The words you are searching are inside this book. To get more targeted content, please make full-text search by clicking here.
Discover the best professional documents and content resources in AnyFlip Document Base.
Search
Published by Harmonia Norah, 2017-05-17 07:40:00

WOMANS WAY ISSUE 20 LIVELINK

Woman's Way Issue 20 LIVELINKED

WIN A TWO-NIGHT BREAK IN KILLASHEE HOTEL

WINNER Magazine of the year

ATOZ
OfrFoAmCC€ES8SORIES

Win!YOUR

HEIGHT
IN BOOKS

PBIPIGPAD’ASYbLruetnscdho
(is Kate in the way?) 23rdMay2017
ERAECSIYPEWSEPEaKgEeN22D ¤1.49
(NI stg £1.39)

HOW FAR WOULD YOU GO TO HAVE A BABY?

The Wellkid® vitamin range for
children provides great all-round,
carefully balanced formulas for kids
aged 4-12 years. If you’re looking for
a comprehensive formula with more
than vitamins A, C and D, or calcium
supplement for kids, the Vitabiotics’
range of children’s vitamins has it
covered.

Calcium Liquid Multi-Vitamin Liquid Multi-Vitamin Chewable Immune Chewable Soft Jelly

Calcium and Vitamin D3 15 nutrients including Vitamin A, 21 nutrients including iron 24 nutrients, with Zinc which 10 Vitamins plus axseed oil
for normal growth C & D for normal growth & which contributes to children’s normal contributes to normal immune and Swiss Alpine Malt.
of children’s bones Available in Orange or
development of Bones in children. cognitive development system function Strawberry avour.

For more information, visit www.wellkid.ie

PG10

Contents Style for less 4 5 PG8
3
By the time 12

6 PG16

you’re reading 7 €U3n0desrpecial 1
this, we’ll 2 PLruinggt a€g1e6€fr2o4m.9P9efnrnoemysPARFOIS
have chosen
our Woman’s 3 Tribal €20 from M&S 15
9 4 MSBCleeohtlgilaaslolnliecn€e€€v22e24s64.€9.f9r92o56mf.rf9orbo9momfoNrihoCeomwlootTLhKoinoMkgaxx
8 12 5 ERrogsoengoomldic€€2208ffrroommNFeitwFblorpidge Silverwear
10 6 Frill €28 from V ON THE COVER
7 Suede €28 from by Very @ Littlewoods Ireland
8 Chic €17.95 from Dorothy Perkins
9 Zara
10
11
12

13 CSaptaerkyley€€2105.f5ro0mfrRomedNHeexrtring @ Debenhams
14 Floral €22.50 from Simply Be
15

Way and Beko 11 13 6 Pippa’s big day
Mum of the 14 8 A-Z of accessories
Year regional 10 WOMANSWAY.IE 18 Surrogacy real life
finalists and WW20 Under 30 Fashion.indd 1 By Áine Toner 22 Lets do brunch PG12

overall winner. 11/05/2017 10:55 29 Win your height in books
Many, many thanks to all our judges 48 Win a trip to Killashee
for helping us with the difficult job EIShlaenedpaleexthpoerrsteLwluhcyoylWittollefe‘uarndsvwiishesos ploavreiegnnetsttoinnghguowp etaorlycqebbapphhbuaytaaatsanowraSatiforya5owiticrceorldrrtorslardaeakuketysatttabmrdslmuwkhlimiiowywttetttea.mksrieorhoefe;aysnnInieeeuistepaetkyspsfolsdglllhgla–ltenwetlyolrina;eue,osgnmeieemodufdetntetnvibilpgovshlaphrtepp,igoeuatllrihlireraea,iocnrfbpinntfsltoeeegteohyrottgeaoytgcrtxscipahyrhriystomm.lftelaifnmoohesroedoohYanasms.suaoeeennnntsmor.easewGghtyroealpdehuyarwtyigeiianriulwhlnolrtttlmceneooraighgiliohdrede,osgaileukopshtiiynaisyn6khwrrsttisniietysghaonfinaatetifordteimrslumaegngiinwaletmodyrdnuekd,eneed. SpwjiipsuEnatloyetauftlH,nvlxmooaoaalkgoocaIoucrrretfagtelnlmewtrhyvnicytiee.conecceioeioewadmWnnhegdvwuprpaieye,blaleaaaykhdtorabensyi,rl.ia’unttlfan,ousdyhvTodtmsgudtohesahirhiretutaloetxieebeeshsvccttcyeeywepgheahseapeoeriatncierineatnlnsuisafpedlelbloainlikwso’rassaoresp’et,snrotnnuhpasaesfslrfoigsrlyercilokrxybsuetheobigmotsenwesttamieotuthipgtmelenpshhowreeetageaatiedce,sakfhthsnreyooywaisetcidoenmlslsbolidocutgtoolsmaniehtlirrwtrmeimfeacirvstmasrocliensseoneaukvarsuolslygeensjyauyoarruldieneheotstloglosv.lieidsauueonnptaepvrtnns.ieen..d
of choosing our top 15 for 2017. is YOUR LIFE
week, we’re publishing just some of PG28fasIos5sotrellrlaoeeCnciemsnsseoBeeolupvgpnemetoleoedltwcpenrmpiycanyatwi.otctoratmhilmananeperknei,lupadnyseticln,sstgseh–aedhbttcbaepyieautlmr,oahiirrlnasurydeevhntgearthtiodoto,inrafshewagmirltenasdvhtinagltaheeeahs,drsestty.et r. CYstfwbcChmatOooaaamaruncoeNrkttkiatvciliiTniaietntneeegnRgdausytreooemOcthlaeilueaeoeaLrslsrllsckry,nlemeToiobtotustHsuhetpoteuteieEtsrnr9yhIrtetepaaaNwhotmertaahotAatnbvauubodePe6tlaerdcattSktfaieohmonefuseeromysewpttofieho1ulartete2vsokhtaeteeneirttatnoeith,hrraioalomaecpyntnshre.wicioiso.lMytdauncwktalieiesininnlnylega.p
the prizes our finalists will receive nearly there. 2 Ladies in green
on our extra special event day. Plus, D●abttythhOeColefreuooyoanrduswetogt)i.nonh6Enu’attv’emhtseehwrn(eimaiftitntfuhodtwrthtninheoetoenabotlspolsalsdlkaoemynnetoipchunlw,aonugtcttoiekl ttdbhhouaenttc’yathofgituloedrwidntiwotloleonsthteboeeedmtthtterourenjeiutfwditlhg6eeeeaykms, WImtybfroehwftooteyovAeahehuuafoewrreoeKyswnlrueyynrsiidrEntnaen:wwoyakgctgiteoTyhteaith,lyrsuihklwOestilondeweoaokuiu.gln,aSnnwlsrsTdklotbeluLceaehhexwehbatkeEiet’siwleepeslEtdcrwswhhdostyPaaieeeeeaocislktncncllylmeihtetogapye5inauhvltaocc.ainiegt0hebqmuyedhrnu5o–dteeoiaueptaqnuswo,matoiutnotwnti1ese,tei5drtcehnhyniiontmismogtcoynhdiuehnoneaitennitoulecinelrhtunotyroluvoestvyufoeesefmeoolrkmsdltlfryfviwob!ptyearraoOostnycauhrdk.e 4 Aoibhinn Ní
we’re asking for your help in choosing to wake at this time. your approach. AAwhis6esTwmsnoDtlesavaaeikhhIlaopotieeoaerennmeJetniepewnktemsrsaheaUpdohrpty.sjnpnjnetqohcweaeul(aSTh.ddi.ioayue1trnscssilahETna0Airnaaattcmgstmtepyxolmthb–ghltwwitBnaetatlerteletahe1hhteaomroyrhosdaE0tmhroeitarrbaswanuteeie½asneDkutnotiettlgaaetmw,thgeeniiveTdysryremsbeheheoillteowtIelyyvnuwitimolwh,eMuImfbvehitawut,iietthreeyorsfaihydhesErtmyraadocvjtsyaoofjeyuhttkaautui)ookyeumnhetsi,iinncsrmeohulnrcgtihdwbdutneuiaagecinipneunbtgttilsniahttdisechgoatfiehbmirhipolenanselldsoanehyadiauddsedyettbninawtssfilisisijori/uldbltgsmudssahealovuobrilsemhkwtetyanergtertetsrwaedsaosebsadcyecmltkd,wtaohhaaktntbhdetwaiatiircnoieeiemiuenmolektnkddsi!arcnsuhtrctfigjeefeketioubt–oyifnh.rserntnelursaecerieesrTaossmtlvtgfnostssaneipiomhihhxdymussr.eeosrioey,sgw.ewe,uhrit
our Celebrity Mum of the Year. Turn ● Make sure the room is super ● Ensure that the gap Shúilleabháin IHWNEIINGBHYOOTOURKS Competition
to page 31 for the finalists and simply dark with no external light obr●abccfeetleoPcwdoldnoerstatoitmaeimkrvsrmietmibtedfe4ouued.e5tbnlIoetnmfedhetetdesoehistdnnsiibwmusotbeitahtdemeekaef,tsoiixesimnbrt.cseegcelefiaetpofonderpoeeeathddlseo 5 Katherine Heigl
email your choice to womansway@ 10 Fashion under €30 pWeer’sroengailvsionrgtaowf paryiazeptahritsiwcueleakrly
gmail.com before May 23 or post it in DON’T creeping in. noises – central s●i(tAosiheEodte,oxnjy6uoa.pshmetmaativrnh–leee5yhabddmaeauddy)e,teftitnoomhroetweuhn.gaeIbhrfnydisatl5speoasemp. 12 Beauty news
on this week’s competition form. ● Start reintroducing ● Avoid any that the final 14 Lauren Murphy WIN!efbswrnIenoefimntsmvOPawclmuryhruoWoeWnooleenompeeenrnwtmcraoeueleeaieeoybrtmdfikus’apw,hlllmveheaeo,ruocnaeewererntevvcwmdoytnms’ieoeksimeivo,ogethewfylefinbwit’bahooancorebe,onlraodvtveeidln,reolognbeeoeslfiasoagtonekiorkptasht,ioudinrksnrisvhdorbsegwroe,seyciemeDorirnnwtcqelsonmarqahorsug(ueeeuipousgiaknW,nneqsrshsastaensnsadstuoisnwtoiit.dceetnsreeieooemisurlraaFsdodfh.atue,nmyrw,ahn,hkooWdrwuwocneysi,yurpmomwlheht’oeolDgpetsnpo’ie’ibhuomvlefrurnrcWdntiuaeereeobzcgnhenervrlvoewoatlielaeteuaeiioyhuhnkynerlfecmcfwet,loew.i’hbtdwoonsgtrarboAabomegytiicbncyebyeotvxhfooepsdorhsbraoekteepliteusolooaegirwtileal!tr.eiinkofohecinawwtesWthdskvtetteliialntlesoesktnn,taedhiyoeirnhnntnwangt)eewdreobgogendhftseiwiowerhiodbitrvafi.ngmsrieeo.oelsefmcetn.ralkaoakrtheaadSwysmeikneadwotsonosdyiitei,nnuantltdytowm,fy.h,o.eairsny
hstfpohoermraeatwcbeitnaooitgcnrhakecrll,io(inIcbokkumthnitn,eoyggwoheouottntughi,seniestgtiusuhsnpei’ntg nap is later 24 Parenting advice
is week, we have Aoibhinn Ní a night and bedtime 26 Parenting real life
Shúilleabháin and Katherine Heigl is too, but the 28 Early risers
and a few must-read real lives. ese o●ylGeroSiaeuvtvaaerirrnbtlthygebedmtrmhoionertrgrotnoihynioensgmgisntphfbeateehermfedeo.bcrieneodtt6otaoomr . i●hidnueMtnaaa)gk.kreeya.snRudree-eenthxsaaumtretihnteheyattahdreeinfnonooetdr wake period 30 MOTYA prizes
are the kind of ones you want to settle play with. is an evening meal. is still what is 28 Celebrity mums
●tmn●teioRmmaBtekepaeve.ecicesrMoouwannatrsutnetirhsrytitebehefuaaanrtntomtoobdarimetlyciitelnfhosagticrshceteioopnarlogd.rrltyitos syuogugrensotetdesi.nWW
LEoaaebUinncxtatlhdpCcyivekeYmarcitttoatSoyaeyfAtfmatripnYoheprndeqSoos,umrreweeaaonarhcwtyteitcniabtvhikahgicnetehinadetenitsaanigirmlgseleyaed By Lucy Wolfe
activity.

28 WOMANSWAY.IE 10/05/2017 15:50

WW20 Parenting feature.indd 2

down with alongside a cup of tea. PG22 33 Visiting Lyon Competition entry formPage29Your Page 46 Himalaya Scrub
We’ve also got a competition to 34 Super trolley Your answer:
36 Upskilling 101 Your answer:
win a break to Killashee House Hotel 38 Gardening tips height in books (include your height too!)
and one to win your height in books. 53 Soapbox
Now there’s something I wouldn’t MPaygneo3m1iInfavtoiotninigs:for Celebrity Mum of the Year... Page 53 Woman’s Way beauty goody bag
mind winning (but alas, I cannot. e Your answer:

Page 40 Three new books DiIsfuspuboelsin2ti0n1,4gR,bocysoetmhmepolcuelotnestitHnhgoeudfosaertm,eDaunnddsreunmd it to Woman’s Way Competitions,
Your answer: Road,

Hr€Ba6aaTREeEnT00tnElOMe.s9pdNl6X.waI9lA0SainT1T9ne/eIn5:dL£rerfR1sWslo:0v3wi0.lYnw.iAl€845ceoeY11ew00rw.F85/.CPptca6Oe82oraone1d14ol/rm5s7Rl4£vb3wst1pie0y30fdAexeN.r0y0e5rtot7ILosri.0mpt.0ufPiLlpoIo9urhNmlen0lsnCoros1NosnaOw@ctb1mIoaa3iegTvMlln0edlemaEdfsa0tbPXraainc1ooyriT6Eodmlnd:y.9scTatWoLnIoanuNmtIenmAdTsrtow.RwYEnIPrOiOeoaterHorr.mIc/NkOoemNSE/:
Terms and Conditions apply. Photocopied competition
YOUR DETAILS TO WName: wAninswtheer bthoioskqpureisztei:on to
INAddress:
will be selected at random. oUWfnhBboeeiawnrgrao?btlee The
Number: Lightness

PG29A winner Closing date: Midday, Tuesday, May 30, 2017.

entry forms are not allowed.

WW20 Comp.indd 1

10/05/2017 16:01

editor’s decision REGULARS

is final!). 16 Latest health news COMPETITION
20 Food news WINNERS
Have a lovely 25 Parenting news
32 News for jetsetters Issue 17 (May 2, 2017)
week from us at 40 New reads
41 Reader fiction Crossword winner
Wow! Woman’s Way.W2IN0N%EROMFaFgaCziAneRoRfAthIGe yDeaOrNNEVERY READER WIN A TWWINNOE-RNMIaGgaHziTneBofRthEeAyeKarIN KILLASHEE HOTEL 42 Soapland gossip PG25 Eileen Harkin, Co Donegal
TALKING 45 Have your say Three new books
FOR TO 46 Horoscopes Sandra Mulhall, Co Laois
A ZPOINT 47 Tarot special Ritual of Dao Body Cream
Win!(AANPD RinkINforTa EyeRar) PG20 50 Puzzle special Bridie Murphy,
55 Knitting Co Limerick
Win!ONTNEETWLHLYE from €8Why does AGE Carraig Donn voucher
define us? pattern Beatrice Duff, Co Dublin
Nationwide’s bLruetnscdho PIPPA’SRThEenDewWIrAishTdEraRma OF ACCESSORIES

PCeYHerssAfi,bPWmeReyRoHcMhIupWAatNITpcllNETaypeTAnISyGHYORNOEBIUGORHOTKS PG33

ANNE BIG DAY(is Kate in the way?)STYLE CENTRALThe perfect NOW
CASSINblowdry
SUBSCRIBE TO WOMAN’S
SeaBurencadhuetfryo¤r2r0omance.N..oisaiyrsouorr 2¤3rd1M.a4y 29017 WAY NOW & GET...
graces HOW FAR WOULDRE16¤th1AEM.a4yC2S091I7YPEWSEPEaKgEeN22D YOU GO TO HAVE A BABY? (NI stg £1.39) 4 ISSUES FREE*
date a (NI stg £1.39) 11/05/2017 10:50
* GO TO PAGE 52
WW20_CVR_FINAL.indd 1 FOR DETAILS

conman?

04/05/2017 15:04

WW19_CVR_Reg 1.indd 1

Call us... Email... Online... Subscribe... Facebook... Twitter...
01 240 5300 [email protected] womansway.ie 01 2405363 facebook.com/womansway twitter.com/Womans_way

May 23, 2017 Vol.54 Issue 20 Woman’s Way, Rosemount House, Dundrum Road, Dublin 14. Tel: (01) 240 5300. Fax:
(01) 661 9757. ISSN0043-7409. Published by Harmonia Limited, Rosemount House,
Editor: Áine Toner Email: [email protected] Deputy Editor: Louise Finn Email: [email protected] Dundrum Road, Dublin 14. Distributed by Newspread.
Lifestyle Editor: Amy Wall Email: [email protected] Staff Editor: Michelle Newman Email: [email protected] Standard subscription rate for 51 issues €75.99 Island of Ireland, €264.69 for UK & rest
Art Director/Studio Director: Simon Baillie Email: [email protected] of the world. Woman’s Way Subscriptions Dept, Rosemount House, Dundrum Road,
Senior Designer: Karl O’Toole Email: [email protected] Dublin 14. © 2017 Harmonia Ltd. All rights reserved. No part of this publication may
Cover photo credit: REX Features be reproduced, stored in a retrieval system or transmitted in any form or by any means
electronic, mechanical, photocopying, recording or otherwise without prior permission of
SALES & ADMINISTRATION: the publishers. The publisher cannot accept responsibility for errors in advertisements,
Publisher: Norah Casey CEO: Ciarán Casey Creative Director: David Gibbons Commercial Director: Rachel Supple articles, photographs or illustrations. All information is correct at time of going to press.
Financial Controller: Darren Murray Advertising Manager: Noëlle Kelly Email: [email protected] Colour transparencies submitted for publication are sent at the owner’s risk and, while
Advertising Production Manager: Louise Allen Circulation Manager: Sinéad Behan every care has been taken, neither Woman’s Way nor its agents accept any liability for loss
Subscriptions: [email protected] or damage. Average net circulation 20,711 (ABC January to December 2016).











Pippa’s big day

‘no ring, no bring’ e Middleton
measure-up
policy meaning that
Two sisters with
unless their guests are two very different
weddings
engaged or married
One is a duchess and the other enjoys all
to their partners, the benefits that being the sister of royalty
can bring. Take a look at some of the main
they won’t be able to di erences between Kate’s big day and

bring them along as KatePippa’s impending union.

their plus one. is Groom: Prince William,
second in line to the
means that James’ British throne
Location: Westminster
brother, reality TV Abbey, London

On Kate’s wedding day personality Spencer Date: April 29, 2011
Matthews will not The dress: Designed by
Sarah Burton, creative
have his girlfriend director of Alexander McQueen
The ring: The late Princess Diana’s
on his arm. Socialite engagement ring, a 12-carat oval blue
Ceylon sapphire set in 18-karat white gold
and Made in Chelsea Public or private: Public – broadcast to
millions around the world
star Spencer - who Wedding Planner: Jamie Lowther-
Pinkerton
is expected to be Guests: 1,900

his older brother’s best man - is currently Pi aReception: Buckingham Palace

“Someone dating Vogue Williams and much chatter has Groom: James
skirting the Matthews, hedgefund
guidelines been circulating that the Irish model was manager
is Harry” Location: St Mark’s
banned from the event. Sources close to the Church, Englefield
be quite close and share a number
of common interests; it would be bride have said that Pippa felt like it would be Date: May 20, 2017
fairly unusual if she wasn’t. However The dress: British
others suggest that Kate - who wore inappropriate for Spencer to bring Vogue as fashion designer Giles
an incredible lace gown on her own Deacon is the current favourite
big day, designed by Sarah Burton – they have only been dating for a few months, The ring: A three-carat art deco-style,
would rather take a step back and let Asscher-cut stone
Pippa garner all of the attention instead. while others are surprised that the soon- Public or private: Private – Pippa and
Meanwhile Pippa and mum Carole James are said to have turned down a
(61) have been seen shopping in to-be-married couple aren’t bothered that lucrative magazine deal
some of the most upmarket bridal Wedding Planner: Mum Carole is thought
boutiques, including award-winning James’ brother will attend the wedding on to be helping Pippa with the preparations
designer Suzanne Neville’s store in Guests: 150
Knightsbridge; one of London’s most his own. Vogue’s representatives addressed Reception: Parents’ Carole and Michael’s
lavish residential and retail districts. back garden
British fashion designer Giles Deacon the gossip and attempted to clear up any
was spotted visiting Pippa’s home WOMANSWAY.IE 7
towards the end of 2016, making him speculation that Dublin-born Vogue was
the most likely person for the job of
creating the all-important dress. disappointed she was not on the invite list. To
While little is known of the bridal
party, Kensington Palace has already clarify her reasons for not being there on the
confirmed that Pippa’s niece and
nephew, Princess Charlotte, recently turned day they issued a statement saying, “Vogue
two, and Prince George (3) will play the
parts of flower girl and page boy on the day. has a prior engagement in her diary on the
Other well-known names who are thought
to make an appearance on the day include date of the wedding, but wishes Pippa and
author and broadcaster Ben Fogle and Swiss
tennis player Roger Federer. However, not James all the best on their special day.”
everyone associated with the Middleton and
Matthew’s families have managed to obtain Interestingly though, Kate and Pippa’s
an invite to the society wedding of the year.
Apparently Pippa and James have issued a younger brother, businessman James

Middleton, is expected to bring his long-

term girlfriend Donna Air. James and media

personality Donna have been an item for

a number of years now, so it is easy to see

why the rules surrounding plus-ones are

somewhat more flexible. Someone else who

seems to be skirting these strict guidelines is

Prince Harry. Kate’s brother-in-law, Harry,

is in a relationship with American actress

Meghan Markle and it has been reported

that the Suits star will not attend the church

ceremony but will be by her boyfriend’s side

for the reception.

Few brides will stand for being outshone

on their big day and there were talks that

Pippa was not so keen on having anyone

steal her thunder on the day, thus explaining

Meghan’s reception-only invite and Vogue’s

apparent prior commitment.

By Michelle Newman But Kate didn’t have that option, as a

copious number of famous faces attended

her big day, which could again be a bone of

contention between the sisters. Although

given that in public Kate always holds herself

with the utmost of grace and poise it is

unlikely that she would make her feelings
about the wedding known. WW

Ankle boot Ballet flats jDaecnkeimt
Charm bracelet
€135 from Dune €69 from Pandora
Practical all year round, pick one €79 from Dune
that fits you like a glove – you’ll Similarly to ankle boots, Make memories with a charm
get so much wear out of them make sure the fit is on bracelet that allows you to add
point – flats especially can details for special occasions
Earrings widen through use
AACCZESSORIESto €70 from Simply Be
€120 from Beje @ Brown Thomas Fur
They don’t have to be expensive, they Probably the hardest
don’t have to conform to a certain shape, working piece in your
but you do have to love them wardrobe

Glasses €24.99 from New Look Jumper

€15.95 from Zara Fur isn’t for everyone, but these sliders are one way
Keep your peepers protected from the sun’s
rays all year around with sunglasses to inject the never-going-away trend in your life Investment

Kimono Heels €40from €490 from Marc Jacobs @ Brown Thomas
€49 from Evans Dorothy Perkins
With jeans, trousers, Whether it’s an investment bag (it is for me)
over a dress, opt for Okay, bit of a or shoes, or a brooch or whatever, working
a vibrant colour or divider BUT if towards something like this is
fabric you’re a fan of hugely satisfying
heels, choose a
8 WOMANSWAY.IE block heel and

your feet will

thank you

Lingerie €64.95 from White Stuff By Áine Toner
A great basic but one that’ll keep
€40 from Myleene Klass you warm – and that’s invaluable
@ Littlewoods Ireland
Mask
You know, good lingerie,
stuff that makes you feel €25 from The Ethical Silk Company
all gorgeous and lovely An eye mask will help you sleep better –
and if you’re getting one, you might as
well get one in silk…

Necklace Purse Added extras
€37.50 from Principles
by Ben di Lisi @ €9.95 from Zara Ring
Debenhams A little cute thing for
A statement necklace will holding your change
take any outfit from day
to night

Oh, headgear Quirky Flamingo ring holder €20 from Newbridge Silverware
€14.99 from PARFOIS €14 from Paperchase A sparkly ring will add pizzazz to
You’ll need somewhere any outfit. And yes, we did just use
So we cheated a bit but a hat is hugely to place all your jewellery, the word ‘pizzazz’
important, particularly in warmer weather after all…
Va-va-voom

Umbrella

€32 form Cath Kidston

Scarf Timepiece Probably not on
everyone’s to-buy list
€60 from KDK but who wants to get
As a shawl, as a blanket, as a pillow, caught in a shower?
as a scarf, we could go on
€110 from Swatch €33 from Therapy @
Wristlet House of Fraser
Being on time is important,
€135 from Kate Spade so opt for a slinky watch Back to our comments
@ Brown Thomas about lingerie, a sexy little
So chic, so now, so useful Xtra Space number is always useful

€30 from Kitty McCall @ Moss Cottage Zip up

You know, for all your bits and bobs, like
beauty bits and bobs

Yellow €23 from Penneys

€8 from Autograph @ M&S For no other reason
than we love this
Not that we’re saying yellow
is an accessory but nail polish
is… and this is in yellow

WOMANSWAY.IE 9

Style for less 4 5
3
12

6 7 Under
9 €30 special
8 12
10 1 Luggage €24.99 from PARFOIS 15
11 2 Print €16 from Penneys
3 Tribal €20 from M&S
4 Chi on €24.95 from iClothing
5 Bell sleeves €26.99 from TK Maxx
6 Slogan €24.99 from New Look
7 Metallic €26 from boohoo
8 Rose gold €20 from Newbridge Silverwear
9 Ergonomic €28 from FitFlop
10 Frill €28 from V by Very @ Littlewoods Ireland
11 Suede €28 from Dorothy Perkins
12 Chic €17.95 from Zara
13 Sparkly €15 from Red Herring @ Debenhams
14 Cat eye €20.50 from Next
15 Floral €22.50 from Simply Be

13

14

By Áine Toner

10 WOMANSWAY.IE

COSY CAR SEAT COVER
The Car Seat Safety Essential

PFOWQRSUWTEOATAEGEYE Safety for baby
No bulky snowsuit required

Allows correct harness tension

Fits all rear facing car seats

RRP €40

The Cosy Car Seat Cover keeps baby warm in the cooler
months, whilst removing the risk of overheating and
allowing the all-important harness tension.The 3+ tog rated
elasticated cover fits over the rear facing car seat, offering
baby maximum warmth and protection.
The cover is easily fitted and removed in seconds without
disturbing baby. The Travel cover is ideal for use from car seat
to travel system to ensure your little one is snug and protected.

Safe and secure No snowsuit required

Did you know...

Car seat manufacturers recommend that babies should not wear bulky clothing or snowsuits in their car seats.
Bulky clothing and snowsuits do not allow you to tighten the car seat safety harness correctly.

For more information visit: www.rubyandginger.co.uk

Take two LOWVEE... Nima Nets and Mitts from Nima Brush. The
CATRICE has released nets keep brushes hygenic and in perfect
shape for anytime use while the mitt will
clean skin, remove dead skin cells and

make-up residue while gently exfoliating.
Lightening and Darkening
Make-up Transformer Drops
(€3.95), meaning you can
personalise your foundation
without having to spend loads to

READERget a new one. Fabulous idea.
NBUOYWIT 3 NREo7VIEWNatural beauty NIMA nets are €9.95 for a pack of seven
POP! Beautymarkthebrand’s while the mitts are €9.95 each.
lovers rejoice... To
50th birthday, the Restore &
entire Dr Hauschka There are now seven Renew FACE
make-up range has pop coloured lip oils & NECK
been reformulated MULTI
from Clarins (€21 ACTION
tnewsandrevamped.Five each), as four new Serum
(from €34)
years in the making, shades – Candy, A decade
the latest products Tangerine, Mint and ago, the cult
in the now 83-piece Honey Glam – have product Protect
collection have been & Perfect
designed to deliver been added. Ultra serum was
strong colour payoff glossy, delicately launched onto
fragranced, these also the market
and I wasn’t
feel great. sure if the
new product
while maintaining an would be as
revolutionary.
all-natural ingredients I had read some information on
OSCFESNUTCSCESSdisappoint. it – that it had clinically proven
list - and they don’t results for wrinkles, face firmness

As The Perfume Shop celebrates 25 years on and skin tone – so I was excited

the British high street, the brand is looking Lovely lotion to be asked to test it. I tried the
back on the rise of celebrity fragrances, a serum for two weeks and my face

market that’s worth €1.49bn today. Britney Bronz’ Express has was softer and smoother but

Spears has been the retailer’s top-seller for the introduced a Tinted Self- still retained firmness. My neck

last seven years, with one bottle of Fantasy, Tanning Lotion (€15.95), showed the biggest difference in

originally launched in 2005, selling every 30 the first self tanning its firmness; even in a fortnight

seconds. But Ms Spears is currently lagging lotion on the market it looked different to how it had

behind in the 2017 chart, with SJP taking the which produces a tan in a been before. The serum is easily

top spot: few hours just like a real applied and is non-greasy. I will

1. Sarah Jessica Parker - Lovely suntan. Suitable for all skin be happily continuing to use this
product, it genuinely made a
2. Ariana Grande - Ari Sweet Like Candy types, the tan gradually difference and it made me feel
3. Britney Spears - Fantasy and naturally fades. Ooh, more confident in my skin.
and it’s streak free!
4. Beyonce - Heat

1 25.Rihanna–Nude 3 4 5Take five… €20 and under
€20 INGLOT Beautifier €19.95 Anthelios €18 BUFF Make-Up €20 Eve Lom Kiss Mix €4.93 NIVEA Daily
Lip Gloss lip tint Essentials 3 in 1
Tinted Cream Dermo-Pediatrics Wet
Cleansing Micellar Wipes
Skin Gel Lotion SPF50+

12 WOMANSWAY.IE





PRESTIGIOUS
EDUCATION IN A
WORLD-CLASS
HAIR ACADEMY

At The Dylan Bradshaw Hair Our apprenticeship courses focus on both the
Academy we o er bespoke theoretical and practical aspects of cutting
training and courses to suit and colour. And for qualified hairdressers, either
all levels. Simply put, there is returning to work or just looking to brush up,
no better place to learn we have a range of advanced courses in styling,
the mastery of the colouring and much more.
hairdressing trade.
For more information visit
www.dylanbradshaw.com

» Creative Cutting & Colour
» Trainee Finishing School
» City & Guilds Diploma in Hairdressing

& Barbering

56 South William Street, Dublin 2
+353 1 671 93 53

Health news

Tried and tested ASK FUNGAL NAIL
THE INFECTIONS
EXPERT

As someone with incredibly Janette Pegley-Reed is a foot
health professional from the
sensitive skin, I was Reed Footcare Clinic

intrigued when I saw the What causes these infections?
Fungal nails are primarily caused by fungi
new sensitive sun care range called dermatophytes (the same fungi that
cause athlete’s foot). Other factors such
from elave. Combining as not cleaning or drying feet properly,
going barefoot in communal places such
high protection with a as showers or swimming pools, damaged
nails, a weakened immune system, or an
blend of vitamins to keep underlying condition such as diabetes or
psoriasis can cause a fungal nail infection.
skin soothed, this this a
What are the symptoms?
godsend. e Sensitive Sun Nails will o en become discoloured,
thickened or distorted. They might also be
SPF30 is a dream. It smooths very brittle or crumbly and can sometimes
cause a little bit of pain or discomfort.
on effortlessly and offers €19.95 available Take three:
great protection. It’s also from pharmacies Simple ways to… What’s the best way to treat a fungal
paediatrician approved nationwide soothe stiff muscles nail infection?
from newborn, meaning it’s There are several ways to treat a fungal
Whether you’re sore from some exercise or nail infection and the success of the
gentle enough to use on younger members you slept in a funny position, here are three
simple ways to soothe stiff and uncomfortable
of the family too. After spending a weekend muscles.
1. MOVE MORE – It sounds counterintuitive,
out in the sun while using this product,

my sensitive skin was kept safe, happy and

hydrated. I’ll definitely be stocking up on it

for summer.

GET HYDRATED but moving is a powerful remedy for stiff treatment depends largely on the patient

Revive and Relax is muscles, providing you don’t overexert being consistent in following their
a new range from yourself. Try going for a gentle walk. e treatment plan. This may include treating
Deep RiverRock. movement will help to warm up muscles which the condition with a product such as
Combining water can help you feel a little looser and less sore. Mycosan and a regular check up to ensure
with essential 2. HAVE A SOAK – It’s true – a warm it’s working.
herbal extracts bath can help ease stiff muscles. Draw a
and minerals, the bath that’s not too hot and add in 1-2 cups of How can you prevent fungal nail
range has two Epsom salts. Relax for 20-30 minutes. is infections?
minerals designed will help to soothe any discomfort and help Keep your feet clean and dry –
to give you a li tension ease away. Thoroughly clean and scrub your feet and
(magnesium and 3. EAT SOME PROTEIN – if your stiff ensure that they are completely dry as
zinc) and two herbal muscles are caused by exercise or over fungal organisms thrive in warm, damp
extracts to help you exertion, protein can help. Try eating some environments.
unwind (mint and fish or chicken. Protein helps muscles to repair Protect your feet – Fungi (which can
lavender). The range themselves, speeding up the process which lead to fungal nail infections) love
is available in stores means less discomfort. environments such as communal
nationwide now and showers, swimming pools and changing
the RRP is €1.40. rooms so avoid going barefoot in these
environments.

Avoid sharing footwear – No matter how

Bookworm tempting your best friend’s shoes are,
avoid borrowing them so you don’t pick up

Do Less Be More any ‘extras’!
Let feet breathe – Be sure that you wear
By Susan Pearce and Martina Sheehan (Hay House, €20.99) cotton socks and shoes made from natural

We live in a world of ‘busy’ and modern life is hectic, but materials to allow your feet to breathe.

what if slowing down was more powerful than speeding

up? In Do Less Be More, the authors show readers why

slowing down is vital when it comes to helping us reach Visit your local professional to get them to By Amy Wall
our full potential. In fact, living a busy life could actually check your feet. They will be happy to see
make us less productive and less satisfied with our lives in you and review your nail health to let you
the long run. In this book, readers are offered 21 activities know if you have a fungal nail condition.
designed to help them see the benefits in slow moments and Mycosan Fungal Nail (€22.85) is a fast
enjoy a more laid back pace. e perfect book for anyone solution to fungal nail infections, with
who is feeling overwhelmed or frazzled and wants to try visible results in two weeks. It is available
from pharmacies nationwide. For more
something new that’s easy and fun. information log on to www.mycosan.com

16 WOMANSWAY.IE



MBEUCMOAMNIDNDGAD
In the wake of their own journey, one Irish
couple is highlighting the need for Irish
legislation when it comes to surrogacy

Fiona, Seán, work… and you’re so emotional and raw. I Before we had went into adoption, he
Donal and Ruby spent the week crying. at’s what I did. I had raised it but because there was no
didn’t go outside the door… Even the whole information readily available to us, we kind
“W e met later in life. We had experience of having it [a miscarriage] of put it on the back burner.
fallen in love and decided confirmed was an awful experience. You’re in
that the next step for us was a waiting room with all those other pregnant “So he raised it again then when we
to have a baby together,” ladies and you know in your heart. realised that adoption wasn’t going to work
says Fiona Whyte. and I decided at that stage okay, you’ve
“Even though you’re hoping, you know in thrown it out there. Let’s have a look and see
“We tried going the natural way and that your heart you’ve miscarried and yet you’re what we can find out,” says Fiona.
didn’t work and then we decided that we sitting there, waiting to be called in to have
needed some help in that regard, so we went that confirmed…” e couple began researching earnestly and
to a fertility clinic in Galway.” quickly found it hard to find information in
When it comes to IVF, we’re often told Ireland.
Fiona, who is from county Clare, was about the success stories, but few people
46-years-old at the time and when she visited speak about the emotional toll that this “None of the fertility clinics in Ireland
the clinic she was told that she while she process can have. In fact, there is no support would provide us with any information,
would never conceive naturally she may be available to help couples through what can be when they knew it was about surrogacy,
able to with the use of IVF. a very stressful and difficult time. because it’s not legal but it’s not illegal.
Because of that they just can’t give
Fiona and her partner Seán have recently “ ere’s no support for IVF. You do it as a information. ere was no option the but to
released a book together. Without A Doubt is couple and you do it alone and that’s it, and look online and see what information was
the story of their own journey through IVF, you support each other. there and try and decipher what was fact and
adoption and surrogacy, and the struggle what was fiction.”
they faced to be recognised as the parents of “I suppose in some cases it might be
their children. e question at the centre of so stressful it causes disharmony in a Fiona started to look at every country
the book is simple – how far would you go to relationship. In ours it didn’t, but I’m sure it which provided surrogacy services and did
have a family? does in others because it’s fraught with stress research to see which one fit them best.
and emotion and upheaval.”
Fiona says that due to her age, the couple “We fitted with a number of places. For
was “prohibited from accessing IVF services When IVF didn’t bring success, the couple example, we would’ve been able to go to the
in Ireland” so in order to try IVF they had to turned towards the adoption system. US, but it would have cost us up to €200,000
travel abroad to a clinic in Barcelona. and we wouldn’t have that,” says Fiona.
Fiona says that while they put their name
“We had five cycles of IVF and on the first on a list for assessment and continued with Finally the couple looked at India and
cycle, I got pregnant… but unfortunately this process for a few years, eventually the found a regulated clinic, the Corion Clinic in
miscarried then at ten weeks. We did five couple decided that adoption wasn’t right for Mumbai, which could help them.
further cycles, none of which resulted in me them and chose to look into another option –
getting pregnant.” surrogacy. Fiona and Seán travelled to Mumbai for
a week and chose their surrogate mother.
Fiona says that nothing could compare to “Seán had raised [surrogacy] early on. During that week they also chose their egg
the pain of losing a child through miscarriage donor and the embryo transfer needed for
and unfortunately this is a pain that a lot of “You do it as a surrogacy happened. ey returned home
women experience. couple and you and waited to see if their surrogate mother
do it alone and was pregnant.
“I think it doesn’t matter what age you are that’s it”
or what stage of the pregnancy you’re at, it’s Once the pregnancy was confirmed, the
just devastating. couple didn’t visit India again until a week
before the birth. ey weren’t allowed to see
“You’re sitting at home. You can’t go to their surrogate mother again.

18 WOMANSWAY.IE Finally, after a long journey, twins Donal
and Ruby were born in September 2013 and
Fiona and Seán were overjoyed. e couple
spent eight weeks in India, seven of which
were spent bonding with the children.









Recipes

Caroline and 4 To make the sausage Cinnamon buns should take about 5–10 minutes.
Sophie say patties, mash the garlic and with cream Grease a large bowl with a little
sugar to a paste using a pestle cheese icing oil, add the dough to it and cover
“The divide between and mortar, then add the fish with cling film. Leave somewhere
what we would like to sauce. Slit the sausages and Time 1hour 30 mins Makes 12 Level warm for 2 hours. While the dough
eat and what we think squeeze the meat into a large Medium is proving you can make the filling.
we should eat o en feels bowl. Mix in the garlic paste, Melt the butter and leave to cool
most pronounced at then form the mixture into 16 You will need slightly. Combine the sugar and
breakfast or brunch time, patties. 350ml milk spices in a small bowl.
when the appeal of a fruit 5 Grease a griddle pan with 75g unsalted butter, plus extra for 4 When the dough has doubled in
salad can wane next to a little oil and put over a greasing size, line a large rectangular baking
a fry-up. There’s a time medium heat. When hot 2 x 7g sachets fast-action dried tray with greaseproof paper, grease
for both, of course, but cook the patties in batches yeast with a little butter and sprinkle
for moments when you for about five minutes 750g plain flour, plus extra for with the demerara sugar. Clear a
want salty and fatty and on each side until really dusting large area of your work surface and
crisp and fresh, there is browned and crisp. 75g sugar lightly flour. Turn out the dough,
Vietnamese bun cha.” 6 When you’re ready to eat, ½ tsp salt punch it down and roll out to a large,
shred the lettuce. Divide 100g yoghurt or buttermilk even rectangle – around ½cm thick
Method the noodles between four Oil for greasing and 50 x 35cm. Brush the butter
1 Wash and dry the lettuce and large bowls, then top with 50g demerara sugar over the dough, then sprinkle over
herbs. Add the radishes and the lettuce, some herbs, Milk, for brushing the sugar and spices, covering it
spring onions to a bowl with radish and sausage patties. right up to the edges.
the vinegar, salt and sugar Serve with the dressing for For the filling 5 Roll the longer side of the dough
and scrunch together with drizzling and extra herbs. 50g unsalted butter in on itself to make a fat sausage –
your hands, then set aside. 200g soft brown sugar try to keep it as even as you can so
2 To make the dressing, Extracted from 2 tbsp ground cinnamon you end up with similar sized buns.
crush the garlic and sugar The Little Book ½ tbsp allspice Cut the dough sausage in half, then
to a paste using a pestle and of Brunch by cut the two halves in half again so
mortar. Add the chilli and Caroline Craig For the icing you have 4 pieces. Cut each of these
bash lightly to release some of and Sophie 120g cream cheese into 3 equal pieces. Place on your
its juices then mix in the fish Missing (Square 40g icing sugar lined tray, spacing them a couple of
sauce and vinegar. Taste and Peg, €17.44) Pinch of salt (optional) centimetres apart, then cover with
adjust seasoning if necessary: which is out now cling film and leave for at least an
it should be sweet and salty Method hour, or pop in the fridge overnight.
and sour and spicy. 1 In a small pan, warm the milk 6 In the morning, or when you’re
3 Cook the noodles in boiling over a medium heat (don’t let it ready to bake, preheat the oven to
water, according to the bubble), then add the butter and 180°C/gas 4. Remove the buns from
packet instructions, then leave to melt. Sprinkle over the the fridge (if necessary) and brush
drain and leave to cool. yeast and mix together until any the tops with milk – this will help
lumps dissolve. them to turn a nice golden brown.
2 Whisk the flour, sugar and salt Bake in the hot oven for 30 minutes.
together in a large bowl. Gradually 7 Beat the icing ingredients together
add the milk-butter mixture, in a bowl and spread on the buns a
mixing together with a wooden couple of minutes after removing
spoon. When combined, add the from the oven. Eat immediately. WW
yoghurt or buttermilk and mix
again.
3 e dough should be fairly sticky,
with an almost porridge-like
consistency.
Flour your work surface generously,
turn the dough onto it and knead
until smooth and supple – this

Caroline and
Sophie say

“Somewhere between a sticky bun and
an American iced cinnamon roll, these
pastries are just as good with builder’s
tea as they are with filter co ee.”

WOMANSWAY.IE 23

Relatively speaking

TURN OVER A NEW LEAF

Is the joy of books getting eclipsed by ‘screen time’ in your house? Here’s

how to turn it round and make books important in your child’s life again...

T here’s no denying that readers from two to three your child every time they read and who appear reluctant by
‘screen time’ is part and months old. Use bath books and a book by putting a gold star on making sure they have the
parcel of life and the fabric pram books to encourage the cover. reading material they are
digital age has brought actually interested in, be it
many advantages when it comes 2little readers. 7Make the reading of books from comics, kindles or the
to children learning, but, as Make a bedtime story a together playful. Kids love local book shop.
researchers are establishing, feature of your child’s wind when you ask them what word
too much of a good thing can down routine from early on. they think is coming next, or 11Following an author and
be negative. Researchers from Not only will they be soothed by what word they’d use instead. joining the fan club is a
universities in New York and your voice and lulled to sleep, great way to foster reading in
Canada have revealed that pre- they will look forward to ‘what ese prediction games are a child – once they get hooked
schoolers show less readiness for happens next...’ important for expanding little on one compelling read make
school if they’ve been exposed to minds. sure the next one is lined up.
over two hours of telly a day. And 3Children love to hear you Encourage them to write to the
last year a study from Australia giving characters different 8A child who has reading author stating what they loved
of 2,000 parents found that one voices. Sit you child on your difficulties can lose interest about the book.
in four mums and dads had knees, get them to do the actions in reading very quickly and self-
problems actually controlling and have fun with the dramatics. esteem can drop. Being mindful 12Lead by example. Snuggle
the time their children watched of the indicators for dyslexia can up in bed with your
telly or used electronic devices. 4Instead of handing your be helpful in ensuring your child favourite book and your child
Various studies have shown how toddler a phone, hand gets the help they need as soon as will follow suit.
too much screen time affects them a picture book. Ask your possible, so their joy in reading
concentration and mood and toddler or grandchild what can be aided and fostered. 13If an older child has lost
impacts family life. they see and what they think interest in reading and
might happen next. All this is 9Turn off background noise seems reluctant to get started,
So while it’s a good idea to slowly contributing to building to encourage your child take time to read a chapter or
monitor and curb screen usage your child’s vocabulary, to enjoy the quiet time of two from an exciting novel
and have boundaries at home pronunciation and increasing reading. e perfect time is after every night. Taking turns to
about device usage, parents imagination. homework when your child read one chapter at a time opens
may also find the benefits of is chilling. It’s easy to create a up the world of words for your
encouraging their children’s 5Picture books without reading zone or a quiet corner child and gets him interested.
exposure to books at the same words are hugely important with a soft chair and reading Once he’s engaged in the story,
time. A study of 17,000 found as they allow a child to apply lamp or a cosy tent made from he’ll plough on by himself.
that reading for pleasure benefits visual literacy skills and can blankets and lined with cushions
children not only in literacy help with comprehension and in a child’s bedroom. 14Rewards do help. Get
but in math, spelling, and interpretation skills. your child a book voucher
vocabulary too. 10Encourage the joy of for every number of books they
6Leave books and comics on books with older children read from the library.
ose children who were a low table in the bathroom, who are still in primary school
frequent readers at the age of ten so that even toilet visits have a 15Take your child for a
and read more than once a week rummage in a secondhand
at the age of 16 obtained higher meaning and reward bookshop for bargain books.
results in tests. So the evidence Let them set up a book swap
that books are a benefit is scheme with friends. By Una Rice
huge, but how can parents
and grandparents switch on 16Embrace all
the desire to love turning genres. Buy
the pages and nurture a children’s cookery
natural love... books and craft
books and let them
1 e older a child read and follow the
gets the harder instructions – another
it becomes to get invaluable way to
them engaged learn. WW
in books, so
introduce baby

24 WOMANSWAY.IE

Parenting news

Ask the expert NEW IN STORE
Morpho One mattress from
“I know I should
talk to my Candide (€139)
ten-year-old
daughter about e patented Morpho One mattress has
starting her
periods, but what a specific shape that directly enhances
should I say?”
the baby’s quality of sleep with a soft
Teacher Jade Dalrymple, head of RE and
PSHE at The Pines School, Berkshire, UK, and hollow spot to keep baby’s head
says: “It doesn’t have to be a big ‘sit down’
chat – children are super-curious, so it’s rounded. e design keeps the baby’s
likely you’ll get an opportunity to mention
periods in a natural way in conversation. Just Sun in their eyes shoulders and legs slightly raised, and
bear in mind your daughter’s personality. an included removable wedge can be
Some young girls are very private and might
prefer to visit a website to look at the facts, With the sun starting to shine, now is the perfect time inserted depending on the baby’s needs.
then come to you with any questions. Others to get your children equipped and protected from the e mattress is treated with 100 per cent
might be happy chatting about it with you. harsh light. All Vision Express children’s sunglasses
come with 100 per cent UV protection, which carry natural hypoallergenic treatment and
“Make the conversation open, honest and the CE mark of quality, and prices start from just €20 the 3D mesh fabric of the removable
free from shame. Telling your daughter about for Vision Express’ Exclusive Brands kids range. cover enhances thermal regulation for
your own experience can be a good place to For more information see www.visionexpress.ie optimal comfort. Designed for babies up
start for mums. Dads can reassure too – you to four months old.
don’t have to have been through it yourself, Available from babycareshop.ie and baby
you just have to let your daughter know
you’re there to talk to. DATE FOR THE DIARY care retailers
SEPTEMBER 29, RDS
“Avoid using euphemisms to describe If you’re a parent of a child
periods, and steer away from negative
language. Try and talk about menstruation in or children aged between
a positive way - you don’t want her to see it
as a burden. four and 18, you just might

“Lastly, show her a range of sanitary appreciate The Parenting
products and talk her through how to use
them, how o en to change them, the amount Expo taking place in Dublin
of blood she’ll produce. It’s a good idea to
have a stash in the house, so she knows she in September. Some of the
can find them if needed.
country’s top experts will be
“It might make you feel more confident to
read up on the subject yourself beforehand.” speaking about nutrition, BROWNIE’S HONOUR
coping skills, social media
and a range of other topics, Brownie maker (€20 approx from Wilko)

in addition to a parents’ is is one for brownie superfans.
panel discussion. A large Make the batter, pour into the six
exhibition area will feature non-stick compartments, plug in
suppliers of everything from and press start to kick off the baking
kids’ entertainers to single process. Fitted with a safety handle
parent support to healthy to ensure cool handling, the top
eating, mindfulness, schools, of the machine is also non-
a ercare and much more. stick so your goodies can
Pre-registration is essential be peeled away smoothly.
from www.theparentingexpo.ie
Simply delicious.

CHILDREN’S BOOK OF THE WEEK
THE LADYBIRD

by Bernadette Gervais (Laurence King, €9.99)

Just in time for the summer holidays, when little ones may
little bug-hunters will be out in force, comes soon discover),
this beautifully crafted, yet simple picture they’re born with
book that will teach children - and grown- blank yellow
up readers - a surprising amount about one elytra, which
of our most iconic insects. Starting with a slowly turn red
lift-the-flap, showing the ladybird’s actual and show spots
size compared to a coffee bean (cue grown-up over a couple
wanting a caffeine hit), this slim volume is of hours (all
packed with fascinating factoids and colourful illustrated in
illustrations. Did you know, for example, that a thrilling series of three round
ladybirds’ two red wing covers are called flaps) and, the gardener’s friend, they can eat
elytra? Or that they can fly up to 2km high? more than 50 aphids a day. Topped off with a
brilliant ‘spot’ the difference, e Ladybird will
ey play dead to defend themselves by rolling intrigue and delight.
on their backs and pulling their legs in (as the

WOMANSWAY.IE 25











Mum of the Year

Mum of the Year Awards
Who will be the Woman’s Way Celebrity Mum for 2017?

Every year the Woman’s Way team US, Germany and the Netherlands and was 5. Una Healy
asks our readers to choose who you subsequently turned into a film of the same
would like to be crowned the celebrity name. In between writing best-selling novels Singer-songwriter Una Healy started her
mum at the annual Mum of the Year and working on TV and film projects, Cecelia career in music by playing in various pubs
Awards. We think it’s really important that is a mum to her children daughter Robin and and clubs around the country and was
you get to decide the person you feel is the little boy Sonny, who are seven and four. Brian Kennedy’s backing singer at the 2006
most deserving of this title and it’s the only Eurovision Song Contest in Athens. In 2007
award chosen exclusively by our readers. 3. Celia Holman Lee Una became part of a five-piece girl group,
Our previous winners have included Mary
Kennedy, Yvonne Connolly, Anna Daly and Celia Holman Lee has been in the modelling e Saturdays, who went on to have brilliant
Amelda Maguire; who do you think should business since she was just 15-years-old. She success in the UK and Ireland, which included
join our hall of fame? began her career while at school and went thirteen songs, which made it to the top ten
on to become one of the most successful Irish and four top ten albums. While the band
Woman’s Way readers, it’s over to you… Email models ever. In her early twenties Celia’s worked as a group
your choice for Celebrity Mum of the Year to entrepreneurial spirit was born when she in the last few years,
[email protected] or share your pick created her own Una is currently
via post on our competitions form on page 29. agency, the Celia working on her own
Closing date for nominations is May 23, 2017. Holman-Lee Model solo material and
Agency. She has has been a judge on
1. Lucy Kennedy been running the
company for more e Voice of Ireland.
Lucy Kennedy currently co-hosts the Six than 30 years and e busy mum
O’Clock Show on TV3 with Martin King and it is the longest has two children,
the TV and radio presenter has come along running modeling daughter Aoife Belle
way since her first job as a flight attendant agency in the who is five and a
with CityJet. In the past Lucy presented TV country. Celia has son named Tadhg
shows such as e Podge and Rodge Show, two grown-up John who’s two-
Livin’ With Lucy and children; a son years-old.
Ivan and daughter
e Lucy Kennedy Cecile who works 6. Karen Koster
Show. She is a mum at the agency.
of two girls and one Karen Koster is most widely-known for her
boy after giving 4. Maia Dunphy long-standing role on TV3s Xposé, where she
birth to her youngest has presented the show since it first aired in
daughter just before Maia grew up in England and attended school April 2007. Before her career in TV started,
Christmas last year. in Paris for many years before coming back Karen graduated Trinity College, Dublin with
Little Jess arrived in to Ireland and studying English and French a degree in English Literature and French
December and joined at Trinity College, Dublin. Maia has written and was runner-up on RTÉs talent search
older brother Jack for Irish titles along with writing for and show, e Selection Box. Karen’s association
who’s seven and five- producing TV shows like Wagon’s Den and e with TV3 began when she became a weather
year-old sister Holly. Ballydung Bible. As part of RTÉs Reality Bites presenter on Ireland AM in 2004. Karen is
series Maia wrote and hosted a documentary married to businessman John McGuire and
2. Cecelia Ahern based on the Irish has two sons,
baby boom in two-year-old
Cecelia Ahern has made quite a name for 2012 and her other Finn and John,
herself in her own documentaries, named after his
right and is now Merlot & Me and dad, who was
one of the most Maia Dunphy’s born last year.
successful Irish What Women Want Karen recently
female writers were extremely launched the La
around. At just 21, popular. Maia lives Roche-Posay
Cecelia wrote her in London with ‘Save Your Skin’
first novel PS, I Love her husband the campaign,
You. It went on to comedian Johnny which hopes
become a number Vegas. Maia gave to raise
one best-seller birth to her first awareness
not just in Ireland, child, a boy named about skin
but the UK, the Tom in July 2015. cancer
prevention.

WOMANSWAY.IE 31

Travel news Discover

On the island

Enjoy seven nights at the Emerald Studios and
Apartments in Rhodes on a self-catering basis
from €449pp. Flights depart from Dublin on
June 14.
For details call 1850 453 545 or
log on to www.falconholidays.ie

AMAZING ALBUFEIRA Twin city
break
Soak up the sun with a break to Albuferia and spend
seven nights at the three-star Cheerfulway California Spend three nights at the Inn of
Hotel on a bed and breakfast basis from €673pps. Chicago, exploring the ‘windy city’
Flights depart from Cork airport on July 28. before flying to New Orleans,
For details call 021 427 4397 or log on to where you’ll enjoy three nights
www.dawsontravel.ie at the Hampton Inn and Suites.
Accommodation in both hotels is

Cruise the on a room only basis. This package
Caribbean is available from €1,189pps. Flights
depart on various dates from May
to December.

Step aboard the MSC For more information call

Opera in Havana, 01 664 9900 or log on to

Cuba and enjoy a www.americansky.ie

seven night cruise TAKE THREE… THINGS
around the Caribbean. TO SEE IN NEW
From Montego Bay in ORLEANS
Jamaica to Georgetown

Relax and unwind in the Cayman Islands, Visit the Garden District
this cruise includes Take a walk around the stunning
Spend 14 nights at the Clubhotel RIU Ocho accommodation in an Garden District and view the
Rios in Jamaica on an all-inclusive basis from inside cabin on a full board spectacular 19th century mansion
€1,459pp. Flights depart from Dublin airport basis. This package is available which line the streets. Make sure
on June 15. from €1,295pp and departures you don’t miss the Layfayette
For details call 1850 453 545 or log on to are available from Cork or Cemetery #1, which has been
www.thomsonholidays.ie Dublin. Various departures dubbed the most photogenic
are on offer and there is also graveyard in the world. It’s
STAY SUN SAFE the option to extend your stay. worth noting that you’ll have
Terms and conditions apply. to visit this cemetery with a
During the summer months For more information call licensed tour guide.
it’s important to protect your 021 427 7094 or log on to
skin with sunscreen. P20 is www.shandontravel.ie Feel the music
an easy way to do just that. New Orleans is a city that has
The new P20 Continuous
Spray makes it even easier to GO ADVENTURE strong roots when it comes to
stay safe. Simply spray and
enjoy continuous and even Planning your next trip? Did you know? music. Visit Frenchmen Street
coverage from all angles. Want to make it a truly Less than one and check out the various styles
With a formula that helps once-in-a-lifetime type per cent of the of blues and jazz on offer. Allow
to protect against UVA and holiday? Look no further world’s entire yourself to get swept away and
UVB rays, P20 is active 15 minutes after than the Adventure Journal. don’t be afraid to dance.
you apply it and even after spending over
an hour in the water, P20 will still give you Packed full of travel Enjoy the cuisine
the same level of protection. inspiration and great ideas, The food in New Orleans is out
€30 from pharmacies, department stores this little book contains population of the world. From crawfish
and airports nationwide has visited to delicious pastries, there’s
over 300 unique bucket
32 WOMANSWAY.IE list ideas that are ideal for Antarctica. something for everyone. Make sure
anyone wanting to push Are you in that you try Calas instead of your usual
breakfast fare. These little round
themselves out of their
comfort zone and see the special one per bites are made from rice beignets By Amy Wall
world in a different way. cent? which are deep fried, dusted with
€22.79 from sugar and served with coffee. Yum.

www.firebox.com Please note: All prices are correct at the time of going to print

Travel spotlight

Lovely Lyon Sevenreasonswhyyoushould
consider Lyon for your next mini break

Lyon is the perfect choice for your next break, Reason 3:THE WALKS history, it is also home to the biggest
downtown shopping centre in Europe, La
either as a solo traveler or as part of a couple, Scenic walks can be found in abundance Part Dieu. ere are shops for everyone here,
around Lyon, with one of the most popular from high street clothing stores, to toy stores.
group or with family. Here’s why you should being located on Fourvière Hill which
captivates travelers with its stunning views. ere is also an abundance of independent
Reason 1:consider paying a visit. stores and market stalls for those looking for
THE FOOD is can be reached via a scenic hike up a steep more unique items to take home as gifts and
Travelling to a new destination can often lead hill for those looking to challenge themselves keepsakes for loved ones.
or, for those wanting to relax, two
to a plethora of new and exciting flavours and funicular lines still operate. ose Reason 6:
wanting to reconnect with THE SHOWS
Lyon is no different. In fact, it’s hailed as the nature can head to Parc de Found in Lyon are a number
la Tête d’Or, an urban park of venue halls which
culinary capital of the world, full of Michelin- which covers an area of put on a wide range of
approximately 117 hectares shows to suit every age.
starred chefs ready to impress visitors with and features a boating e Opéra Natural de
lake during the summer Lyon hosts a multitude
their menus – many of which are altered daily months. e park also of shows including, as
boasts beautiful gardens its name would suggest,
according to seasonal produce – so that each and a zoo which houses opera, but also dance shows
giraffes, elephants, primates
and every experience is unique. ere are and reptiles, for families with a and even concerts. It’s always
worthwhile checking out the
over 4,000 restaurants located within Lyon, Reason 4:passion for wild animals. upcoming schedules when planning
THE MONUMENTS your visit to Lyon and booking ahead of travel,
all of which offer something slightly different as you don’t want to miss out on the chance of
Spread across Lyon are many landmarks and
so you will always have a variety of dishes monuments that tell a wide range of different Reason 7:securing tickets.
historical tales guaranteed to enrich your THE NIGHTLIFE
to choose from. Classic pork dishes, hearty break. Located in the old city of Lyon, on
Fourvière Hill, there is an 86 metre tall tower For those who enjoy unwinding with a
salads and traditional quenelles will all feature the ‘Tour Métallique’ – a monument built relaxing drink after a busy day of sightseeing,
between 1872 and 1884 which has now become there is a wide array of different bars, pubs and
prominently on the majority of restaurant the main symbol of the city. Other monuments comedy clubs across the city. ere’s also the
worth a visit include Basilique Notre-Dame chance to go wine tasting at vineyards located
menus, but even the pickiest of people will De Fourvière, a 19th century church hailed on the outskirts of Lyon for travelers keen to
one of Lyon’s most unique landmarks, and the learn more about the local grapes and sample
find something that suits the palette when Bartholdi Fountain, a stunning 19th century some exquisite Côtes du Rhône, Beaujolais and
fountain which was designed by the same man Burgundy.
Reason 2:eatingout. THE MUSEUMS who created New York’s Statue of Liberty.
ere are countless more reasons to visit this
If you’re looking to implement an educational Reason 5:THE RETAIL culturally rich and diverse city, so why not see
THERAPY what the fuss is about yourself?
take on a mini-break without any complaints Not everything in Lyon is Staycity Aparthotels offer accommodation in
steeped in culture and Lyon with a contemporary finish. For more
of boredom from children, the multitude information log on to www.staycity.com

of museums located within the city are the

perfect activity. By purchasing the popular

Lyon City Card, tourists are able to gain entry

to 22 museums, all of which cover different

and important elements of the city’s history.

e Musée des Beaux Arts ( e Fine Arts

Museum) is worth a visit. You can find it in a

stunning 17th century abbey surrounded by a

garden filled with sculptures, allowing for tons

of imaginative play for children.

e Museum of Gadagne is also a must for

those travelling with children. It’s located in

a remarkable Renaissance house and explores

the history of different puppets, including

‘Guignol’, a local hero. e museum also

offers workshops on how to become a

puppeteer that all ages can

take part in.

WOMANSWAY.IE 33











e votes arein

e Woman’s Way & Beko
Mum of the Year Awards 2017

MAWumARofDtShe2y0e1a7r e overall winner will walk away with €3,000 of Beko appliances
In association with
Over the coming weeks we’ll be announcing our regional finalists, one of whom will be
awarded the overall title of Woman’s Way and Beko Mum of the Year 2017. We’ll also be
showcasing the gorgeous prizes our regional finalists will receive. Stay tuned!

Books

We loved ONE BAD TURN MFUARLLKS #1Great gift

IN DEEP WATER by Sinéad Crowley
(Quercus,
by Sam Blake (Za re, €12.99) €14.99)

After that incident, Cat Connolly is Oh, I love
back at work and it’s not long before
her personal life impacts on her Sinéad’s work and
professional life. Her best friend Sarah
Jane, daughter of an award-winning I was keen to read her third instalment of
war correspondent, has gone missing
shortly after she’d been working on the Claire Boyle crime dramas. In this, Dr GREEN
a story that even her father thought Heather Gilmore is being held at gunpoint UNICORN
was too dangerous. Can Cat find a by her childhood friend. Which is pretty CARD WITH
connection between Sarah Jane’s bad, but made worse when she realises 3D TAIL
disappearance and her teenage daughter Leah has been €6 FROM
her career? And can kidnapped. It’s a particularly bad day for MOSS
she find her best Claire, as she gets caught up in the hostage COTTAGE
friend before it’s too situation – and she’s put in charge of
late? As with Sam’s
first book, Little finding the missing Leah. Sinéad’s
Bones, the writing
is clear, concise skill in writing lies in being able
and well written.
I want more Cat to relay a tale that’s at times THE THERAPY HOUSE
Connolly mysteries distasteful, at times emotional but
at all times relatable. is is a by Julie Parsons (New Island, €13.95)
story of how some in Ireland lost
the run of themselves and took Retired Judge John Hegarty is brutally
others down with them. Well done murdered in the genteel Dublin
to you, Sinéad. suburb of Dun Laoghaire. His body is
discovered by former Garda detective
immediately! Michael McLoughlin who has just

moved into the building next door - formerly

a centre for therapists and counsellors: the

RTHEEASDTERREERTEWVIHEEWRES:YOU LIVE therapy house.

by Roisin Meaney (Hachette Ireland, €14.99) JUST FOR THE HOLIDAYS

by Sue Moorcro (Avon, €8.99)

During a six-week heatwave, members of a choir prepare for their In theory, nothing could be better
summer concert. Molly, who cleans homes, sees a young boy, the than a summer spent basking in the
image of her son Philip at that age, and wonders if he’s the reason her French sun. But when you add in
son left for New Zealand. His twin sister Emily has met someone but three teenagers, two love interests,
Molly knows he’s not the right person for her. Christopher, in charge one divorcing couple, and a very
of the choir, closed his heart to relationships years before after being badly hurt. As unexpected pregnancy, things don’t
the concert date draws near, the lives of these people become entwined and they look so bright. is isn’t exactly the holiday
realise how their lives matter to each other when secrets are disclosed. I enjoyed Leah Beaumont was hoping for.

Great gift #2this book, it was an easy read but well written and another hit for her fans. HOLDING

by Graham Norton (Hodder, €9.99)
e village of Duneen has known little

drama; and yet its inhabitants are
troubled. Sergeant PJ Collins hasn’t
always been this overweight; mother

ROMPING THROUGH DRACULA of two Brid Riordan hasn’t always
been an alcoholic; and Evelyn Ross
€8 from www.atitagain.com hasn’t always felt that her life was a
waste. So when human remains are discovered
is illustrated pocket guide to Bram on an old farm, suspected to be that of Tommy
Stoker’s classic will bring the novel to life. Arm Burke, the village’s dark past begins to unravel.
yourself with some insider titbits and essential
quotes for your literary adventure. If you are in

town, discover Dublin through the eyes of one of THE LEGACY
our writers and his world-famous vampire.
by Yrsa Sigurdardottir

WIN BOOKS (Hodder & Stoughton, €15.99)
Newly promoted, out-of-his-depth

detective Huldar is struggling

Every week, we’ll be sending one lucky reader three books from the WW book cupboard. to solve the murder of Elisa. e By Áine Toner

To enter, all you need to do is answer this question: Who wrote Holding? only witness is her seven-year-

Write your answer onto the competition entry form on page 29 or text/email in. Best of luck old daughter Margret. But she’s
and happy reading. traumatised and won’t say anything.
A cracking read that will keep you

guessing until the very last page.

40 WOMANSWAY.IE

Reader fiction

THE BROKEN PROMISE

Annie reminisces of her previous life in Rome

By Mary Vear “We’re nearly out of coffee Going along the street she they had liked each other but “Annie still
so I’m going to the shops to went past the travel agents. Annie had been unprepared wondered why
buy some more,” said Annie Her attention was drawn to for romance and his early she had never
getting up from the breakfast a large colourful photograph tender declaration of love replied to his
table. Her husband, Leo, displayed in the window had overwhelmed her. When letters”
looked up from his crossword and she stopped to look at it it had been time for her to
a pencil poised over the more closely. e Colosseum return to England they had Surprised Leo questioned
newspaper as he tried to work in Rome bathed golden in promised to write and arrange “What did you call me?”
out the clues. evening sunshine was as to meet again.
beautiful as she remembered “Leonardo.”
“Would you like me to but now an unwelcome However, when at home “You haven’t called me that
come with you?” he offered, memory came flooding back. Annie had been warned by for years.”
pushing back his chair ready everyone that it was only a Annie smiled “I know.
to stand up. It was of a broken promise ‘holiday romance’ and not Perhaps I should do it more
she had made to a young to take it seriously so when often. I just wanted to say grazie
“No. You sit down. It’s handsome Italian man. After his letters duly arrived she and I am so happy that thirty
already beginning to get all these years Annie still pushed them away in a years ago you left Rome to
hot outside,” insisted Annie wondered why she had never drawer unanswered. Now as follow me back to England even
sharply. replied to his letters and it was she stood looking in the travel though you never got a reply
a surprise that it had come agent’s window her eyes from me to your letters.
“You are such a mother back to haunt her today. pricked with tears at her cruel “And to say also how
hen,” Leo teased. “I’m much betrayal. True, she had been wonderful I think that our life
better now.” ey had met quite by young and impressionable has been together.”
accident. Annie had just but knew that was no excuse. Leo moved towards her. He
Annie put on her sternest finished college but before Annie turned away to walk was smiling. “I’m so happy that
face. “ e doctors said you’ve going to work had stayed for home. e heat of the day was I did too. Mia bella Annie.” WW
got to take things easy for six a holiday in Rome at her pen increasing. ankfully she
months and six months it will friend’s house. In a coffee bar arrived at her front door and WOMANSWAY.IE 41
be!” When she used that voice she had dropped her purse opening it up called out, “I’m
there would be no room for and all the coins had scattered home.”
argument. over the floor. e young
Italian had picked them up Leo came out from the
“Okay, okay.” Leo laughed and as he handed them back kitchen carrying a tea-towel.
and held up his hands in invited Annie to share a coffee “You were quick. I’ve only just
surrender. with him. For the rest of the finished washing up.”
holiday he had proudly shown
“However,” Annie said, her around Rome. Obviously “Never mind Leonardo,”
“please can you wash up the Annie replied gently.
dishes before I get back.”

Leo nodded his head
in agreement turning
his attention back to the
crossword again.

“Before you go. What’s
another word for ‘invent.’ Six
letters beginning with ‘c’?”

“I think it’s ‘create.’.”
“ at’s it. Clever clogs,” Leo
replied and pencilled in the
word.
Annie went into the hall to
put on her sandals and called,
“Bye, see you later.”
It was pleasant as she
walked into town, there
being a playful breeze gently
stirring the flowers and trees.
Arriving at the supermarket
she quickly bought the jar
of coffee then hurried to the
warmth outside, it being in
sharp contrast to the shop’s
chilly air-conditioning.











Tarot special

ASK THE TAROT

What do the cards have in store for you?

I am struggling at the moment and I change is needed. You say you want I am crying out to be held, loved
feel that life is passing me by. I would to travel and Death urges you to break and to feel part of this man. Been
love to go travelling by myself in out of your comfort zone. Taking a with him for one and-a-half
the next couple of years, but I lack look at your future we have the Nine of years. He is Leo, I am Pisces. Can
courage and confidence in myself. Pentacles which shows an independent you please tell me if there is any
Can you see what the cards have in woman, who is fully at peace with future with him? I really like him,
store for me? who she is. She knows that all she has he is very generous to me. But I
Anon, via email to do is rely on herself. would love to know does he really
She is confident want to be with me? He has met
e cards show that at the moment, and comfortable all my children, but I have yet to
life has become boring for you. Every in her own skin. meet his. We both live on our own
day, you do the same things and life She has had many as our spouses have passed on.
feels as though it has lost its colour. experiences which M.B, Co Drogheda
have encouraged
e Queen of Cups appears and asks her to grow. e e cards show a few elements at
you to refocus right now. Instead of cards say focus on play here. First, that this man has
focusing on the fact that you’re bored the positive and listen become quite comfortable with
and feel stuck, try to focus on the many to your heart, Death being on his own. He appears to
positive things that you do have in your shows that travel will be set in his ways and the energy
life (a roof over your head, people who lead to great change in this situation is blocked in some
care etc.). e more you can do this, the for you. All you have to way. e Nine of Swords shows
less stuck you’ll feel. e Death card do is take the first step. feelings of anxiety – often this
comes next, which suggests a radical card represents worry about the
outcome of a relationship and
In 1991 I married a gentleman who turned out to be anything but a loyal, torturing ourselves with ‘What
loving spouse. For my children, I have stuck with the marriage. Ten years ago if?’ questions about the future.
I met another man through work. We developed a very strong bond. I felt
very safe. Our contact at work ended, but I have never forgotten him. In the e Nine of Swords is asking you
magazine a few weeks ago there was an article about the Akashic Record. I did to let go here. Do your best to not
the exercise and almost immediately I was in Denmark in Viking times, waiting worry about the outcome of this
for my warrior husband to return. He was lost in battle. The grief I felt was relationship. Once you can let go,
intense. Is this the bond between us? Is this what we both recognised? Can you the universe can step here in and
shed some light on this for me? bring about the rightful conclusion
Eleanor, Northern Ireland of the situation. Will you end up
with this man? e cards are
It’s important to begin this by saying that while people from our past lives do unclear. ey ask you to step aside
reappear in our present ones, we’re not always meant to be together in this and to ask that this situation be
incarnation. I feel very strongly that the appearance of this man was to spur you resolved for the highest good of
to a change. Yes, I do believe you knew him in the life you described above, but everyone involved. Rest assured,
the cards show his appearance was a catalyst to get you looking at your current if this isn’t
relationship more strongly. The Eight of Swords shows a woman blindfolded and the man for
bound. She believes she is trapped, but she could easily free herself. The question you, you will
here is – are you really happy with your current situation? You are so deserving of meet another
the type of connection you felt with this man. You deserve a happy relationship, soon. I do see
one that brings you joy. I pulled a card for your future and was met with The you happy
Magician – card number one of the Tarot, he symbolizes new beginnings and in a new
feeling as though you can achieve anything. The choice is yours, but your past relationship
life connection is inspiring you to truly think about what would make you happy. I in the future.
wish you all the best and I do hope that you find what you’re looking for. Trust that
the right
partner will
find you.

By Amy Wall PLEASE NOTE: Tarot is not designed to replace any medical or financial advice or your own free will. Tarot can guide you and show you options of what may happen.
Remember, when it comes to making choices, you are the master of your own destiny. Have a question you want Amy to answer? Write to: Tarot questions, Woman’s
Way, Harmonia, Rosemount House, Dundrum Road, Dundrum, Dublin 14 or email: [email protected]

WOMANSWAY.IE 47

THE BIG PRIZE CROSSWORD ACROSS
1 - Revoke (7)
Once a month, we will be o ering readers (and crossword fans) a super puzzle to test 5 - _ _ _ Conan Doyle: author (6)
your skills. This month, you could win an overnight stay in Killashee if you’re chosen as our winner 8 - Themes (6)
11 - Single in number (3)
WIN! A break at Killashee Hotel 12 - Adolescent (abbrev) (4)
13 - Went underwater (9)
Killashee Hotel is known to race goers as the perfect place to stay and dine in while at The Curragh. Enjoy the 14 - Bog; confused situation (6)
award-winning spa, stay in an opulent guest room, savour exceptional food at Turners Restaurant and sip post race 15 - Had di culty with (9)
cocktails in The Bistro Bar a er an exciting day. 16 - Divisor (11)
The Killashee Irish Tatler Style Icon will take place at the Tattersalls 20 - Fictional stories (5,5)
1000 Guineas at The Curragh on May 28, with a panel including 21 - Quickly finish something (6,3)
celebrity guest judges Aoibhin Garrihy and Eoghan McDermott on the 24 - Trickery (13)
hunt for the ultimate iconic looks from race day punters. The winner 29 - Component (6)
of the Killashee Irish Tatler Style Icon will receive a fantastic prize of 31 - Very dense star (5,5)
a two night stay for two at the magnificent Killashee Hotel including 33 - Man on his wedding day (10)
breakfast, champagne a ernoon tea, dinner, treatments in the award 35 - Go back on (6)
winning Killashee spa as well as a shopping spree worth €1,500! 36 - Involvement (13)
To celebrate this the prize for the Big Crossword this week is a two 40 - Athletic track-and-field contest (9)
night stay in the majestic Killashee Hotel including one dinner in 42 - Poisonous chemical element (10)
Turners Restaurant and breakfast each morning. 44 - Uninvited guest (11)
48 - Massive land mammals (9)
For further information visit www.killasheehotel.com 50 - Holds one’s ground (6)
51 - Filled with wonder (9)
52 - The sound a pig makes (4)
53 - Relations (3)
54 - Eccentricity (6)
55 - Strong-smelling bulb (6)
56 - Let up (7)

DOWN
2 - Happening (5)
3 - Very intense; absorbing (9)
4 - Short close-fitting jacket (7)
5 - Nocturnal insect-eating mammal (9)
6 - Vehement denunciations (7)
7 - Cowboy exhibition (5)
8 - Musical speeds (5)
9 - Weatherproof coat (5)
10 - Get rid of (4,3)
17 - Chilly (5)
18 - Building for grinding grain (4)
19 - Longing for things of the past (9)
20 - Complete trust (5)
22 - Exceed (5)
23 - Public meeting for open discussion (5)
25 - Vigorous (9)
26 - Participate in a game (4)
27 - Franz _ _ _ : novelist (5)
28 - Refute by evidence (5)
30 - Metallic element (4)
31 - Planet (5)
32 - Type of chemical bond (5)
34 - Woodwind instruments (5)
36 - Hit with the fist (5)
37 - Having equality of measure (9)
38 - Cyclones (9)
39 - Tiny parasite (4)
41 - Played out (7)
42 - Act of reading carefully (7)
43 - Penetrates (7)
45 - Dissatisfaction (5)
46 - Hazardous; dangerous (5)
47 - Very informal phrases (5)
49 - Adjusted the pitch of (5)

To win simply complete the big crossword
and send it back with your name and
number to Big Crossword 20, Woman’s Way,
Rosemount House, Dundrum Road, Dublin
14. Closing date May 30.

48 WOMANSWAY.IE


Click to View FlipBook Version