IndCicleaater sGFlausllsview CoHloirgshInPeSrtfoocrkm*ance Low-E MiMdvidievwiewColors In StoHcikghview Highview Colors In Stock
Highview Colors In Stock
H Indicates Fullview Colors In Stock* Midview Colors In Stock

HHH HHH HH H H HH

*Low-EHavailabHle WhiteHonly H H H 2 2H H H H HH

*Low-E available White only Choose your handle
Choose your handleHANDLE SET
HANDLE SET

Elegant Selection™
Elegant Selection™
Brushed Brass Aged Antique White Sandstone Brown
98 1 C1hCoohoseosyeouyroudrodoor or
NickelBrushed Brass BronzAeged BrassAntique White Sandstone Brown
Nickel Bronze Brass

Low • 1-5/8" thick aluminum frame
• Ov•er1la-p5p/8in"gthfriacmk aelusmeainlsuomutfrwameaether
E ELowGLASS • Do•ubOlevewrleaaptphienrgstfrriapmpiengseals out weather
GLASS • Inte•rcDhoaunbgleeawbeleatshcerresetnripinpcinlugded for

149-FV 149-FVE 149-BV sea•sIonntearlcvheanntiglaetaiobnle screen included for
Clear1G4l9a-sFsV Low-1E4G9l-aFssVE Doub1le49B-eBveVl • Two saedajussotnaabllev-esnptielaetdionclosers
H IndiCclaetaersGCloaslosrs In StLoocwk -E Glass Double Bevel • Bo•ttoTmwoexapdajunsdtearblaed-sjupsetsedtoculonseevresn sills
• De•sigBnoetrtosmcreewxpcaonvdeerrsacdojunsctesatloexutneerivoern sills

mo•unDteinsgigsncerreswcsrew covers conceal exterior
• Matcmhionugnitnintegrioscr raenwdsexterior handles

wit•h Mbuaitltc-hinindgeiandtebroioltr laoncdk exterior handles
• REVEwRitShAb-uHilItN-iGn Edefoardbrigohlttloocrkleft mounts

• REVERSA-HINGE for right or left mounts

INSTALLATION

INSTALLATION

H Indicates Colors In Stock

H H HH
H H HH

Low Fullview with Bottom Vent Wood Core Retractable Screen
• C1bRu1BBn-oEoroa1ue•••F••ttnVdt/tsvuov4oEjB1B1bCuheulem"mlRne-onvorsona1utdeiStttneihdpsta/eestvoAvo4wiiNjbahnxecluelm"m-spneltnkiseHnwc,tedat-ihkapseIaeeilnsNteiilNabanxhclupdllGssnpltkmieeecB,lyeeaEer-ka-eoivlnsndtealateoupdutldsrcom-eemljyrelumeroe-ivnsdtmasfeortuVedasrc-omerjmrlutvnoeosetemsfrteasormtvoee • MDuaW•rganDoTeoeutdcricahCT™woeeorceavhteR™hreeostrvroaselictrdrtispacobolliredeSccorreeen
E ELowGLASS • • METAL-TECH
GLASS • •3R•6EaS10lV-tl--e1E1m3RM•e/6R46lEa1eE0S"klV-tlT--Aa1itEc1Amhl/k6RSL4ifcepr-SC"aktTaAaRmtEnhlESeCeifcrElCHakNRmEeEN
• • B2tooau••tdtnojMBtueomosvautetgaetnnonbxemeplsevtiael-ilcenssnxpdwpseeeiaerllansdctdhoceenlrorfocssreotmrrnispsforms WEA•RSTtUeeFlFk™ickpanel
360-NV • • 3R•••7EDsF50olVue-hlE5rix3RW••dai0RGn7EDsT5Ecg0SuoVeuAo-eAahlEc5riRrdraihs0eRnSdTy™TcgSC™esUoeARotccreFvEhseSlmFoey™EC™srsNReotervEmeErN
360-NV •
• SRleeEvce••VurES2lserReevaaScenLdurAdojsur-cesbHaktunLIa®NidobltwGc-lbeikinEt-uh®silloptwm-ceiinatkehtdlcomhccilaknotgscehrisng • FlexGuard closer™
• INSTALLATION

• REVERSA-HINGE • REVERSA-HINGE

H Indicates Colors In Stock 360-16 370-50

H H HH Indicates Colors In Stock 830-80 H Indicates Colors In Stock Color3s6In0-S1t6ock 370-50
INSTALLATION 883300--8888523300--8802
H HH Indicates Colors In Stock H CoHlors In StocHk
HH H 830-85 INSTALLATION
INSTALLATION HH H

HH INSTALLATION INSTALLATION

Note: Larson is not covered under Therma-Tru's warranty, visit www.larsondoors.com and www.sealritedoor.com/warranties for more information.
Finish colors may vary from an actual application due to fluctuations in finishing or printing.

InInsswwininggDDooorrSSyysstetemm PPaatitoioDDooorsrs--GGrarainineedd&&SSmmoooththFFibibeergrglalasss Dimensional Data

DeDsecsrcipritpiotinon SiSzieze AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng BrBicrikckOpOepneinigng ReRpelpalcaecmemenetnHt eHiegihgth6t '66'"6"

SiSnignlgeleDoDooroUr nUint it 2'20'"0" 25251/12/"2"X X81815/58/"8" 26261/14/"4"X X828"2" 28281/14/"4"X X838"3" DeDsecsrcipritpiotinon UnUint iWt Widitdhth AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng BrBicrikckOpOepneinigng
(P(aPnaenleSl iSziez)e)
2'26'"6" 31311/12/"2"X X81815/58/"8" 32321/14/"4"X X828"2" 34341/14/"4"X X838"3" TwTwo oPaPnaenlel 5'50'"0"(2('26'"6)") 65651/14/"4"X X80803/34/"4"
(w(w/ m/ mululilolino)n) 5'58'"8"(2('21'01"0)") 73731/14/"4"X X80803/34/"4"
2'28'"8" 33331/12/"2"X X81815/58/"8" 34341/14/"4"X X828"2" 36361/14/"4"X X838"3" InIsnwswinigng 6'60'"0"(3('30'"0)") 62621/12/"2"X X79791/14/"4" 63631/14/"4"X X79793/34/"4" 77771/14/"4"X X80803/34/"4"
5'50'"0"(2('26'"6)") 70701/12/"2"X X79791/14/"4" 71711/14/"4"X X79793/34/"4" 65653/34/"4"X X80801/14/"4"
2'21'01"0" 35351/12/"2"X X81815/58/"8" 36361/14/"4"X X828"2" 38381/14/"4"X X838"3" TwTwo oPaPnaenlel 5'58'"8"(2('21'01"0)") 74741/12/"2"X X79791/14/"4" 75751/14/"4"X X79793/34/"4" 73733/34/"4"X X80801/14/"4"
(w(w/ m/ mululilolino)n) 6'60'"0"(3('30'"0)") 62621/12/"2"X X78785/58/"8" 77773/34/"4"X X80801/14/"4"
3'30'"0" 37371/12/"2"X X81815/58/"8" 38381/14/"4"X X828"2" 40401/14/"4"X X838"3" OuOtustwswinigng 5'50'"0"(2('26'"6)") 70701/12/"2"X X78785/58/"8" 63631/14/"4"X X797"9"
5'58'"8"(2('21'01"0)") 74741/12/"2"X X78785/58/"8" 71711/14/"4"X X797"9" 656"5"X X80803/34/"4"
3'36'"6" 43431/12/"2"X X81815/58/"8" 44441/14/"4"X X828"2" 46461/14/"4"X X838"3" TwTwo oPaPnaenlel 6'60'"0"(3('30'"0)") 62621/14/"4"X X79791/14/"4" 75751/14/"4"X X797"9" 737"3"X X80803/34/"4"
(w(/wa/satsratrgaagl)al) 70701/14/"4"X X79791/14/"4" 636"3"X X79793/34/"4" 777"7"X X80803/34/"4"
DoDuobulbeleDoDooroUr nUint it 5'50'"0" 62621/14/"4"X X81815/58/"8" 636"3"X X828"2" 656"5"X X838"3" InIsnwswinigng 74741/14/"4"X X79791/14/"4" 717"1"X X79793/34/"4" 65651/12/"2"X X80801/14/"4"
757"5"X X79793/34/"4" 73731/12/"2"X X80801/14/"4"
5'54'"4" 66661/14/"4"X X81815/58/"8" 676"7"X X828"2" 696"9"X X838"3" 77771/12/"2"X X80801/14/"4"

6'60'"0" 74741/14/"4"X X81815/58/"8" 757"5"X X828"2" 777"7"X X838"3" BrBicrikckOpOepneinigng

DDooorrwwitihthEExxaaccttSSizizeeoorrBBooxxeeddSSidideeliltiete(s(s) )SSyysstetemm––InInsswwiningg 65651/14/"4"X X838"3"
73731/14/"4"X X838"3"
DeDsecsrcipritpiotinon SiSzieze AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng BrBicrikckOpOepneinigng TwTwo oPaPnaenlel 5'50'"0"(2('26'"6)") 62621/14/"4"X X78785/58/"8" 636"3"X X797"9" 77771/14/"4"X X838"3"
49493/34/"4"X X838"3" (w(/wa/satsratrgaagl)al) 5'58'"8"(2('21'01"0)") 70701/14/"4"X X78785/58/"8" 717"1"X X797"9" 65653/34/"4"X X82823/34/"4"
WW/(1/()11) 21"2"SiSdiedleitleite 2'28'"8" 474"7"X X81815/58/"8" 47473/34/"4"X X828"2" 53533/34/"4"X X838"3" OuOtustwswinigng 73733/34/"4"X X82823/34/"4"
51513/34/"4"X X838"3" 77773/34/"4"X X82823/34/"4"
3'30'"0" 515"1"X X81815/58/"8" 51513/34/"4"X X828"2" 55553/34/"4"X X838"3"
63631/14/"4"X X838"3" 656"5"X X838"3"
WW/(1/()11) 41"4"SiSdiedleitleite 2'28'"8" 494"9"X X81815/58/"8" 49493/34/"4"X X828"2" 67671/14/"4"X X838"3" 6'60'"0"(3('30'"0)") 74741/14/"4"X X78785/58/"8" 757"5"X X797"9" 737"3"X X838"3"
67671/14/"4"X X838"3" 777"7"X X838"3"
3'30'"0" 535"3"X X81815/58/"8" 53533/34/"4"X X828"2" 71711/14/"4"X X838"3" PPaatitoioDDooorsrs--GGrarainineedd&&SSmmoooththFFibibeergrglalasss 66661/12/"2"X X82823/34/"4"
73731/12/"2"X X82823/34/"4"
WW/(2/()21) 21"2"SiSdiedleitleite 2'28'"8" 60601/12/"2"X X81815/58/"8" 61611/14/"4"X X828"2" FuFlul lHl eHiegihgth6t '68'"8" 77771/12/"2"X X82823/34/"4"

3'30'"0" 64641/12/"2"X X81815/58/"8" 65651/14/"4"X X828"2" DeDsecsrcipritpiotinon UnUint iWt Widitdhth AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng
(P(aPnaenleSl iSziez)e)
WW/(2/()21) 41"4"SiSdiedleitleite 2'28'"8" 64641/12/"2"X X81815/58/"8" 65651/14/"4"X X828"2" TwTwo oPaPnaenlel 5'50'"0"(2('26'"6)")
(w(w/ m/ mululilolino)n) 5'58'"8"(2('21'01"0)")
3'30'"0" 68681/12/"2"X X81815/58/"8" 69691/14/"4"X X828"2" InIsnwswinigng 6'60'"0"(3('30'"0)") 62621/12/"2"X X81815/58/"8" 63631/14/"4"X X828"2"
5'50'"0"(2('26'"6)") 70701/12/"2"X X81815/58/"8" 71711/14/"4"X X828"2"
DDooorr&&SSidideeliltiete(s(s) )wwitihthCCoonntitninuuoouussSSysystetemm--InInsswwiningg TwTwo oPaPnaenlel 5'58'"8"(2('21'01"0)") 74741/12/"2"X X81815/58/"8" 75751/14/"4"X X828"2"
(w(w/ m/ mululilolino)n) 6'60'"0"(3('30'"0)") 63631/14/"4"X X81811/12/"2"
DeDsecsrcipritpiotinon SiSzieze AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng BrBicrikckOpOepneinigng OuOtustwswinigng 5'50'"0"(2('26'"6)") 62621/12/"2"X X818"1" 71711/14/"4"X X81811/12/"2"
51511/14/"4"X X828"2" 53531/14/"4"X X838"3" 5'58'"8"(2('21'01"0)") 70701/12/"2"X X818"1" 75751/14/"4"X X81811/12/"2"
WW/(1/()11) 21"2"SiSdiedleitleite 3'30'"0" 50501/12/"2"X X81815/58/"8" 53531/14/"4"X X828"2" 55551/14/"4"X X838"3" TwTwo oPaPnaenlel 6'60'"0"(3('30'"0)") 74741/12/"2"X X818"1"
64641/14/"4"X X828"2" 66661/14/"4"X X838"3" (w(/wa/satsratrgaagl)al) 62621/14/"4"X X81815/58/"8" 636"3"X X828"2"
WW/(1/()11) 41"4"SiSdiedleitleite 3'30'"0" 52521/12/"2"X X81815/58/"8" 68681/14/"4"X X828"2" 70701/14/"4"X X838"3" InIsnwswinigng 70701/14/"4"X X81815/58/"8" 717"1"X X828"2" 99
74741/14/"4"X X81815/58/"8" 757"5"X X828"2"
WW/(2/()21) 21"2"SiSdiedleitleite 3'30'"0" 63631/12/"2"X X81815/58/"8"

WW/(2/()21) 41"4"SiSdiedleitleite 3'30'"0" 67671/12/"2"X X81815/58/"8"

EEigighht tFFooot tDDooor rSSyysstetemm--InInsswwiningg

DeDsecsrcipritpiotinon SiSzieze AcAtcutaulaUl nUint iSt iSzieze RoRuoguhghOpOepneinigng BrBicrikckOpOepneinigng TwTwo oPaPnaenlel 5'50'"0"(2('26'"6)") 62621/14/"4"X X818"1" 636"3"X X81811/12/"2"
(w(/wa/satsratrgaagl)al) 5'58'"8"(2('21'01"0)") 70701/14/"4"X X818"1" 717"1"X X81811/12/"2"
SiSnignlgeleDoDooroUr nUint it 2'20'"0" 25251/12/"2"X X97975/58/"8" 26261/14/"4"X X989"8" 28281/14/"4"X X999"9" OuOtustwswinigng

2'26'"6" 31311/12/"2"X X97975/58/"8" 32321/14/"4"X X989"8" 34341/14/"4"X X999"9" 6'60'"0"(3('30'"0)") 74741/14/"4"X X818"1" 757"5"X X81811/12/"2"

2'28'"8" 33331/12/"2"X X97975/58/"8" 34341/14/"4"X X989"8" 36361/14/"4"X X999"9"

2'21'01"0" 35351/12/"2"X X97975/58/"8" 36361/14/"4"X X989"8" 38381/14/"4"X X999"9" SStotormrmDDooorrDDimimeennssioionnaal lDDaatata--8822RROOHHeeigighht t

3'30'"0" 37371/12/"2"X X97975/58/"8" 38381/14/"4"X X989"8" 40401/14/"4"X X999"9" DEnEtiWnrmytWirdyDitdheoDtohonrorsioStSnoWtromWairdmitlUdhtnUDhint itatSatSoHtrNoeHmriemgoUihgntUhtintteit s:MMININ-M-MAXAXWWiditdhth MMININ-M-MAXAXHeHiegihgtht

3'36'"6" 43431/12/"2"X X97975/58/"8" 44441/14/"4"X X989"8" 46461/14/"4"X X999"9" •  U2'2s0'"0e" of Pub2l42ic"4"Access808"(0A" DA)2s32i33ll/3s4/"4w"- 2-il42l43c/34a/"4u"se797u93n/34/i"4t"-h8-e08i03g/34h/"4t"s to be
72'/268'"6"" less th3a03"0n" stated8.08"0" 29293/34/"4"- 3-0303/34/"4" 79793/34/"4"- 8-0803/34/"4"
DoDuobulbeleDoDooroUr nUint it 5'50'"0" 62621/14/"4"X X97975/58/"8" 636"3"X X989"8" 656"5"X X999"9"
2'28'"8" 323"2" 808"0" 31313/34/"4"- 3-2323/34/"4" 79793/34/"4"- 8-0803/34/"4"
5'54'"4" 66661/14/"4"X X97975/58/"8" 676"7"X X989"8" 696"9"X X999"9"
•  U2'21n'01"i0t"s using343D"4"uraTech808"j0a"mbs333c33o/34u/"4l"d- 3-a434d3/34d/"4"ap7p979r3o/34/x"4i"m- 8-0a803t/e34/l"4y" 1/32"
6'60'"0" 74741/14/"4"X X97975/58/"8" 757"5"X X989"8" 777"7"X X999"9" p3'e30'"r0"jamb le3g63"6t"o the u8n08"i0t"'s ov3e53r53a/34l/l"4"w- 3-i6d363t/h34/."4" 79793/34/"4"- 8-0803/34/"4"

NoNtoet:e:OuOtustwswinignghehiegihgtht 979"7" 97971/12/"2" 98983/34/"4" •  O3'36u'"6t"swing u42n4"2it"s will b8e08"05" /8" s41h413o/34r/"t4e"-r4-2t4h23a/34/n"4"st7a97t93e/34d/"4."- 8-0803/34/"4"
didmimenesnisoinosns
• For vented sidelite units, please add 1/4" per sidelite to the width
TTrarannsosommss of the unit measures above.

TrTarnasnosmomfinfiinsihsehsesanadndbrbicrikcmkmouoludldavaavialailbalbeletotommatacthchdodoorofrrafrmamesesininprpimrimededpipnieneoropr rpermemiuimum
wwooodo.d.AlAl ltlratrnasnosmoms saraere13131/12/"2"ininhehiegihgthet xecxecpetpht ahlaf lrforuonudnsd.s.

Entry Handing (View from Outside Home)

Outswing Inswing

LH RH LH RH

2233

www.thermatru.com

Turn a vision into a reality.

Try different fiberglass door and glass
combinations on your home with the
DoorWaysTM App from Therma-Tru.

Burnsville Hebron Lansing Rockford

12301 Dupont Ave. South 1120 O'Neill Dr. 4624 Creyts Rd. 5960 Falcon Rd.
Burnsville, MN 55337 Hebron, OH 43025 Lansing, MI 48917 Rockford, IL 61109
888-982-2470 800-477-7471 866-608-9020 866-892-7800

www.sealritedoor.com

Top: Fiber-Classic Oak Collection, Maple Park Glass, Door – FC777, Sidelite – FC900SL
©2018 Therma-Tru Corp. All rights reserved. THERMA-TRU and the Therma-Tru Logo are trademarks of Therma-Tru Corp. Registered trademarks are registered in the
U.S. and may be registered internationally. All trademarks are property of their respective owners. Therma-Tru Corp. is an operating company of Fortune Brands Home
& Security, Inc. Apple, the Apple logo, iPhone and iPad are trademarks of Apple Inc., registered in the U.S. and other countries. App Store is a service mark of Apple Inc.
Google Play and the Google Play logo are trademarks of Google Inc. The Best Buy Seal and other licensed materials are registered certification marks and trademarks of
Consumers Digest Communications, LLC, used under license. For award information, visit ConsumersDigest.com. ENERGY STAR is a government program that helps
consumers protect the environment through superior energy efficiency and is a registered trademark of the U.S. Department of Energy and the U.S. Environmental
Protection Agency. MET17.11325  05/18


Click to View FlipBook Version