2018 BNCW and Sangster Motors Home Tour & Remodeling Expo

( THE BUILDER ) LEXAR HOMES

Lexar Homes is proud to be in our 9th year of 509-663-1722
calling the Wenatchee Valley home!  Owner Rob www.LexarHomes.com
Eldred has put together a strong, experienced
and dependable local team to take care of every Contractor Number: LEXARH*909QT
detail in your new custom home.
BUILDER HOSPITALITY
At Lexar Homes we feel that our customers deserve a home that works for them SPONSORED BY:
in every way, including size, style, amenities, and maintenance while being cost-
effective. Just as important, your home should provide a safe, healthy, comfortable
and sustainable environment for your family.  We are passionate about having
our home owners involved in designing & building their custom dream home,
giving them every opportunity to move into their new Lexar home with thousands
of dollars in equity.  We’ve also put together packages for those of you with busy
schedules, who want to leave the details to our knowledgeable Lexar team.

Visit us on the web at www.lexarhomes.com or stop by and see Shawn Larson
at 147 Easy Way Ste.104, Wenatchee or Chris Peck at our Moses Lake location
at 2707 W Broadway, Ste. C, Moses Lake.  A Lexar Home isn’t just a decision to
Choose Right; it’s a choice to Live Right.

Create your perfect at-home retreat with a Bullfrog Spa.

(509) 662-1590 www.pooltospaservices.com 160 S. Worthen St.
Wenatchee, WA 98801

51

#6 WESSMAN CONSTRUCTION, LLC

182 Grey Goose Lane, Malaga

Upper Floor Lower Floor Bedrooms Bathrooms • FEATURES WITHIN
4 3 THE HOME •
1,770 1,030
l 4-Car Garage; 3-up and 1-Down
l Antique Blue Pine Ceiling
l Two Faux Trusses Made From Old

Telephone Poles
l Large Wrap-Around Partially Covered

Back Deck
l Wide Plank Engineered Hardwood Flooring
l Use of Two Large Custom Barn Doors
l Granite Countertops Throughout
l Stainless Steel Appliances
l Custom Hood Over Stove
l 9’ Tall Cabinets w/ Glass Inlay
l Custom Walk-In Tiled Shower in Master
l Large Free-Standing Soaking Tub
l Amazing Views All Around

( THE BUILDER )

Wessman Randy Wessman and Christian Wessman,
CCOONNSSTTRRUUCCTTIIOONN father and son, are second and third

integrity quality design generation builders and have been building
in the Greater Wenatchee Valley since

1999. Randy started building in 1986 after

he graduated from Central Washington University in 1985 and Christian joined
the team 4 years ago.

With over 32 years of construction experience as a licensed contractor, Randy Christian Wessman / Randy Wessman
truly enjoys all the aspects of the construction industry. Together Randy and WESSMAN CONSTRUCTION, LLC
Christian have a passion for the design aspect as well as new construction,
repurposing of old materials, recycling and salvaging materials, helping to take 509-264-9662
unique natural resources and create a one-of-a-kind finished project for every www.WessmanConstructionLLC.com
client. From rustic to craftsman and everything in between, they work with clients
to bring their vision to life in every project. Contractor Number: WESSMCL852N1

Integrity, quality, and design, is our motto and the core of what Wessman BUILDER HOSPITALITY
Construction LLC. is built upon. From helping each customer design the perfect SPONSORED BY:
home, to personally overseeing every aspect of the construction process. Randy
and Christian’s construction style is “hands on”. They complete several phases
of the construction process themselves while at the same time consulting and
utilizing local craftsmen to create a unique finished product for every customer.

With chef-inspiredWsdmeitahsritcghfnee,afs-tmuinraseprsitraefneddadteeuxsrciegesnp,taionndal
exceptional perforpmearfnocrme.ance.

Open 1729 N. Wenatchee Ave., Wenatchee • 509-663-1671
8-8 WEEKDAYS www.savmart.net
9-6 WEEKENDS 53

#7 LANGE CONSTRUCTION, LLC

1702 Brambling Brae, Wenatchee

MAIN FLOOR • FEATURES WITHIN
THE HOME •
Cov’d Porch
l Custom Cabinetry w/ Custom Finish
Garage Bath Entry Office UPPER FLOOR l Dry Bar
Mud Rm l Double Master Suites
l Custom Granite Sink
Great Room Bedroom #3 l Custom Bench in Laundry
l Built-In Entertainment Center
Bath l 10’ Garage Door for Boat Parking
l Custom Welded Cable Handrail
W.I.C. Pantry l Private Master Patio
l Black Vinyl Windows
Shop l Double Door Entry
l Contemporary Designed Designed
Dining Kitchen
Master Shower
Bath Master Bonus
Suite

Cov’d Patio

Bath

Living Space Bedrooms Bathrooms Bedroom #2
2,412 3 + Bonus 3

( THE BUILDER ) LANGE CONSTRUCTION

Andrew Lange, owner of Lange Construction 509-860-3604
began his career in the construction field right www.mylangehome.com
out of high school, along with his twin brother
Alex, working with their dad, Bill, building The Contractor Number: LANGECL857DR
Fence Store by Eagle Vinyl Fence. Andrew
worked hard and helped build the fence BUILDER HOSPITALITY
company and soon, he and his brother took over the very successful business, SPONSORED BY:
now known as Eagle Fence Store.

In 2014, Andrew built his first home and entered it into the BNCW Home Tour.
His abilities to be creative with the new technologies and smart living were
taken very well by the attendees and his home became award winning. After
that, Lange Construction has had three additional homes featured in tours.

“When designing a new home, we like to give it our full attention to ensure that
we build quality homes that are tailored to the people we build for and today’s
lifestyles. That’s our credo: innovative homes and enduring communities. In
other words…living designed smart.”

High Quality Custom Designed
Pools and Spas FREE ESTIMATES

Dan Rookard • 509.679.3840 LIC. #ROOKACP935KJ

Liscensed • Bonded • Insured 55

#8 SAGE HOMES, LLC

223 Pershing Circle, Wenatchee

Living Space Bedrooms Bathrooms • FEATURES WITHIN
1,729 3 1.75 THE HOME •

l Quartz Countertops Throughout
l Custom Mantel Electric Fireplace w/ Tile

Surround
l Walk-In Closet in Master
l Tile Master Shower
l Dual Sinks in Master Bath
l Stainless Steel Appliances
l Vaulted Ceilings in Living Room
l Patio Off Kitchen
l Huge Center Quartz Island in Kitchen
l Abundance of Cabinetry
l Professionally Landscaped
l Fully Fenced

( THE BUILDER ) SAGE HOMES, LLC

Sage Homes LLC is led by Brad 509-899-9800
Selland, Jason Gaul and Adam www.sagehomellc.com
Brizendine, they have 50 years
of combined experience in the construction industry. Sage Homes Contractor Number: SAGEHHL860OB
specializes in residential new construction in the Greater Wenatchee
area and is built on team work and the dream of providing much BUILDER HOSPITALITY
needed quality homes at an affordable price point. Our group has a SPONSORED BY:
solid base of construction knowledge which has given them the insight
to seamlessly orchestrate the various trades and discipline to come
together in the assembly of constructing your new home. We believe
that value should be delivered into each home by providing the highest
level of quality but yet still affordable. We take pride in each step of the
process of building your new home.

Home buyers appreciate the personal approach from Sage Homes, and
can rest assured they will get a beautiful home suited for their family for
many years of joy to come.

PERSHINGP L A C E MARYHILL
ESTATES

Why Rent When You Can Own A Sage Home?

Rebecca Hackworth

Cell (509) 899-9800

[email protected]
www.premierone.biz

PROUDLY BUILT BY

57

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Fire Extinguishers

Source: NFPA.org • For the home, select a multi-purpose extinguisher (can be used on
all types of home fires) that is large enough to put out a small fire, but
A portable fire extinguisher can save lives and property by putting out not so heavy as to be difficult to handle.
a small fire or containing it until the fire department arrives; but porta-
ble extinguishers have limitations. Because fire grows and spreads so • Choose a fire extinguisher that carries the label of an independent
rapidly, the number one priority for residents is to get out safely. testing laboratory.

SAFETY TIPS • Read the instructions that come with the fire extinguisher and be-
• Use a portable fire extinguisher when the fire is confined to a small come familiar with its parts and operation before a fire breaks out. Lo-
area, such as a wastebasket, and is not growing; everyone has exited cal fire departments or fire equipment distributors often offer hands-on
the building; the fire department has been called or is being called; and fire extinguisher trainings.
the room is not filled with smoke.
• Install fire extinguishers close to an exit and keep your back to a
• To operate a fire extinguisher, remember the word P A S S : clear exit when you use the device so you can make an easy escape
-- Pull the pin. Hold the extinguisher with the nozzle pointing away if the fire cannot be controlled. If the room fills with smoke, leave im-
mediately.
from you, and release the locking mechanism.
-- Aim low. Point the extinguisher at the base of the fire. • Know when to go. Fire extinguishers are one element of a fire re-
-- Squeeze the lever slowly and evenly. sponse plan, but the primary element is safe escape. Every household
-- Sweep the nozzle from side-to-side. should have a home fire escape plan and working smoke alarms.

Western Materials Complete Construction Services
stern Materials
New Homes • Remodels • Additions • Decks
LANDSCAPING
Ph: 509.630.3317
RETAINING WALLS, PAVERS,
OUTDOOR FIREPITS AND BOWLS Lic.# OLSONCI019MW

DECKING / RAILING www.OlsonsConstruction.com

DOORS & WINDOWS CUSTOM HOME BUILD RECENT REMODELED SHOWER
LUMBER • DRYWALL • ROOFING IN PROGRESS

With the most capable delivery fleet in Central Washington, RECENTLY COMPLETED RECENT REMODELED KITCHEN
Western puts your materials where the other’s can’t. CUSTOM HOME

509.886.5182

5704 Nelpar Drive • East Wenatchee, WA 98802

58

New Home Building Permit Curious to know how your home compares
Requirements in today’s fast-paced market?

Source: Ryan Kelso, Complete Design, Inc. Call for a complimentary analysis.

The following list provides a fairly comprehensive look CHRISTINE DOUGLAS
at the scope of information to be provided, issues to be
addressed, and permits required in the construction of BROKER / REALTOR®
any new residential structure. Every jurisdiction and every
project may have unique requirements, so be sure you (509) 264-7411
know!
[email protected]
R Application Form Completed wenatcheevalleyrealestate.com
R Special approvals are signed
R Plans Complete (Submit 2 - ¼” plan sets for review) Follow on IG and FB @wenatcheevalleyrealestate
R Vicinity Map 59
R Site Plan
R Site Grading for hillside or sloping sites
R Floor Plans
R Elevations
R Section View
R Structural Details: Rafters, Joists, Studs, Beams,

Headers, etc.
R Structural Plans: Foundation, Joist & Roof framing

Systems
R Door Schedule: Type, Sizes
R Window Schedule: Types, Sizes, U-Values

(Glazing Glass)
R Truss Engineering Specifications Sheet or Truss

Verification Letter
R Legal Description, Parcel Number and Assessor's

Parcel Map
R Septic Permit (Health District) or Sewer Hook-up or

Re-Use number
R Water Supply Availability Certification
R Electrical Permit
R Driveway Permit
R Address Permit
R Legal Access
R Critical Areas Addressed (i.e. wetlands, flood plains,

geo hazard, riparian and shorelines)
R Washington State Energy Code compliance

calculations
R Heating Calculations
R Land use requirements (i.e. zoning)
R Fire Sprinkler Requirements
R Contractor License
R Excavation / Grading Permit
R Drainage Mitigation
R Soils Report
R Environmental Checklist / Review
R Plan Review Fees

Note: Consult Your Local Building Department for Specific
Requirements

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

What Should I Do Before Meeting With a Designer?

To make your meeting with a designer more productive you should • Subdivision specific CC&R restrictions - bring a copy if you have one.
gather up the following information and bring it along with you (or send
before a phone meeting): • If any height restrictions apply, what is it and how is it measured?

• Building Site Information. • If an architectural review board applies, provide any information
available.
• Boundary survey with property lines dimensioned including bearing
information (e.g. Lengths and Bearings). • Lateral engineering requirements; design wind speed, exposure,
seismic zone when applicable.
• If there are any curves in the property line be sure to include the curve
data table. • Identify the general parameters such as area target size and amenities
required.
• Make sure that any easements are shown and identified.
• List each room and include specifics desired such as size, orientation
• Unless the lot is dead flat, include the topographical survey showing or other features.
the lot slope.
• Identify architectural style desired. Any photographs or clippings from
• Identify any views from the property. magazines are helpful.

• Provide the legal description. Scheduling the Meeting :
After you have collected the information listed above, contact the
• If your site is steep, a soils report is often required - bring a copy if designer to schedule an appointment. Depending on your location
you have one. and needs, the meeting may be at their office, or via phone, fax or
email. Being prepared for your initial meeting will help to avoid any
• Zoning designation (e.g. R-1) and building setbacks. unnecessary delays.

Award Winning Tour Homes

www.LenssenHomes.com
Lic# LENSSCL962PN
PROUD MEMBER

60

Homeowners: Sales & Installation:

Don’t Forget to Budget for Repairs Smart Homes
and Maintenance Home Theaters
Audio/Video Systems
As a homeowner, it’s a good practice Home Networks
each year to set aside 1% of your Custom Integration
home’s value in order to cover
necessary maintenance, as well as Home Services:
those inevitable emergency repairs!
Furnishings
Here are just a few of the more common expenses to keep in mind: Mattresses/Bedding
Window Treatments
• HVAC REPAIR OR REPLACEMENT
Room Design
• CLOGGED OR LEAKING PIPES Color Consultation

• ROOF REPAIRS

• HOT WATER TANK REPLACEMENT

• SEPTIC TANK MAINTENANCE/REPAIR

Located in the heart of Downtown Chelan
and servicing North Central Washington

131 E Woodin Ave
Chelan, WA 98816
Open Monday - Saturday

9am - 5:30 pm
www.deepwaterhome.com

509-682-4529

61

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Why Should You Get Your Air Ducts & HVAC System
Cleaned? Source: Verl Sutton, Clean Air Connection Duct & Cleaning

In addition to normal accumulations of dust and dirt found in all homes others. Allergy and asthma sufferers, as well as young children and
through regular use, there are several other factors that can increase the elderly tend to be more susceptible to the types of poor indoor air
the need for air duct cleaning: quality that air duct cleaning can help to address.

- Pets THERE’S A REASON THEY ARE CALLED AIRBORNE VIRUSES
- Occupants with allergies or asthma
- Cigarette or cigar smoke Cold & flu viruses, fungus, mold and bacteria, live in your home and
- Water contamination or damage to the home / HVAC system building’s heating ducts. Every time the fan kicks on, you breath them
- Home renovation or remodeling projects and they could be making you, your family or your employees sick.
- You are dusting more often than you would like Fortunately, there’s an easy solution. Properly cleaning and sanitizing
your entire heating system and air ducts.
Some occupants are more sensitive to these contaminants than
INSPECT YOUR AIR DUCTS

You can tell if your heating, ventilation and air conditioning (HVAC)
system needs cleaning by one of two ways:

First, with a screwdriver, remove a floor or wall register, then,

  1.  Use a small mirror and flashlight, or
  2.  Use a digital camera to take a picture inside the duct.

AUTO Insurance NOW PROVIDING...
Electrical Services and
Employee Owned Solutions for Your Home

HOME & PERSONAL • Lighting Upgrades
Insurance • Fan Installations
• Outlets & Switches
• Breaker Service
• Panel Replacements

662-6262 Lic# PATRIPH902D5

Nicole Mike
Holderness Poirier

BUILDERS/CONTRACTORS 509-664-2929

Insurance WWW.SAVEAUTOHOME.COM

[email protected] 118 N Chelan Ave www.CallPatriot.net
[email protected] Wenatchee, WA 98801

62

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Do-it-Yourself or Hire a Professional?

Source: Builders FirstSource

Do-it-yourself (DIY) projects have If you cannot complete the
skyrocketed in popularity on the project according to your
heels of Martha Stewart Living, original schedule, are you
HGTV and other popular home- (and your family) prepared to
improvement programming and handle the resulting
publications. And for certain small inconvenience?
projects, a DIY project can be
rewarding and fun – if you are Will you need assistance
prepared and have the proper skills. with this project? If so,
Before you start knocking down walls who will assist you? Do they
and taking out wiring, ask yourself have the time and skills
the following questions: required for this project?

Do you have a clear idea of Do you understand all the

what you want your project to safety issues associated with

look like? this project?

Do you have the time to Are you familiar with the

complete this project? architecture and structure of

your home (i.e., how

Have you ever undertaken a knocking down one wall will

project like this before? affect the rest of the

structure)?

Do you know everything you

will need (materials, tools, Have you considered the

etc.) to complete the project? hidden costs associated with

doing it yourself – time,

Do you have all the tools you tools and the possibility that

will need? you may actually decrease

the value of your house if

Where will you obtain the the result isn’t up to

necessary materials? professional standards?

Are you familiar with the It is easy to look at the cost of
applicable building codes hiring a professional remodeler and
and permits? think only of labor and materials.
But remember that a professional
Do you enjoy physical labor? remodeler offers you an important
service – years of experience, the
Do you have the necessary right tools, a network of suppliers
skills for this project? If not, and subcontractors, and an in-depth
do you have the time and understanding of legal regulations,
resources to learn these cost estimating, scheduling and the
skills? latest construction techniques.


63

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Fire Resistance

Source: Chelan / Douglas County Extension

FIRE OCCURRENCE IN NORTH CENTRAL Landscape Zone 1: 0-5 feet if the structure has one-hour

WASHINGTON flame-resistant siding OR 0-10 feet if the structure has non-flame-re-

On average, wildland fires occur in Chelan and Douglas counties be- sistant siding. In this zone, the goal is to prevent ignitions on or near

tween every six and 30 years. Wildland fire has been a part of the a structure.

North Central Washington ecosystem since the retreat of the Conti- • Plant no trees or shrubs.

nental glaciers more than 10,000 year ago. Wildland fire is an essen- • Use only inorganic mulch. (Rubber mulch is not acceptable for use.)

tial part of the environment in this area. Fire serves as a key compo- • Plant fire-resistant plants with high moisture content.

nent in maintaining a healthy and productive ecosystem. To reduce

fire damage in the fire-prone wildland urban interface of North Central Landscape Zone 2: 5-30 feet. In this zone, the goal is to prevent
rnalcDFNWeioerefriaetnohnscshCciubeinnrlergterStnapolcaWenciaenshingtononTansnrcrcoihltemesatcaWfeit-nhuaiaeptrnatsamTWfrerOasalarheineeonsairslghcrixnswsmaaWCpWdeaTmpDsadsaoeinfieottoebaatenhptsateonnnuha.aasrnbie.graeeelphariEwmokCsneyiyyuvvdtencWlerCernednnieesndsllestebtiainoacssiiooaFaarhtyilnlythhgesrmhblmdgeatto.fw3sosusnladneiniiihscinnbetEtutmatoronl0An,nng,lfiataoodoetopiaaeoiitrllmangeifdmlgmlyschdomantacnNnsniinrdsdnntan,trehottetia,ntddeetiympwwdeaioiendpllipayfmnphnoSooefatbvimosirenctpnoffnirimoeahasangfisolleneanNereeudndrirItf,eemr.amtnrttryseo.efcscsBtodapWtlellateatgretneaaythan,dhtntweoirnnnoihatelrisnntckioviatunoeLuevaosilttmoihorehngtiaedddDaisilefwmktisihnrpeirrlwfEbnnlnamaldlhCeabiefafeosntooearnriittleactnnctsehsoneererme,vhrnhanmecrupieteaaselntStsedd-imzseeiaawernireossramosorpgr.ttsabeeoepep.osneafrinofHpPonaetwNhipnTileanpsrispoenrcdrseeanclsoodiyshltieamebofAnosarotnrnrctasnWosofmshetiot-suorcensmhumeaisoraepetoprwrntaCfcponeealarhepctesirnensonrbrrpibsopvhsoesinneolienioetetrfroantenehuEahiea.ietnarbeuvgeirslprtwCvhicCoiratcririeCeene.etcntraylcnnbtoocaemteyanatnweWhhgeemwounatfeutnfcehntnietponweiihififitrtienntonrirnaaosetiilelnoeilcrwscsdtrataolenadiannadeesndgh,elfsroanotied-etllnnpyNnnnaitovreatbarNblrvtanbansafahaoeaogetealneeiueockeem1aythnrkrsysoectsfnrWdsnratatneaerhtt.sk,0dettofbtiareitlrhdtltov.iiunnr.ustoheuowo,ahitHrnguDmnuaietn0FfsiertahrmcnsomaDdslfapbeitotooiagemc0tiCtlctdsthhdraedpauonrnceupeCimatee0tdpezeeaenkeitiresiiamit.gprfeennoeonpeooroeenteilnNhsylppriwhosieTgaeennangldsvnfsnseotoeorewlrortsnstr.arstaoouettmtosiemortsrmoeaavArbtlrcn,mviopctsnvwmilucnlrarlobehocieedeotesfrinentlutceeitnnaulirsislrtflWvaCobaieevsnast.octoyneefemutwefWuhoeatetentrnetearosnrersiheiftemnsdsosi,eenlschctlpayaa,ehdmtfsrotaioheinahnnaaarfaplNlfrnbnsiiiailrekigevccner1nyphnsofeonoWfeeaaeies0tgsioitrnridmn.trmnrntsmwo,att,amtuee0Fahho.sfifbtpaiemco0siiiflhraeernbzriCTfeteere0wserkieiosi.ieunefrnoethvatesLLyoiuewhhbTngrlnefeeteeddlioaatrinateeutomtirgoacrverlrlevopvinnlatesarenhoeenlpparhnclisrdduuuuguuuufottmvsaoyioraadheeeressenrrnprearesiccttnaeePMCEMEPKs----..taatllelleliiaahaeippmmrennniaaaeenpiiittnttmnnteZZsssm•s•i•••r•L••aauaagdiehiiLLootnizPEMKMPECnnattnrpndaaareuyeennbgglllleilunnnuyiaaaiitecnwdmmeeyiegslllcddgufuuuuuuubcionnatdeeaibnieppourmeersseiiantt32snednntoeccsanrPMEECPKMstrnalsss::ieaaepaalrftdlltshelldeulzuci-iiaaiiiithahieeh53ppnamm.ttnnrenogrsreepirnnniaeeaaaerenfueen0-pdpiuggunrttiinuttmwu3dnngtsdpe-unlcllZZrbasssm(abhifaeeoe01uaac/rediehiiitoooutoeiczennsosnesttdfpnele0ahlraentseennbefs.ledgguuuuaydrta-dse0pwdhda.eetyKgedlllcselb,nsrtZieee.absee+rntrorefpeaef23tsnfddufru.oieaggtstatnrolhuuraas::eplrfdsh/ndr.ufobefe-icitre53soerieecugrsrinpeiIrneotsnmeenetenfu-0unpuulehnereetu3dsy.dseu-unhenbarw(sifdate01lfps/.i)tfK,utsoecarsnnu.bseeal0thharefegs.edw.tuutetIt3de0ddechau.uraKdnelit,rslsrseee+msteellioief:,tnfrrn.ngsttatfrhieepatgnedasuzr.fouht.acerfnhrei3eipsIoounnrinmeetnpwyegdeeenb0yoicunewdndwstrfpl)detey-grnbu.boeulahe1reaawoszi,Itflddewueutnnmiltlsusa,0en.oshlwali,rngestfietltegn0amizdnuchtn.eeeghhcrdfnonlril+eigldodneaoidnlcrroendablssl-eoaegroao,sia.seasonwzfttewwgwtttmdmteeps,enoewd(hretlleom1edddncnieeareeshennellllet0aadsllaecoealbltds-.-ofa,ls.soerl’sgessred.wgttwdoprsfeIipnhrtdondfro1dseaaremoeeuoas10a.eecaltpotlltiscole’t0gemlrrtolrhhsfbaityedoslf’rseaiforsuiouer)s.udpfaseputtta.sremrrolhe.hpaatotrncltirzoserislpasemeuttisga.ornvhturrdct.roneignaiegeetegtrt.vudheitrrengdetegeero.Se,AWD.iirentdudtemoERouTI.iNtTtEuago.tcuHAnhESnsabcnnI?rEenNePneoedsCdyscyTtOurot.oH.TglhshVssoEnuuHEpoepeRRsdrorEracRherOCe.crheOelFeEaresoMeaaSdiE.sMtsHttado:h.RoEtNUIeftSoBDaoTarSEHfDEORaDREEAFTERCNEOES
SpacenHnepoibfnoimnerptphnftsftaeaohotaroorlwsmdrmoeeurnomtoteevehvraciootwldiuufetirodendeeaueauctinilnsinsanryccantf,feieusteogiobferpdriiareirnrneadbrmesesenoeatelgw,dfwdettefieaofneeogeifevwalf.nceshdofieretntCediptfcsehsnltiegrdnrtratedhrwferaelrdhisiceaouv’musrasiinsaeamlneectcdsitodnprnegituenlasddsntavputsncetoaheegn,htienredtmiguopeodtwspndereomimapaetfsgistvneyllorarsee.draeolofttoreasyAnsfeitgmsinomnadfhrnsceprdbnene.eoetatsr)yt’labaimsnonpiwcoabbtputsatnoiinheiconlsrlprdnneiaeocs,tnntrctryeteovha)estotsifntnitasapamfdwoneteshkkgvraciecihsoneoentteactppyiegimgtrnnevrthbhtreaeowseheoyibaaacnassseidvrpnletwedwfo,.eeerefHfiwgpuioalioitadrlaeishbnentdrrfavtoeoibiagedi(rlllnnocaesityratieg.reoytonarDvebnscadteheeasdohdfngteeewaeaselfntspfenpeaetsnbsakedrnibdeeentspileeiiaoetnabrnogdnoglsberm.pptuhehesrHaorosopaccndamstaetsieinc.vfteiciebsghiestneodbgesyena
thbeefitrwe eoeftnenadestterurmctiunerethaenfdinaalnouotncocmome. iCnrgeawtinildgfdireefe(nosribbleestwpaecenaraoubnudraning

STEP THREE: IS THERE

DENSE COVER OF SHRUBS OR

WITHIN THE RECOMMENDED DE

AREA?

mes from catastrophic wildfire. Defensible space is STEP THREE: IS THERE A CONTINUOUS Sometimes wildland plants can occur as an
re and an oncoming wildfire (or between a burning rupted layer of vegetation as opposed to being
DENSE COVER OF SHRUBS OR TREES PRESENT widely spaced individual plants. The more con

etation) where nearby vegetation hdaesfebneseibnlemsopdaipcofndiseanedpladnts patio Firebrands (Sparks or Embers)WITHIN THE RECOMMENDED DEFENSIBLE SPACE
ity and ability to psatpio read. Having a AREA?
shrubs and landscaping and dense the vegetation, the greater the wildfi
If this situation is present within your defensibl
area, you should “break-it-up” by providing a s

also hBeeflopres protecdetck those who are defendAinftger homes bydeck between plants or small groups of plants.

WildfireRtehprleacaetethnesdrhaowimngeosnipnagthe r5eweithwtahiyssd:rdawirinegc.t contact by flames, radiated heat,
and firebrands (burning embers). More homes burn due to firebrands than
egress. gravel due to any other cause. When fire conditions are right, firebrands can be lofted
(no plants)

gravel
(noplants) high intIon bthroeadalieraaf envdertgrreaennsspeoctrioten dthemfoonrtesiztehavanrieas.mItinleeefdrsotmo btehceonmsisateinnt.fire. Firebrands
gmalusatotteecrraisan,SlasbtasneruteinccwgahSDWrofranEiTiIrNseTpeHEdaSdIgEeNrPbeaiCey3sTOd3HiTwlVyEgHEinRcRraEadROCsnOsaFE,sMnfStEadaMHl:rRElfteiNU.IrSnBeDHTSElHoweDEOmahRDRvEieEreAFTlossERC,.NwEOwIESfnSNIofBeiTLPorIrEeNRdsbESUcSsPrOaEAhaUNnCnaSTEkdtaeskrleaonoarwadunfcipsddtti,eeidnSloldeyoennlemsaaspeyaefatett-scoirhmeioeolderyfvrseiveniwndgedggeiieulvtendaitecldtaiaittduoeniaaondlln,tebppthah-lllsaaeefennioglttplssrep.ecaodaTtsneherdeotchmtcoeuob
plants and landscaping

Home Ignition Zone and Firebrands (Sparks or Embers)FIREBRANDS (SPARKS OR EMBERS)Wildfire Fuel Species
ponds and plants patio Wildfire FuelThe mshorusbstainmd lapndoscratpainng t Ecology ignition potenAtRiaElAo?n and immediately adjacent to the homaIfreethat,isoysoiuctuosahtTmiooYunblPdisaE“pbtSrreieOnsaekcFn-itotDw-muEiptAh”iinbnDygyVporuEorvGdiedEfi
firebrands.
defensible space, or thing you can by flambetweesen,DprElaaAndtsDioarFstUmeaEdllLghrToueYpPsaoEtf,plants.
a safety zone, dimomisecdrWieaatetielyldfireRtehprleacaetethnesdrhaowimngeosnipnagthe r5eweithwtahiyssd:rdawirinegc.t contact
Wildfire threatens homes in three ways: direct contact by flames, ra-AfterThe flammability
HOME IGNITION ZONE AND LANDSCAPE ZONEStype they are. In
of individual trees aenvedrgfureeelsnvnaerieedsldesepaerendminogreofnlawmhmaatbdleeck
general, trees with
ZoonLnaZneodssnceapaenZdones BuildiBnugildMinagteMraitaelrsialsucbtasoegrrkleepesaetpcericreinennsontespdmenieeenitsfITpLceInoaedcsggegrnnrr.ilhnaoeeeawIdteaMTTawna6natdehennoviurn-s,heafnveelntrdsnleieatinatt4siriiobhhnegehaiwstttfadgOuuurwmtagbrtrHptdsveiihiilnhreetspdieohoeoemeerooi1oaesitrrRcnaeeahocdouanmetdassndcnncnnuiUPPstac0iaplsbttemgfeHea0etiey-ae1mlrldhalll0larpbes0ay0eZZrantaaavDlrr-isp,oifceen3e.roeteMa1.sy0ainnnhdidooe(aLnWefeslaneittlfln.dmybd0ssorIndtttnnorfneobloak(gal(ioeeceo1Ea2Ziiecnqtfn)nieeifsrIx)tsdkenunnionnmhsdetv2uhaohidlrttspoecatgiaoeta.pteyslcignveedau,nuveart0inenstrfietueajslsInitheatib-v)iicelicsaategvtsoeomn0eenrenrdnaraaeheliivternmeZc(vpteeecwnfnnnZsatogeosah1eeecoboesss,f.tanbteoeognd1TWds2TSirlnweehmtilnZ.e:nmchsehettae.ugshapfTitiepho,itnTiHaevs0lbiheotewfhdsretoweohfineHainltrailusereeeehlaideo-hitfianotnieblorannbllawmacn5gdsIesogefneEnetdeummceeicnetwldssl-exifmt(lZornoleasmmrentnacdahfrhtiwrmhsxuofbZegdmnaeeies3bsuZmidtseca)oreo0ppinebasanem.tfmtlertlelifeevliJarfissaotoecpepnvi.amanaeuwrtnenlsiimesioaulevemcbttdntaatonsgsgrInrnudkemelebIe)peieseZbguppnnhn,eitpcsgepasiZcsrrolfyeinsneFebnaseonnrilgcsorsteostnespdbtldo.nene.eetieenceesuneahtds.rpirnpaledhuocseMe,etticlibnnre.ilsnawfee0a,w.hanteriaitdne,en-su,3snsotai-el,e(sneesoh3ta0odotpilReaasiaet0nntsgpt-rnootvngsta1ineedlhuvElthiu0tfcamhecdprsltchnrariZni0abebosinna.ceecuetienslhonZd7lnofor0yTtsbtaogtenod.scocfiegtiaatnhaan.uionhfgpeWtnefeutenratilonoysceui-ethondhartgoagcurnntfhoiy,mslrrblnaedemdtetfuaagemteaudeewifzafistijiinmelobctradaausyroilhfHLerohuoeaiinecitnglgalitaraezlrngiee.cdea-nhaoeeeM1wd2assnousnns.ixr-,.rhuniT.iWoe(dtnTttvs-nraenmdinphhgdrcsdhimousoriiergheohtdtseeiwtsoienxrtepr,F.aIs1isenrEmonslf5c3261bl4(sieuibibveuaeroreoa.iltextr..res.eeac..tssnaahT:toceeinkdaRRtWMClwe0nxtsehehiftsssnswriynstcmaeecdepeirtcn)iiaiabssnclkesenmmcndttra-IHoi1fisoteroiee0vaipn,r0)nseptteiehagooftveocnP.irdttertnewroiwgeaeenavvteeanyferaeZiearneneepoaouooeeeinsnnZsnsetottnyrn-srenudaraaeoitonektntdbntdnyo.keridtuomplnZnntaneiiemloevhosatcbllkdu-cuugestepMeyh,oeusceuscrropudn0,earaocirvmooroleriena3dislle-teornudew2mtdapuoh3ti0fedoongenapenlaicsietcd0nn(lb-rgodt,nwictnofan1i1smisgp0annuedHrb0iiun0deeftimnaa.tsoctnsoennige0snzeddirs.ftmfasraterdtseett0iees(nycaibferdo3b3stgtZar(astoomss.gllib0wleiaiatnuahetwnabuvongerooubcWt.xdmreecebnrrftteosfaotwesoideloeai5deoplzIaf-fen-unnrinlteeosicroatnltfbnlncnmdor.tedthrdetfteencperMhbuadteawifefeahnafeafefsueeirrinmivueltahbnosrltdneetesofeeasrseemrkdwioaoum)iualvdhoIrnsgleiineigrgrseigerzldegtngendroi(abceessrnejgocirss(yiuuxtrudoannemm1.shtsttastnnsr-nieypgshled2aaucfdadahxetrhpseenc”eelninizilctua.o1ln)iteefsrirsnarnsrbehnen1geotrnooe:tt/menaet0)eew3sisibeedtsslbirosnvnnisoHun-H0ba.aeafmaTgdihasbsef)osupltmeilegeinvzlaftiltodeioveeo)nlhtrsretiuurdeec,anrpnszoengameolsmeaaoaZettdeaei.ftoctnteshT2nuentbi)hue2ssth0o:een,steeegehes0fe.rcitrendiirof0eiarooalrnagiesssenadnnmtr-,..,abISlodnaspbntersabtosaney.rhrdutntoeincoeeeacdtatmrwgawgadonoehtssoeiiTrhsboblausrissgiiroiahoeuiedkhatnlftosuuifctgrenanth(pietrrkvfrtdiecueuiidihaaboeveirillenseelealrptddrartscifeeuhildmiihrrusroiavdaee,goiideenetasto,onnrcofag!hnlterbvnylhthabo,drmodggebCabaoenneetaodnaiorteahromaieodcr,ueymmiu3anlfdgsftgataafienefn.ad3trrmioinrsrdfnonAwaamntiynrleasaigtanh,fyiereedttdniecigaegdnddeeeCsotecoiasme.ebneshwncndruwrreitsbmlsosn’gnWaiilsaaiemaerirsaaedp,irmmthsnadllite,eshballtfninesshfssinsooi,hi.ccsbttoararirngcmflAedrnsatinea,eelfrioosSmsnrielusdruromnatlfegt.encrdeuoence.rpaencdseadRoeeaewsestsbmnhIfsd.oldnetoruaftefidc)clwmfhiMrictirtmetf.aoirlikosarf(lreeoideu.aeamrtiew1snMnesanaunirhneefHlbnltDDSen/fayskeagc,yfwsommeec8TdoOcrurtcelenoEtovAbwnsoiae”o.trlTosortWambAcrfbdeeNemtysurriommivofnYaenhorarlatuenefsDeNDsc(ierfeeavPdvsaaiiorbrnntniIz,edtnylrw,lertaNeEirDiesehdFileehnusnroodigtSnolwiEGfnusUa.i.dsmossgtnjuorfssabaAvsfiOsicaa,n.iyteeTEotftDwrar)tDoonamaitseewrealFIcnc.hLiirEorcihoateafnsroiTnkesAdwneoetaoDderadotrrTcRnoegsfaneeD.ng.adsvsnEteeiEimmYtdsliaos.hnrhmredAEFsmdpmtTHeftrsiaPeinIaroRsdeoiaDdehsitlatibigmirEdttaoncadErb.iomsnrrnaraeloloEedVhnchLttiumrsseagenrnbfeetkasbEeedaee,hadocerhrgrtc.ewvGeaedifxnrdniaiddfnhneneafa,aregarpisEcnsfindirtorsltuknerdaiaotTntioshoieodronnuilt)dfntAma,esetoywos.sdu.sthgeyaooauTdeTbkne,trsobMlrnlanrinIlhofdh-nrageeaaeyfO.otgseupda-ceeirailemhdnonfpr,rtNneroaWcalatcriRsRRaisealuuenuanpoioeeerrnssdhdoolteteficiadaoceEmmAaermlscenbfarascnoeosheactoootCestemtjeNhiacinivv,lfsbafu,erirtemigaesyOweeanrdhsoitcooDiafladohrmgslcssnaaorwen-eaeentiraoMaaiafsllaenetonnymllheeendhRoeSDD.aiausdibcfo,nnlchmacotnnmidoneEMdaandbflThatDWD(DDB(DSBipOpdrfoolttlwirndOOEtvfiCeAtlToe.cRRa-trsEEROEidoebospnro.errraTEAafIOmWnyiTNieAiAAADn-AAowILanieNrnskmidtnWnoaerEHseNrNoslgYDtonctoreDDDMtNNofvcpreDeyereowfeTDpsaNEDederniFlubNaDaaeDlcteaPdHbocnnCCsa,ReuNNSebuLMabrtGabteIrIt.ainosilbOntHHddaiHEEennNhaayairNdEDsergdeEEDdnrTeeuRaFhoFErDEEoftntbWRtEEtesteHGEGseSrreactnusraArlEGnNhsSSanbuUoelDDirmilAeiUrxoeildAsRpaeteacrneinweEAlS,,cnnioeDLLtmPDOestiDBnnihiscfeOeeR-NenivEliSoEEoctdCADttdtetEDshethsfSdafhREySrSSeyoEUdcdrabdTiOiFeAiLoandNnirnEOlDouSlteolfR,,tdmtAaNwmtiootloDebTNotrADsraunhiDeeaELLNncbauiAehwTrPRCtetDnatfEEErhEmef-slTDeieeddhorTeNssyodEAAtRS)TetEfeTReYehnWuneimieVVHDIAEtAEnfodTileCdbsPtEEEnIElntdoRCehGyDesSSEideesliEGTgEbStd,,dddlIeeeERiVesCmdtfsOueEbp
ft.

Remember: “Lean, clean, and green” are the essentials to a fire-reand dense the vegetation, the greater the wildfire threat.
disturbance to a minimum. Also, it may be necessary to
Maintenance practices forSSTTEEPPTTHHRREEEE:: lRlaaennmddsesccmaabppeeer..: “Lean, clean, and green” are the essentials to a fire-resBNCW and Sangster Motors Home Tour & Remodeling Expo 2018AREA?
DAWERDWINTEEHAISNTI?EHNSIECNTOCHTOVEHEVERREERROCEOOCFOMFSMMHSMHRENRUEISNUBDISTBDSEHTSDEHEODREODRREDREEAEFTAFETRCENRaIbECfNOreEESeOttESSNhIawBSNI,iBTesLPyTIeLPEsNoRInEiNRutESUupESUSsPaOlSPhEaOAtEAionUNoCUNutCSnsTESlTEdoisr“pbsmrreeasarwaIelrwakuflnunni-pitdgdpitddhttereewdi-eSdolSsduledyeoyuiopsntnlmlpsmihass”astppseyuiyeeeabnaeatetottcicyirhtrhmmyfeieeoeoodpodpeefnfvvrussliivoveaennirwwsgegevndddggeeiiiitpllvvedstteerddaa.fiittieldtaldtaensaiaitutuonogeniniaoanonnsddlalni,nt,bppppttwsahahllllleseaaseaaiepnntnnoohsggttattppsspirssrrnp.epa.eaccaoacoayTtaTtsitenseonheoeherurdeondeotrcthmtchmtcdoecoeuoeuobwrrfbwrreeeeaieinailsincldsncsdogfaiogfanibnrpnintlrpeiateurteniauotetnncsuthtnpciuhphpornihleoryanurtaeyaecutscoateresv.oe-trr.e-rfnltamexmceasbwrdsleiiwrrdeimsveelitidmpsevulotfNdlreuvsioabfNrgroicvieanbreteioinegalantotcfanrgeansloeetcarhlianseoemytorsholausn,ytamrsobiaturo,Chawseabamtnrebhaosseiy.minlttenaenhesdyainietnrvmteopdtaeiieertrmunesgptaheremlleueueosssatre.moplalofossetprAh.opiuosfolielrmaAghosnsosnhoiflm,gwtostsl,eythofidmeinttsl,teeeyhtemcairpentooteenoaesmcdnrptylsroohasoaisidbenebapdylrlaseoleeeisbbpsprd.nl,eeleeeeaWdksrc.n
AREA? fire-reMMsaiasiitnnattenennt aalannncceedpspcrraaccptteiiccseessffoorrbaertewa,eyeonupslahnotusldor“bsmreaalkl-gitr-ouupp”sboyfpprloavnitdsi.ng a separation
between plants or small groups of plants.
aIrfetah,isyosiutusahtoiounldis“pbrreesaekn-titw-uipth”inbyyopurrovdiedfienngsiablseesppaarcaetion retpolpacreevfelanmt emxacbuelsnesivivneegtseeotariltrieournopwstioietnhd.other plant
to prevent excesvsievge seotilaetrioosinon.

EaarimarklsklssbsoeorrrsEE)mmbbeerrss)) fRoercSohmRfffrioiumerrreecbSeo--srrhnmeeardssumniiebssdedttsnaaSaSdnnmneettdpadllaaSalSlSnnmrmeCeaddpapoatssalialcnlcolrarCaiCanafpopteotieDnieornossisniifnsfeeDtrDarsisisnstcMwwnUoEdohdkeeHdRagnnuafstoaePhrbaeOAFCMeUrchtLdOsOygitoiEyOcsiruSeicshtpmSotdEaotcm-aAeeeaEeTEOesteloaoDshohrro)rFtTkwilnsADnsEMBwosdHeUtNeheaobDfaptsrlruCotNedoreFrneMrvrr.chLTckRiaayii:tlEy,cs:arSiishnRmssRRifsaRiSoeSzeEDtedtberTaEanlaEugeadsunvrruoahoEyrnohpTkoenesAEsiMhmwdmeesHNeeeYreanUoaodhedfhDaottrtIesdlorevoarilTciaaRanSocieiEmmAd:AEisrm:amlsnRimedpcosBtTmzDwEhDsedtnfnrgtaadnfjoiMibMdnafhitiRhfsiTPThrhosaln(mrrusvriBMMMFciaPerEfrovseeoTEinhemnaggadmsnNlYictUooaaidtearhoeoo1SaocRstde,oCerE.tilaIetDelsoeuleNhaiiensoooolHooofowlatnhhrSdaieldAEeineonvvnlgnnnimDdgImedpuaaosBtTooDwEdsat/acdcfau,ewUticdaEIfcejofemscig.aonreiaPAAUrsenruawdnvnryEmmnmOreewarOd8eeTpRnscmabogarfSRidosaedo,brbElikikv.itsvoaonunDDiEncRiidHV-tdwhlantnmehncnLntrtmimsr-Dgest-on”lamnsinmrwDaIablaRereaaeneE.doatIgwr,eraewaecoadEeiIcoeneee,ctcdILIEu.nffosfeugfhfsenrrEphrEnOtnirrttrtetecteiMEesifamLsfasegsnfmnloallrsEaedeiiNNe”oeeeioEaenipycoRmrieolldsaVhfdltohn...noeditaLttAndtrdFoilhRaDeohrtTeeoos.em..mrgramRrrhcddawCs.a.gkse.tratarbocsuwenveG-dsEnefibfaEiinfseedDrtlrm,xteRatneutmchEfey,msLedacisamisnIsoSiEtedeMdfTTite,Crt.nnIneeeRtePoNilieeidsfSoseeeldEMddao,sads-oAtFaiaohybhsaEtTeebhynosdDDWSD(DDDBB(CF..orgysemlariciapHrpoaprectd.eirtoOdElciwvGbcblwicEanrsfdInntrmOOtoxEefRaSnttarsnunvdnfiieEErleCniniram,edeIIsaienludfletbscosClToeT.nenicideONEwRRrelfadcsNidasoOEREE,uSdhtsnuofooNtuaeITarbeEiotRtpassnyeobacpreoErspreErrrecaeyitBtOyeEkrEsoAuIppbercrrteiOenadnytnui-ihNTdsiE,fsiSAAAypNNade.gnioafrtssstDntrsn-nAAoAwoT,IhL.elalanelanrueeornanTSnet:eerlLEMoofsdrPcmec)dlminaW.sanGtumSttsNAITcrhiouubEisaHsseeiaeoeINehasirSeretphNoa,trfwEgcBDginoryaodmniomaDmaaNdrrnodRenuDDDtenieMhniuToWnidetcoaNNoalTbvcfYpAAtntccATe,rhdfrnDgaledroosekbeIoeeorLo“rrwardPfdTprs.abscardtBuyetsEEuoufesslwSvedDUIienpioFrruulasnoNobfEaeSfDnIosgerhbnyaoanDlpibdiakvteNdtsLedaRlmdnae-hMnnlaSTnd,HrdaebostuannTPbnauCCgPs,ih.ReumeirtengrNNeidNNOSdUOaugLvvtwsmMOejaanobfcruvwitpirGEadoEaslShbrtU-maAenneeIreraeon.twnamoieinsInTcdsanhogenssirddlkndar,ebOdntodilHHerene-niHEEeSodr“narNEUtNahatdRynbaPhfgprbdeDataSrduOsAegOrCoed.getNEEeicbaCCutrFneonrdOaiTipkFaeul,tpbestRdoEailvr,m-atAAhoeedefiuRRiRsssaRfilveS-EtabeeteobscrnreSTrlaEuiuDEEilbofmtutbsntrWriubuRtuuEEdrdoiTaneUlrtNshyonatnhopiHbGtaoEfGep-pnnmsdreatereeenluibeteUotranCoirnTitNehcdrfesnernotakaittiAroieEEoldDotcarNhldvse,oSSiasiaauioelRRsRaissfRaDDshIrocsSeEmmmleAraomeifsssiNb,nilaAeaerrimTiUlaEautmclsusxccnorheumfehoogniatifyulnhoprdadouABndOoeRtuoenaneeeilcceeeeerrreroanfaoconnkhteEedefsienweoeeEteeia.ttEnwlectSoooalt,,ndocrteeonofiCevaaioaeaDLLytln,ngdocestdtEmmmmAelePDiNeeshefhrmsDd-Bmhancl,sdmaicissAnmhleTiLnnfiOfPcvdvvvrtlaalgnRed!Nlneuiinoovtlciat,errfftuou,ecSiseEEaabapReofimFcetgaaLdaRipCAheotcteoooaernyttoOweeeacrdceytCehtlotthisErEl.ppseaetdeellehfkbosSdtNdla.ebw-htsRdoanEnDdeeiieNnayrSteoaarvvvSSdlyChldmhEremnoooeoRratfugsUtlolfpdu,eerboimdTsnrwaIaibOeetfmcfeeegAeaaasaeosoen-anreewnueNnLysuOweeeardwaairiu,HnDisfseeufIltaebobanptOinrbrwrtDrteiMsDhSonrti.ieDamftlostfnnTellleRd,,antednnmemiohnltmaercmelpoAwigsDpcAty.comtrcolllchmhsrlNmtnorwaaIbwfdift”-eniedaaadelhRaaoolgwAyoDleonnriieNeo,Atrhlfoaowsstteeuf.ieDtstanasairbtvniarriustrdop,oEeisddMnineinbhnaifeamfEaeetassonEt,lllfLLaNareeroenicauhYkef,nedaocisobixnpyonimAllloeSehltttoedittwmnndndnl,ehRaitwoplie.errdsPoeoeCeeeeEeoMLetdDaidhnuoawslfed.syehs,atcesrBEEentaycrob(DSDDWDDDBBC(FOyuAtEpCrrhEesddineibefiagiapo.fpNeecgdoroad,lsodoieeTaiochyf,lwfdalcmisnneseOOooS.itoaryTtaTtnndvnnefniNelitCliePcddondsmi,ooeoeeeedieIo,EaMndtAAdadadbtnslnToeRa.sicSdsllO)yThsadRRStepeaoRtydWDDDDS(DDBCB(FdrsOEREEddufiTnfidoaRspospeoeeehpfehcdtrRttpodlinidpriaDohETlwWrfAeyrtTsueeannasOOofyeneEAnueDtIppwvnenhrvrtufieOalsnCtebynirmn-,eNTdlIiansimsbiAAAslToe.VVsiciocsadHaOsRReoDsdaE-eDeAAodIwIoIL.sasEEEORaondureeetfoaogreAanToEtunslHEfMotfsRdtpomndlrfmnWandprtoEerAlsdrccrhabotEeyinaHshgEeASaupeIppNertdoeOirrIahdNoydevtnisgc-eCNTwaDiisonlibshAAAomrrwoamaCztsteDsDDDrt-eAAowMSIiELr.dscoWnaEEnreetrINNoannVTlltvclYrEEMpatfsdanmrcdclCtmneWadnDctoaeodirootomeAtcrhaoEaCrwEeio,iaHsffhedaTpprneNuhsairnBrnrGhyNoyutt,EegadsDeinoedDomieebraaFuaueo,NseSSDDDEaefDnMioistoWnersnlattDlibnNNopvltvcYrpuebbcrdcae.eddDlefdedbHeroRboonselroCiwanwaobPneCCsa,lwiti.hfEdTpbRregdchursaiNNSrBrGrdTUyutfuELvwMOudeseEelnkeddDaeineobbFuNiiaGafDsnaoseSernedtbadieDlitabcevIr,,asa.twdeadbiaenladsdcHbogssuensinadnldaiPneibOCCsa,adoitfdHHs.grreReriHEEeiNNSGe“nNEdUilallIuLRvynwMOddegrdoantnloeDbSeftnseigrGAtsdeaeEE.eRistmncabcFetrsInrrOsiTiapF.twmkasibdSeelsrtnaeRhsicgensidldhaosxeeebOnCitdHHrlvhEtaiHdEaEmeete“nNEdpaiikcRSyrlonoiuDgEEfrgofmdtgtbsDroWRStEEdfrsTehegrfsdaeaEEtteH.GnfEF,bGefbtdnnrmOdiTirpFetatnisbUObeategEsrtuirRreereuhhoeeadniemArlaeviEtrlPdDsettaenNhAusEoSSiSartobuDuEEoofmtepDDItbsrlnWeraRtrEEemdripsdTetsilaAireaatiHiUGdEtGernioxmcdroreateenreibooUttPnfptirneieulmsddrieABFdneOoRtaehanmilArneiToaldceDntnkaeeNheiibsnswealaSSaaaesEuoesueDDIoEUelroaSpmilsa,,nnsilaAeaoispiUvawoesnDcLLtnnxdcoEtnmtoePtDieeeisuldDd-sBBAhtdn”OoRtdritesmAarnileeLfgaanocOcnnukeeinwalegReenifeENonenArinvclEiltv,nOcSuulh,,wnc.SpaEEtabotvawioehFcrotDLLtnnLddbagACittmiePDteaesDNdt-hBdhenatirtEerEppsinsAneleahfhLtefSOtdlawl-grcRoehorNenRinagEvdlSaitnktd,NahySaoacoarSclaEESSbyhFcltEaLdoCAiototuUllcordterebdTetesitOhmyctlhceErEaTAppesoeanlcuarhftSNstdlnawaant-ttihhuiRnDiseERbldeNoahhySoaaslrpOSSyehDaEDDhSotnieeoetudtloUlltttdftTeerbefTR,,tiOdnnmtsfunetAahio.ipanArDcrNesoroohaaNmifIinwfuinDi”-iiteaeiuilaaelgroDrdF••••••••s••T•rnpOnaDNwe.aotDrhStntsteestloitnfDTc.sasRa,,tndnnmepntEa-inahtpnrADEaetoeaOsisrEhuffLLa)NmNwefrTr”-iruaYnblghmxnoDeiAnrr eeNecotnrwttefbppt.OrDerPsasaCeeootpDEgiinehthfgEeetassEBfvEELLciNeriOryAtiEprbeauhYEosences.bhbxniAoeaehscowTiyuhcagnflpaf.erPdeCeotiiDiaroTTsdfeeNc,PBEEcN-oOyAtEo,preedethAAEtletn.RlSsl)tTralposRrrodrTuiyrTrdnfRpmeeehweeeeiiaanrrRdRRaswOrRRiaaiassafLslRclTeTocSSttRTRMWCCPWdeDnehhTeNoWuPeuoeuso,gdtnAAettwmniRegrtSusulnn)TsrposRrtodo“leomTdneRhocpipeeeehVVsHuaidEeDeIeeeeeoIDhoTyritbnrWtaeogAurEenHsfmohcahnedordrdfrraiuhlicteantarastln,rmfroiS,eeeecoVVcsdiHamhetdedvEfeDenIocdorIClefaEimmmdmsAoillebtaabnshgAsEneeHlfoommttrapladtEdahhaEEeamdIvsVttlEfdecnSeatsaacdofidooutdnuvnciCaadoECceeebshaneeucumhnatimhGteyraivee,EdadsaEEeepaeIrVbiooooEutenosSStEtptcpseoCdiotvnoltril.ECmiekaertn.ehhdoseNdefheefaGbcgiRyeeidoswdrelaaiiensEbssirubnwnorisGrSSEsTevvvvsccesnsiltpsibaantow.edsfefcbenReSernetgecdsiceawewa,,lg,i.wrrdtlEbd,risrmGrdTinanOeeeeaaaduieidngndibllanaodGgiiesleaIgueesefStdeaeb,,leadasdtbdyeainktinlmDethRlisrnncac.sitidgmbygdhoeGrineshtnnilleIftmpsgeastnCnrownledrraaemnDtedei)aaaaRclehisouFtrudnplnccpdsgweietvdnebfeartterifkoebvsCr.oeehohadlssOeaiemEtlrrrdmicuCoeMhiguniemstpribs5saollllfoaaaneoatnaiEhofiebbunspiallneosOrwpEwyrdeceiucllllfiihuNdlayshidasegnievrfgsipeectRrsxntseecraunEoicnaibeervpnnlv“riTrpRn.esiiibraaobbkuerouiennbnvpeUetpddsdlnieirenswrnlesursanlesnrnnoTtnloipoehcdfiisbraacoscttnDerdudrtdUiifpiaatmaitneogctaassanaedadsistiansdeAtn,rcertoee uoehEMncvipansfcattodeettlbtohaaenocgufaresNidehAironniccnnnw aeuchhdsndrpeggtcidgcio,saiir.ibnaaeaakgnwdenceclemaadyNndhae.airgrotlunsnagdhnfnvnhiheeiCeoocrtyclaeaT/enosscunyanears.ecttdflascoriddmielenddyncsasoerTntecdcDcuie eoergd”eminlnoepettgtestnmReedfgtsW acmmsooagrEneIdaeD phteeinaeetsuddiOslerdFr•••••Ts•••••• dsoiaixhnooosruaoo.eIrssDptoty fr-gentalsgnrurnrFd••••••••sT•••Orrubnlm)mdreydubsedlpwmts.nee,ed o-oocasnrdpOthea) urtNbaceom irctrohpaegt ,onowi“toonpmssaeroddaeeoenmMhbaaoovdaytpasiacrrbihfecwte oda sircyy,triNacrueeormwstlbuaonteegrsevbptdeftcshprimetoeNnnvsdeeoeLelheisrscRRRfaRadaRlLwiuORssaaRWStCWPRtMCTSuSncoeoiftrstoolrraDrtoohateemohnnriaRlsuicRRwsdsRfaaRsaLRarOabeepeSWPtSWTCCtMRRutooisclevoojdiopchdeseirniidnueeet pei.soeeeee,nrentbrrinmoooaleeeohhblaeihhhopcfwpMagsvaccvtruhrtcpabtveeeeeasnebnirrt,ndoesroyoaceensoehcuuedhmidnenahetleehrnanftohetnseraEmmdmmctAaillethaannsaan(rotmfeeldo’caplitahertahehlenoo,mraavlEmmdmmAtlleiheanoneceaheoeennveedauoaamEeidsfeysyimpudluatdaalRhyaadonecmoeeevrdineucudcsnarrrr------aafearafveunutd.ttaaeraaepdoecrtceesooooeilnucutnpnnipCeerelaaevbemrtrla.mieepekaaoooossdeleeheoNdlrhetaapcprwCeleEmdrertla.emiekapdssiabrn lohoNdsbhDealcvvvvfcsiegpsatatdressaueondaaneessiwsbtnfrsnvvvvrelefcc medwtgeratst,.wrrdtldaanr,nwmfarineceneOeeeeatdfccewgrn,o.wrdrtlflmalaenrna,eroegmnisiEndieeakfuNOeeeeasdneebrtdadtlaleyenaodtigshmiDshaohmesefarpetlbeieiloadadtgyhhtiorintemDhtnnhodtrlmpsgoeanytsirownlpngbrermhtadoriDnelhtnne eb)taaaahempshgeuFrtalnppaewlownrervrtaemeDwafe)aaaaerteeheuFeartrilpsoeelwomre.ienehdltmsedietrfsnarstror,ivoweeMoinrc.uehdlrms sipertireietrneoPllllrroaaDreoasnaiMsoiisrumensrnpbnriowoollll.sywoaardeoanoaicelcullllfpoiiihNilradancegunvpgso eiucywRececullllrhifhhNavleoudicaseaiueogetgsfrvibdneR“agoiroRnd.oseictabeCorivtbn••••a••s••F••k“uCeRSinnbnvRnrddds.esieethttlonwrb lsrksurhuelbnvestbnddsdAnedinthofnteoanhwrdfsilsahtrsrhsclesehnDnednnRsoidioEluhadftimsitdaerrg)tcaihovDneeaaesrdsihdeedi etina,tmergeoe laeEenMavneseesadertin,o,rretleoe odeooEhiiMavseseainPioegltatufrosovStlsfoanhoohnaennCSPUMCWWRsl agucfrodspsnndmggidfirgncionniiiH a.iCuvacaagllasgdnwwpdcidcglEescomadsyi,.inDaauagrsogetwdnncnle.nmdadye nfvhhnlnfeeitraotehtaiCtnctoeldadrnmfv/hnoihtniCnyanrotncttarlaA.e/hcpd.ofaSrcieohryhioarddw.drecgdiffacnedoinsisddnooerttliead ndentrgn”enmsnsnebertieptegtte eptrermge”emotoRnepge.sW eeaeslltammosfRgrewEaneasW phialecnaemh,utddotOgraEnrelodatb phRCe spTanaeoaeuededOialsaxewedhoagndoguriarsoexhyxhDnpitoeeinhySt lprsgeehetuslgtniDpartyw frruebnlatucslmmrna.dubrrePnldhlimmriCwmtsenedpeutbeedlonuhwmettsnnporceasiaidvomioicashesea durtNsarpr).hetehasmse luiortrNap.gtb emsai,bphnontwtnsg tw“ttgmi,tsnoweaeedstedmaeeeskoenaefMddaoeenaaebaeneMovidaaeyteipbUOeatcicrovbahsoeytsae ecirctrbe hodai iecmotaae,oodatiednicadrreeeo,motrtwRaSetseroebarpdlTwishsttueabaotseetgiiuvbyteaotdseeg hpdevbiiemeetnehnh.vneisdeoeLneehn.vesdeocedSheedooiSlfdsoogeohaiofslorausDuosflnaartnnaDmne,teazgtmabeegotpsbcclevojdscldeivonsjedainrddendsenieternned mni.eaiseiee.cstsnempurnarurmBdetahenIeruerfcwpMegstfwpMgsthrt cbArvnnebvf,o3dboresneyn,irdalsoecsnysecsrynssmavmwle(hrntntflehrntelnofteinitauana(ipwfaet(eftdorladriasiibahadalhnoi,leoal,potaaCliotvecailoene.otvneblpadeuvseduEedEeedeosmedmladdaiatdlRlyslRrnyenyoeoderndsrndanenndesdsfafaeuimonnnndbrd.aeaanernu0ttctcbstoononpnnniigipeerSelaeleebbmCmrruetstodwcynaaeassssddheeeeeerraaycrrwwlleelEEmmMttsuidhpdpdtiitbpnarare lo olbbDlDslnfscsfiegsipsgEgspaastatasRiuslondoeereeeeisptstsro nrarlurlareln m lgdoemderadtstferattedsderntcrsngngnaiaraegcreechteliitnienlotenfomaenrcoafmpaeerr/ererenTosEdinakuNsEisik(uNnsenelettreie bnfed.esedhdlnahmsfshaamsonaplnenseieplonalepetitlonadht1awnhta.detWdlybodayl,soyrialdespn3bAermtltdpnedcteml ebdhlebd,hpaefmElrpaevillhreaeveweafeeggeeeleweaafIcseeeelseatoemoitlfsenlomideenrfsnaWsdeeo,cndvswokasfon5caevwaorl inircttecrnesiPr rfDrtesssnePr0esraDroruesrngcarbae“rno.sybgedoSlpeo.ssirdeCdocldpuempia r depcutuetmhitoehavuedeuaseeuothciuthfaveudbaeeuoaagoetfo dbdeeaigobeoNtCidteewcnnbNCtc Cshoirrfterooeehbttlres essreepahsttltbAsedsdrhthfettefatebAsaeuGhttsthfthieehavesnRsahetisronEtluehepdpf“dars)nsRiishovleEaluraeEhdeaur e)ibhoeeoearisphepeeiinesdi,erennedesitoiipitssefoi,nPoietsdroooviislrfesansohsiobipnioPgesolonvhtosfdanoppnmotaifrlnnsolendionCuvopglnlmraifnrewprnobssieosnuvC,glDDruesncwspbdsLDnnco.asnn,ude ulfaeeeseitatepnantn.noeedmlfeeetatetanhtanrotstehiAdmsya.nSrienhanrthsotclswAtdg.rf.Seriishnih.onohtoewcdleaafdddntsernrinnbaietnoottaaeaoptdceotnteondneb.ietnleitetat sfpfseowtdflc.he,tdotthaarsefdtbwayicspTdlch,tedostabierewedtagdbgrspToansdhyxetiiienhStewlpsaagedhdeeghtirssEwtafrhyxacniinohStl sa.ehriPtihsiriCweetcmreh,nuhcae.tenrrrfiPaihihivCenetiessenhietnprr)Sdeitahtisllve,lrsi.be selabhatttpsr )”ethstgielegh.ecsb reeeekaoambhetfsoetngiediaeetlsietesekrooosoearsnfae urtoeEieimoaaeieotednicadsoeesmaot rtRieriapdlTmioashtoeeDendicaedsdtdiieymostdR deirmeaotpedlTuhineshmtodeestliicydadd odeimelotgehhneagesuusfnacMdene,tendzgolloghpcusuonsfnaanne,teezgnemraieupeccsttbuptonurahdntenIuerncemeaaienthec csAiiunfoubrrdtrlewnnIuerscryseavwf(tht cltAlonbfobrturlawfeserysasnovrlarwea(t lsbaatdloaepoaCtouglf.teblpaees,orlarneosaelasibatadreeypoaCdonslapu.ntblpaes tenueoimolabri.tsdatnurteettybtdnsloAaopnipreuimCoubrts.tanuod”cytnebathnsoopyiplrsuCiiudtsthotdSbpncyenleanlhdnsnsegEyisiRlCe leuriehdriphstbpon naielurllenlhrFtmwtsnesedsgEfesseRltac.seervrneagiphlsiido nauerlltenel eo pnddmsfreTossetcssehh(apelhsllrii bn.eltoeeddlnophoernTLnossenpstt(d1agewla.merdi ybbnd.a,edlnioadeh3odtenctnsrencpEttda1dead,wma.reedilybdaa,eneaaldleel3eIrdtecttmreotftedr,mWeecgcndiltkfe5aaeegoaeloilt Is ftieotfsa0eaoercaaWeee“scendkfeo5SaeeeaasleiCdtdecemLsas dfhtptstm0eatooodcaeeatceup“tueSeu semCdeideema dspwcrtnnnttmc shtoonrfdoPdrleetcuyhsuxpas idhetifheeauGautwhcinntvc sheoerfroonrepfsssslapasagEuodhetbeeoifepapGuitprhsisdavemtecenroneiteppftsessfotsloalEruetosmbpegbeeteooinppoitradnfnndneneitrapelrefobhsetnoreAlrecosbbpdgea anoCdnimaeelopnitalnneendtnlraheersebsien,nsyarnecebsdclatnd.rieateneaspni.tec ddsrcrhneazseeiaotsrcryaeanunsicelt tp.frodsni.tectseddasyircrsnaycaanabioetehpcteunniee tienfoddteehstaneoda ydicRsieluFrtrOibee,cenfoheptei• •• •adeserhFawTprhrwastashttdlhlln,os hlioatue”deg,hccyeafmhheienspbstileeesotllno,aeasaelnlNcapte”leglehciteoo mceeorhneedndestlees,yooaooeolnislodnetarcAi(mNteeRdipeddlsnoNoorrsnriodeeplsripslettugrewnnnfourrnlreiicrnwfdDihreetarm tkatwyeealt hrntfeeiloihrgydwoesnsctTiuengeWUScPdhr eawotudodt eoxseslsgeIhnreeconsap:”tsieetami tridtpeeasplihscure harFaptio”htFtrmwestui.rlbsascncgicesI bmtptehes ehheowrrohpwtrclSrmilteoehttrFmwhee ebsma.rngamsharboeGo ihsO,csehhueaepedeerleleaoiowmeeornttnteEpmrturtoteosnoh.h yrrciauaepdl(.erhybrpisepiwmuaertaetuc astcnodottaeououm unamteiasocso:nmpesegtlelcyheexaamerecnrsatwsooNrutnaieuaR,rmgfereishannepssiaulmeicyhroxabehematrtceresoetrefopnsttree,aemsghalsnanp asoesohmdhlecncSenwniemSu,mdtsderifghnernnannritn ehoioeesir aadmlnpidSeriiisfmemtilsu,ossyseuanagpbieoneadnoa enme tdnhtscneetodrmdasenFurteirtipd,nntes•• •• rinyawFTprhrwayettdhlanasphchiauemefdetnnD tesegthiestemnsndvdpbdssieFutreornkaeioneNcplloe• ••• rrptooFawTporhrwa icetdohlhgdehtndsnelste ue,ldnyooooisodhtnieairpbsieoeo thesnRdddeipsaabendscNpoohggmlrusnrtleisaduetopo ecsetieniepheeenugeresnes,ayg”aaonfsoturrthiescodsrnsgsIaafDrghsroorctatRmdip ikooetrearsnsrtirbreddeebpfeegslohsrnriyp.dneesoesgbuegrecenetnienf enurgWcUSPSarherhecnrb dofdhDehrxbrsesntastmnr eetrckpotha p eerf:ta)thireepetasmpeeldohrrerrlydproesdpceeatttiiohseancurgUcSWaPtebhcma.reeutpptopdodeaxsesuietlbsoaafesccnereechoeepol: tbmatpie elhetadssmeootrwarortn ntrRSremtdtpTeecae eerbsmainhscurostelarsaharboedptsrhoolyhdrietta,duwisoueeolbreasccmeeeaoriwmyuaobmttcptenhleseeorwrothtearurStrmecttisni.chnycare efbsmaupi(e.auahtshCaobrbposepwriwomaitatue, anesheocueAhnaefsdosamteeaohooidwtmtocna.cttnc ctosmpseeerutrlctetsen.haymrcrenerhiustwsap(.heeh bruipsthnaapiwmiet,wtafrtum eieaiunnchhnuneindooumytinaroiPoadonaothsetaeeocroimtcepissooeoltedpolpcnetituFee,seamsmsenarlseentwnsnaaeoedheircurnaSNnwcilen,ieonfrmesidhndennaidumaignmrrnron)nbri.tnaveeanrhteoimo,utcrieiossSeoodeaeoptetieri,iemishsafmmilluhcnlnsesedoudnhgseacsneoSsngewdnailoa etememcdntdscneedtoeemneddgirbnrnndnrrit1nnedeaoiootoenyieedtnsthchhniipwriiaiudmefiensbCmm ilhseughtrsSstessmsdvhugo)iodmmciioa emeed0mstnstasctoneeiiorsomicnsoeitgddtndsidtlesdnn ielenevweossinynttihsgschio hesaumefdbedehsnasn hedsseogg%gtmuhtstaecmsuvd aesotennpeetfttisiuoseeuaast aoerieettnonsig saorgdstnodsrceilhss tlgEntiaeoorhrcetmroensonrbtiredeadbgsnot3 hesrndesgsbaoeyeieedsdggnmeae utaauhoeneeotn eheieeusuostnltafasthtrnptastr dufresfgsn)aothefossoprcwdrrlrtghpprssiggeenotrttoasrbteepedbecert.wbdgskaneuuptpnlsgabeeueebcmafne eaahtSheuoln a mcwhe ldoora nt0thRsedentstrpctvbef wdefrrn)slbhoaestelsrpsdrrdgsrlahldpprreedtldwoseotrtboeammteerbcr.hyoulaueptpc.laapveeietheatafectehyhihcpneareolars aen clibe daauoaeaCgh ontcR.rettenaeeiehrnfscsaomstelnrsohnordteadsrwath.ldcrte t tdcsawoeodreemtdrlnrylapcyruoaeiicsSeaeehehup thaithssccttagicimnieearuwnfonhuteneoauutsCooiPlrrdopstaeeon)crsneieehsoodflatasdaspmnssiyroFhoidtshsatvuC.cesebt nnaFtaspoeirtclbon.eoscrehirosb naaneheeb e aetnmirths)bnveo teanrptmipe,nunuhruioSeoaan.iodeoiPoshdbe1ostashcnoeloriee duoonelaedsnpengeiFheabslenttcssiluvCtfeaseeenteaadiboirrntrc1ldonsdsaotonleeOeenradfpfnoaha0ehianmspwitgd)bRnvesannrnthd,lhineuSriosehSeeoeoiae mcirShe0mhtgsaehtccnoeliirsedcsnpdatwtsnndesgeadaiableetev(wetsr%seeteettthigsdbritnr1bhiendnnhtac%otoeheteerc dnahshaohhhbpsppwaaifetfgdgtnihuetirh leihieentSnnsih osirtreeihmcsigtt0mtsaeoiarhrct Rmroeiiprsomstrcesadthndohcect3irdieeeevoytuwidrsyresneatahgdtneeohogsetoedeiebheeuomtnnlhh%ohtsestrcdu efnaasdousfoptrwfttcargtihpsussgge o eioetcnntnd epert--drtdakaeuightslftnfraueorirbhcrmlocmouuottbreuaidmcbt3broarooydi0bhdseeastvbfwdneni.oeotesoelrekeaeiinsgnuoatneleohrlessrbhdueefmnaudfhevreofholfw.larghpspvsigegoetetaoimieyshhseppearermtsdkaoeuepbl aeghounrcbc.mubuitutiruoelmccsinoraaraw0.hsbseets uscavrbfwddtsldrclaltsapyougiiy(Seeehupeerlssbstecm,agerirrhowsfoletec.la-ttltppvu.cisooeotrsainpeen)yhhspearssataesb yiaehghuor.enubtnthopioscinb.rhahwoba neet bceetardv edrplpltgnapyou iala.Seidhuposbss1csagiee wufotee,pu hebsenocsilorfeanppeain)issroiattasdyrihhhlecebftfnoa0epinasthRsnnb.sdheuheoeb nabe etrrSr
ASESERSSRaSEerASema•NoA.vWDNe aDallsdheaind gshrudbes afrOaodrmneOccaudnewt.cdegietorhbawginsrnrasetsiahsssneeadsdnoardeenumfdweotniwlvsdeioilfbdlfolfrfelwoompwespreltsharashecanehdvaetevfseednrdsiriebidueledpohsoupitulaltocforreor“am“ccureurteahred.ed,”,h”ouse.
RS For example, if your home is located on a 10% slope and the brush
Onc•ePgrraussnesinangd wtoildfrloecwmuetRrdesodohuwvacneeveathnldidcarkirdeeladmdyeooervusetrooffrfropum“inceeuthrlneesedde,ed”fleesnstoibale space area. is four feet tall, the separation distance would be two times the shrub
depth of two height or eight feet. The recommended separation distance can be

ONDDEECAARSS,,ULLONONOEECA,,NlwdaRRciNSSenDUOuLLNeeNitahOctsD,,tEEadmENthevNu•••TDdcuAALLSN)eeroTrWhoDecEEssbEvRSTVVHeewT,.eAAS)nTdtWEEhtIEpnhtaewVVDHaGhSSeetiilkaaooiGEEIclEdgnS,,“GnkdSScillsndRediGnn,evolS,,usiaOiacrtnfnRigyaefodnrg”UeOmregnerllmgeteNoasrUsdaeovy o,DeevNeevfaescer)fpnDosra(,aioddmn)nlbmaairdRaaRwllepdbenorreetbninaohactrskontarliaadRwadmsnoeahtehnevosnfuehebitnucuvaeahecieenrtosocraamenrnheoacethedsvsbrcvfuuhucdneegvde,.leeroehllrnbgaeheaededytlsas)betvhteeewnressD,.l)ahseflniog.eesits,ddyt.efaitlonoihte.culwrdDg)aotn“tpot.eeitkwndolrTlslnonoidseiultdragda,hevh“oilieusndalarblisng.iadekceietnafnsd,evyaofloedusisereg”i.diagRcet,grngefnnnafeodreclehrlmug”esrtaeRastgrernampo.tptsedaeelnoytlmuetoe,areutoraoeemvedvhtsedaefRroytanesfcv,ceresoeevpeevndoesonner1aa(escvero,aismddmeofnnoesn5asnaal(bao,aeledtdtompdublnwarrlnrlbndafatvoarlekpdneobldsearflolersnanaeohaeaerrkeaedinseaocenr.ssntcbdhdrrceueahinudgoecenrrhlebbdercteuihlau)sgieeesarhlssnbsetteiia)ss,ii.esdfaetssnlts.hilost,t.ptfaetwtoab.ThottrptahwhtaabTieatgrekaheahtsasieegsiekieeacdssgs,gesinieccceghs,gra(tuncapoac.thra(nmtuaroau.tttondhmeRruntuolfdeeRenudllofnn1aeaemdlnneof1aa5tssmeeoetto5ttusswaFwesetdofttuvroeonNcsdoftfvoleroooneoaaeedforleonunnaecestcdtentcloestcedehedtxepe:hseteaahstieabeiSmdteblisdelelrlp(puotlawsuerht,aoeitirfisomtiyfnmooosduuetirsrsbtfhrtaeahwaFTpronFawTprhwenenNcleeomhnNclecootihdacoodidaodranrsedeiorsunhetuusgrnehuetsahettkloreeceiethclohrehecdxeahleidxepss:saepr:tldecseecdae)ca,iursmibsbpeobmSmaeeoolSbmtbbdbbeseoesmnehetmrrtryesp(ymhmppe(hcupedoueoottahmtlmealeaawswruserutnenefdeusrhreptheetoe,tae,asaooedeiodemem)ntitrngitsiilptdirrirfifils,.siudoadmoatmthsoeobsaiyiyrmfaemofnenRospmvtmverooeoooohgddsnaiitssdeeddrouuruueneneewtttsessttiuirarsrbsrriggsbsebeeeebhomettdfrfhhprprrprn1tateaeeupeenpaaheohaoaann0ietnoeslnnoiloermegrrmbacdwancthict%arcraategnehnht.ivhtsteyttrseegsasisthaiiethtuhehhoseaoolsstiFlseiasernalsarlnnsflr)nn,ur)itoto,urliookenaegelaoegtldbrrtdobrsnehpiwoochnhhims.mcsitdmtescteedtheshthrh.fahtoaenntesearneotersarooatoeeoeisuanoeoreifngsdfeptdgusbckptvduuhchbudasghebsaruogestierheroerhtehrncenhawtdcdrucnoatadrwotubpa)gwatrihunpebab.riobenrbiobee1reueebncs1seuepebns0itRnnhhes0igtnndwe(%gildwte(ah%sneitir(atreahsnmsihecturesgeshcstftuicagnoneastngfloochonodatonrfkelntohvtorkteminhserpochseltaam.sepctyeeear.-ttl.srteer-t.otmaergratehhybreobriugueshgththh.mepFerbouaernnssitsnhagrlueptbsphssraotwsarehcepihdca.uhrcareteisoandth6iile5sy

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Protecting Your Family From Harmful Lead Dust

Although the Renovation, Anytime you cut into surfaces painted with To learn more about any one of these
Repair and Painting lead paint, even if the paint is covered by suggested safeguards, or to source a certified
Rule does not apply to layers of newer paint, you risk creating RRP contractor or inspector, contact BNCW at
homeowners renovating, hazardous lead dust. You can reduce the risk (509) 293-5840, or online at
repairing, or painting of lead exposure in your home by hiring a www.buildingncw.org.
their own homes, do- certified lead inspector to check to see if there
it-yourself projects can is lead paint in the area of your work. If there is
easily create dangerous lead dust. Protect lead, then you may want to have a trained and
your family and home – set up safely, control certified lead abatement contractor perform an
the dust, and clean up completely. abatement to remove the lead from the area
before you begin work.
Follow these safeguards to prevent lead dust
from spreading throughout your home: • Consider hiring a Certified RRP Contractor

• Work safely When you think you may have lead paint, it
may be best to hire a trained lead-safe certified
• Get the right equipment RRP contractor. These contractors have been
trained in special methods to minimize dust
• Follow good work practices and clean up thoroughly to reduce the chance
of lead contamination.
• Consider hiring a Certified Lead Abatement
Contractor or Inspector

66

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Selecting a Trusted Lender Avoiding Copyright
Infringement
Source: Brette Sangster, NMLS#507149 Vice President,
Banner Bank The key to avoiding copyright infringement is to understand that copy-
ing any part of another designer’s or builder’s plan is illegal. If you
A trusted lender will help you choose the right type of loan to help ask your designer, architect or builder to design or construct the same
you accomplish your ownership or refinance goals while meeting your exact feature found in another builder’s home, it is a violation of copy-
budget needs. By offering a wide range of loan programs, such as All- right.
in-One custom construction, first-time home buyers, lot construction
loans, reverse mortgages and many government assistance programs, Many people believe that if you alter a plan by a certain percentage,
your lender will be able to tailor a solution to your specific situation. you are not in violation of copyright laws. However, even using another
designer’s plan as a starting point could place you in violation of their
It’s very important to select from home loan experts that combine copyright.
years of experience with dedication to serving as guides through the
finance process from start to finish. Consequently, the first step in It is not unusual to draw inspiration from a plan in a plan book, internet
securing financing begins with finding the right residential loan officer. plan room or another house. Ask your builder or designer if they used
The residential lending expert you choose to work with will provide you someone else’s original drawing as a starting point or "inspiration".
with a checklist of essential documents you’ll need to take the next
step—completing a loan application. ©If the drawing or home that served as inspiration for the homeown-

While you’re completing the application, your home loan expert will be er, builder or designer is "substantially similar" to the new drawing or
hard at work initiating credit checks, verifying employment and deposit home, the new drawing may be a "derivative work”. Unauthorized use
account history and securing credit approval. Once the application of a derivative work to build a house is copyright infringement.
has been submitted, your dedicated loan officer works in concert with
your Realtor ™ (if applicable) to ensure all the necessary property PONDEROSA
information has been secured. At the same time, the loan officer will be
working hand-in-hand with one of their experienced loan underwriters, CONTRACTING LLC
whose job it is to verify all of the submitted documents meet the
conditions of the loan. They also pay close attention to each detail ADDITIONS
of your specific loan type to make sure the loan meets the complex
regulatory requirements needed for conditional approval. KITCHEN/BATH REMODELS

The next sequence of events marks the final stage of securing FINISH CARPENTRY
financing for your purchase, refinance, construction or remodel
project. As the loan processor completes their final application checks Cris Doré
and ensures all conditions of the loan are met, the lender requests the 509.264.9537
closing documents. Behind the scenes, the bank’s loan closing team
or an escrow officer from a title company ensures titles are created or [email protected]
cleared, arranges for payoff statements (if needed for your loan type)
and puts the final touches on preparing the closing statements. Lic.#PONDECL846BN Lic • Bonded • Insured

Once all the necessary documentation is prepared, your loan officer
will coordinate appointments that are convenient for your schedule to
meet with the loan closer or Title Company. At this appointment the
final signing of loan documents by you occurs. Upon the final signing,
and the escrow company or bank verifies everything is in order, deeds
are recorded and funds are dispersed, making your home ownership
or refinance goals a reality.

This may sound like an arduous process, but it can go smoothly with
the right residential loan officer. When looking for the right partner
to guide you through the necessary steps, look to your friends and
neighbors for recommendations, search online for reputable lenders
that are located in your community or stop by a Banner Bank location
and ask how we can help.

67

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Home Component Life Expectancy

Source: Complete Design, Inc.

Home maintenance is extremely important to protecting the value of • Water Heater: depends on quality of water and type of lining
the investment you make in your home, and prolonging the useful ♦ electric - 14 years
life of the many components that comprise your home. The following ♦ gas - 11-13 years
are some reasonable life expectancy ranges of the more important • Tankless Water Heater - 20 years
and costly components of your home. These ranges assume that the • Forced Air Furnace, heat pump - 15 years
homeowner is following an advised maintenance schedule. • Duct Work:
♦ plastic - 15 years
Roofing ♦ galvanized - 30 years
Asphalt/Wood Shingles and Shakes dependent on environment • Rooftop Air Conditioner - 15 years
15-30 years • Boiler - 30 years
• Gas Furnace - 18 years
• Tile - 50 years • Unit Heater, gas or electric - 13 years
• Slate - 50-100 years • Radiant Heater:
• Sheet Metal - 20-50+ years ♦ electric - 15 years
• Built Up Roofing: ♦ hot water or steam - 25 years
♦ asphalt - 12-25 years • Air Terminals: diffuser, grill, or register - 27 years
♦ coat and tar - 12-30 years • Induction and Fan-coil units - 20 years
♦ asphalt composition - 15-30 years • Damper - 20 years
♦ asphalt over lag - 25-30 years • Fan:
♦ centrifugal - 25 years
Siding ♦ axial - 20 years
• Gutters and Downspouts – 20-30 years ♦ ventilating roof mounted - 20 years
• Copper - 50+ years • Coils:
• Siding: ♦ DX, water or steam - 20 years
♦ wood - 10-100 years (10 yrs if constantly wet, 100 if ♦ electric - 15 years
properly maintained) • Heat Exchanger - 24 years
♦ metal - 50-life of structure • Molded insulation - 20 years
♦ aluminum - 20-50 years • Pump, Sump and Well - 10 years
♦ vinyl - 50 years • Burner - 21 years
♦ brick or rock - life of structure • Thermostat – 8-25 years
♦ Fiber Cement - life of structure
• Manufactured Stone - life of structure
• Stucco - 50-100 years

Windows
• Window Glazing - 20 years
• Wood Casement - 20-50 years
• Aluminum Casement - 10-20 years
• Screen - 25-50 years
• Skylight – 15-20 years
• Vinyl – 15-30 years

Heating, Ventilation, A/C
• Air Conditioning Unit:
♦ central unit new units last longer – 15-20 years
♦ window unit - 10 years
• Unit Compressor - 15 years
• Humidifier Gateway recommends immediate disconnection

8 years
• Dehumidifier – 8 years

68

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Checklist for Finding and Hiring a Builder

Doing a little due-diligence prior to selecting a builder will help you  Ask the builder to provide you with names of previous customers. If
have a more successful experience. BNCW has some good consumer they won’t, beware. If they do, ask the customers if they would
resources available on our website to help you! Simply visit our website hire the builder again.
at www.BuildingNCW.org and look for the “Resources” tab.
 Ask if you can see the builder’s work, both completed and in
Use this checklist to help you select a home builder to build your home: progress. Check for quality of workmanship and materials.

 Refer to the directory in the rear of this guide for the names of  Do you feel you can easily communicate with the builder?
member builders. You can also ask family, friends or co-workers Remember you will be in close contact with them throughout the
for recommendations. construction process and afterward as you live in your new home.

 Make sure the builder has a permanent business location and a  Make sure the builder provides you with a complete and clearly
good reputation with local banks and suppliers. written contract. The contract will benefit both of you. If you are
having a new home built, get and review a copy of the home
 Find out how long they have been in the building business. It warranty and homeowner manual as well.
usually takes three to five years to establish a financially sound
business. You want to make sure they will be around after the  Be cautious of unusually low-priced bids. If the builder is unable to
construction is complete to service any warranties. pay for the materials and labor as the project proceeds, this may
indicate a potential problem—not always, but potentially. Keep in
 Check out the company’s rating and if there have been any mind that less expensive does not necessarily mean better!
complaints filed with the local Better Business Bureau: www.bbb.org.

 Make sure  the builder has sufficient workers compensation
and general liability insurance. If not, you may be liable for any
construction-related accidents on your premises.

Buying a home is probably Local
the most expensive purchase
CUSTOM HOME BUILDER
you will ever make.
Greg White
Home Inspections
Structural Pest OFFICE: (509) 663-7420
Inspections CELL : (509) 669-1313

Foundation “My promise to you is to conduct We love what we do and take pride in our work!
Certi cations a thorough professional In-
IR Thermography Visit our online gallery at
spection with a comprehensive, www.glwhiteconstruction.com
easy-to-understand written
report of my ndings” We think you will like it too!

Don Hester (509) 670-9572 Greg & Cheryl White Lic. #GLWHICI100PB

www.ncwhomeinspections.com 69

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

If You Need to Evacuate Your Home

There may be conditions under which you will decide to get away or • Take your emergency supply kit unless you have reason to believe it
there may be situations when you are ordered to leave. Follow these has been contaminated.
guidelines for evacuation:
• Listen to a battery-powered radio and follow local evacuation
• Plan places where your family will meet, both within and outside of instructions.
your immediate neighborhood. Use the Family Emergency Plan to
decide these locations before a disaster. • Take your pets with you, but understand that only service animals
may be permitted in public shelters. Plan how you will care for your
• If you have a car, keep a full tank of gas in it if an evacuation seems pets in an emergency.
likely. Keep a half tank of gas in it at all times in case of an unexpected
need to evacuate. Gas stations may be closed during emergencies IF TIME ALLOWS:
and unable to pump gas during power outages. Plan to take one car
per family to reduce congestion and delay. • Call or email the out-of-state contact in your family communications
plan. Tell them where you are going.
• Become familiar with any alternate routes and other means of
transportation out of your area. Choose several potential destinations • Secure your home by closing and locking doors and windows.
in different directions so you have options in an emergency.
• Unplug electrical equipment such as radios, televisions and small
• Leave early enough to avoid being trapped by severe weather. appliances. Leave freezers and refrigerators plugged in unless there
is a risk of flooding. If there is damage to your home and you are
• Follow recommended evacuation routes. Do not take shortcuts; they instructed to do so, shut off water, gas and electricity before leaving.
may be blocked.
• Leave a note telling others when you left and where you are going.
• Be alert for road hazards such as washed-out roads or bridges and
downed power lines. Do not drive into flooded areas. • Wear sturdy shoes and clothing that provides some protection such
as long pants, long-sleeved shirts and a cap.
• If you do not have a car, plan how you will leave if you have to. Make
arrangements with family, friends or your local government. • Check with neighbors who may need a ride.

Specializing in TRAVIS KNOOP PROUD MEMBER

Moonlight Custom Stone TPHrOaTOvGiRsAPKHYnoop
PhotographySpecializing in Real Estate,
TILE & STONE Countertops
Specializing in Custom Landscape & HDR Photography
Stone Counter Tops
PROUD MEMBER
(509) 782-2464GRANITE • TRAVERTINE
Spe5c0i9a.l8iz6in0g.4i3n2R1eal Estate and
MARBLE • SOAPSTONE [email protected] tography

GRANITEQUARTZ www.travisknoopphotography.com
(509) 782-2464
5970 Sunburst Ln #3 509.860.4321
[email protected]
QUARTZCashmere, WA 98815 www.travisknoopphotography.com
Licensed & Bonded
MOONLTS953•KB

RECYCLED GLASS

Visit Our Showroom At:

4932 Contractors Drive #B
East Wenatchee, WA 98802

www.MoonlightTileandStone.com PROUD MEMBER

Licensed & Bonded • MOONLTS953*KB

70

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

Home Maintenance Tips

This checklist contains tasks you should complete at least on an IN THE SPRING:
annual basis to keep your home operating efficiently and to protect
your investment. R Check the condition of glazing compound, caulking and exterior

ANYTIME DURING THE YEAR: paint. Replace or paint as needed.

RCheck all connections to your electrical system for possible R Exchange glass and screens in storm doors and/or windows (also

hazards. in autumn).

RCheck cords and plugs of all electrical appliances for fraying or R Inspect the roof for snow damage.

signs of wear. Repair or replace as necessary. Do not overload R Check for evidence of termites such as sagging floors and ceilings
extension cords.
or dry, brown tunnels in the ground near the home’s foundation.
RTest your smoke detectors, carbon monoxide detector and radon
R Seed and feed the lawn and plant annuals, cut back perennials
detector for proper operation. Clean the units with a vacuum or
cotton swab and replace batteries and light bulbs if needed. that need pre-growth pruning.

RHave your heating and air conditioning system(s) inspected IN THE AUTUMN:

and cleaned. If your system(s) has a filter, replace it every three R Mulch perennials that need protection from winter weather and
months to keep your unit working efficiently.
prune those that should be cut back in the fall.
RInspect all doors and windows for proper operation and a tight fit.
R Rake and compost leaves.
Clean the window tracks, clean and adjust the door thresholds
and check that the weather-stripping hasn’t cracked or torn. R Remove hose connections and store hoses to avoid freezing.
Preventing unwanted outside air from leaking into your home will
reduce your energy bills.

RCheck interior paint and touch up or repaint as needed.

RInspect the attic insulation. Make sure the entire ceiling area is

covered. Check that the insulation has not blocked vents in the
eaves to prevent buildup of condensation and to allow proper air
circulation. Insulation should also not be touching the underside of
the roof sheathing.

ROil motors of appliances as directed in instruction manuals.

RPeriodically check storage areas, closets, and the basement to

make sure no oily rags, gas cans, painting supplies or flammable
cleaning materials have been stored and forgotten. These items
could be a fire hazard and should be discarded.

RCheck that the alarm and circuits of your security system are in

working order, inspect the sensors one by one, and check primary
and backup batteries monthly.

RInspect your stairs, steps and ladders for damage or broken

pieces that could cause someone to fall. Make sure handrails and
railings are sturdy and securely attached.

71

BNCW proudly serves our small-business members
throughout North Central Washington, in part, by:

•

•

•
•
•

•

•
•

www.BuildingNCW.org

2018 BNCW Membership Directory

ACCOUNTING / Veritas Accounting Solutions Quality Pacific, Inc. Lopez Design, LLC
BOOKKEEPING Ceinwyn Rudnick Paul Sunich Abe Lopez
SERVICES Wenatchee, WA 98801 13555 Bel Red Rd., Ste. 206 PO Box 2674
(509) 979-7431 Bellevue, WA 98005 Wenatchee, WA 98807
Augustedge, PLLC [email protected] (425) 746-4660 (509) 398-0120
Tricia McCullough www.veritasaccountingsolutions.com Fax (425) 746-0603 Fax (509) 555-1212
521 S Chelan Avenue, Suite A [email protected] [email protected]
Wenatchee, WA 98801 ADVERTISING, www.lopez-design.com
(509) 494-8500 MARKETING APPLIANCE SALES &
Fax (509) 494-8504 SERVICE modFORM LLC
[email protected] Graybeal Signs, Inc. Duff Bangs
www.august-edge.com Monte Graybeal Sav-Mart East Wenatchee, WA 98802
1909 N. Wenatchee Ave. 1729 N. Wenatchee Ave (206) 902-8232
CliftonLarsonAllen Wenatchee, WA 98801 Wenatchee, WA 98801 [email protected]
Angela Spies (509) 662-6926 (509) 663-1671 https://www.modformllc.com/
517 North Mission, Ste. B Fax (509) 663-4583 Fax (509) 662-3788
Wenatchee, WA 98801 [email protected] [email protected] ARTIFICIAL TURF /
(509) 663-5622 www.graybealsigns.com www.savmart.net SYNTHETIC LAWNS
Fax (509) 663-5732
[email protected] Inbound Wenatchee APPRAISAL MJ’s Odds & Ends, LLC dba
www.cliftonlarsonallen.com Shae Lipp Worry Free Lawns
East Wenatchee, WA 98802 NCW Appraisal Mat Nikolas
Cordell, Neher & Company (509) 741-0040 Tony Thompson Wenatchee Area
PLLC [email protected] 410 Pioneer Drive Malaga, WA 98828
Sean Patton, CPA http://inboundwenatchee.com/ Wenatchee, WA 98807 (509) 670-0407
175 E. Penny Rd., Ste. 1 (509) 387-6256 Fax (509) 662-8875
Wenatchee, WA 98807 The ADG Media Group, LLC Fax (509) 664-5115 [email protected]
(509) 663-1661 Amy Gustin [email protected]
Fax (509) 662--5678 PO Box 1886 www.ncwappraisal.com ASBESTOS
[email protected] Wenatchee, WA 98807 ABATEMENT /
www.cnccpa.com (509) 264-1852 ARCHITECTS, INSPECTION
Fax (509) 888-2067 DRAFTING, DESIGN &
Greg Brault, CPA [email protected] ENGINEERING A Central, LLC
Greg Brault www.theadgmediagroup.com Rob Witheridge
East Wenatchee, WA 98802 Complete Design, Inc. 1509 S. Wenatchee Ave.
(425) 985-2914 The Good Life Ryan Kelso Wenatchee, WA 98801
[email protected] Mike Cassidy PO Box 1914 (509) 860-3519
10 First St., #108 Wenatchee, WA 98807 Fax (509) 888-5543
Red Bench LLC Wenatchee, WA 98801 (509) 662-3699 [email protected]
Christa Michel (509) 888-6527 [email protected]
2226 Stephanie Brooke [email protected] www.completedesign.cc A1 Asbestos, LLC
Wenatchee, WA 98807 www.ncwgoodlife.com Tim Powell
(509) 423-7172 1115 Walla Walla Ave., Suite A
[email protected] APARTMENT Forte Architects Wenatchee, WA 98801
http://redbenchfinancial.com RENTALS Lenka Slapnicka (509) 782-8889
240 N. Wenatchee Ave. Fax (509) 782-0332
Tidd Tax & Accounting LLC Poltz Rentals, LLC Wenatchee, WA 98801 [email protected]
Steve/Tina Tidd Beth Gordon (509) 293-5566 www.asbestoswenatchee.com
Wenatchee, WA 98801 307 S. Mission, Ste. H Fax (509) 664-6817
(509) 662-5951 Wenatchee, WA 98801 [email protected] 73
Fax (509) 888-0186 (509) 662-9723 www.fortearchitects.com
[email protected] Fax (509) 663-8072
www.tiddtax.com [email protected]

2018 BNCW Membership Directory

ASSOCIATIONS / WV Chamber of Commerce AUDIO / VIDEO Town Ford Lincoln
ORGANIZATIONS Shiloh Schauer Pat Armstrong
137 N. Wenatchee Ave. Deep Water Home & 700 3rd St. SE
G.W.A.T.A. Wenatchee, WA 98801 Electronics East Wenatchee, WA 98802
Jenny Rojanasthien (509) 662-2116 Ken Moore (509) 663-2111
285 Technology Center Way Ste. 133 Fax (509) 663-2022 131 E. Woodin Ave. Fax (509) 663-8222
Wenatchee, WA 98801 [email protected] Chelan, WA 98816 [email protected]
(509) 661-9000 www.wenatchee.org (509) 682-4529 www.yourtownford.net
[email protected] Fax (509) 888-2036
www.gwata.org ATTORNEYS [email protected] Town Toyota
www.deepwaterelectronics.com Tony Lisson
Lake Chelan Chamber of Davis, Arneil Law Firm LLP 500 3rd Street SE
Commerce Danielle Marchant / Steve Smith AUTO / TRUCK East Wenatchee, WA 98802
Tiffany Gering 617 Washington Street DEALERS (509) 888-5000
216 E Woodin Ave Wenatchee, WA 98801 Fax (509) 888-5052
Chelan, WA 98816 (509) 662-3551 Apple Valley Honda [email protected]
(509) 682-3503 Fax (509) 662-9074 Tod McLaughlin www.towntoyota.com
[email protected] [email protected] 400 Highline Dr.
www.lakechelan.com www.dadkp.com East Wenatchee, WA 98802 AUTO BODY /
(509) 662-1551 COLLISION REPAIR /
NCW Economic Development Jeffers, Danielson, Sonn & Fax (509) 662-5632 GLASS
District Aylward, P.S. [email protected]
Karen Francis-McWhite H. Lee Lewis www.applevalleyhonda.com First Choice Collision Center, Inc.
1300 Fifth Street 2600 Chester Kimm Road 601 N. Wenatchee Ave.
Wenatchee, WA 98807 Wenatchee, WA 98801 Cascade Autocenter Wenatchee, WA 98801
(509) 682-6907 (509) 662-3685 Tom Welch (509) 663-7008
[email protected] Fax (509) 662-2452 148 Easy Street Fax (509) 663-8299
www.ncwedd.com [email protected] Wenatchee, WA 98801 [email protected]
www.jdsalaw.com (509) 663-0011 www.firstchoicecc.com
SMART Association Fax (509) 663-8839
Brian Ducey Moore Law Firm, PLLC [email protected] BANKS, CREDIT
1711 S. Jackson St. Byron J. Moore www.cascadeautocenter.com UNIONS & FINANCIAL
Seattle, WA 98144 1114 N. Mission Street INSTITUTIONS
(206) 812-3819 Wenatchee, WA 98801 Sangster Motors, Inc.
Fax (206) 285-1693 (509) 293-9867 Don Sangster Banner Bank
[email protected] Fax (509) 241-0941 912 N. Miller St. Brette Sangster
www.smartwa.org [email protected] Wenatchee, WA 98801 501 N. Mission St.
www.moorelawpllc.com (509) 662-6134 Wenatchee, WA 98801
The Wenatchee Downtown Fax (509) 662-6137 (509) 886-8282
Association Ogden Murphy Wallace, PLLC [email protected] Fax (509) 663-7439
Linda Haglund Julie K. Norton www.sangstermotors.com [email protected]
103 Palouse Street, #35 1 -Fifth Street, Suite 200 www.bannerbank.com
Wenatchee, WA 98801 Wenatchee, WA 98801 Town Chrysler Jeep Dodge
(509) 662-0059 (509) 662-1954 Nissan North Cascades Bank
Fax (509) 665-9889 (509) 663-1553 Tony Lisson Mindi Doré
[email protected] [email protected] 1001 N Miller St. 614 N. Mission Street
www.wendowntown.org www.omwlaw.com Wenatchee, WA 98801 Wenatchee, WA 98801
(509) 888-9595 (509) 682-7372
Fax (509) 888-0737 Fax (509) 888-6009
[email protected] melinda.dore@
www.townchryslerdodge.net northcascadesbank.com
www.northcascadesbank.com

Visit www.BuildingNCW.org for an up-to-date directory

74

2018 BNCW Membership Directory

Numerica Credit Union Lowe’s Home Improvement CABINETS The Floor Factory, Inc.
Denise Gallucci Warehouse Vickie Sparks
615 N. Emerson Ave. Ramon Iniguez Bagdon’s Inc. 13 S. Wenatchee Ave.
Wenatchee, WA 98801 1200 Walla Walla Larry & Sarah Bagdon Wenatchee, WA 98807
(509) 667-7251 Wenatchee, WA 98801 760 S. Wenatchee Ave. (509) 662-1421
Fax (509) 662-7276 (509) 663-4530 Wenatchee, WA 98801 Fax (509) 662-0602
[email protected] Fax (509) 663-7978 (509) 662-1411 [email protected]
www.numericacu.com [email protected] Fax (509) 662-1478 www.thefloorfactory.com
www.lowes.com [email protected]
Peoples Bank www.bagdons.com The Floorman
Ann George Marson & Marson Lumber, a Dave Lutz
901 N. Mission St. division of TAL Holdings, LLC Ovenell’s Cabinets Orondo, WA 98843
Wenatchee, WA 98801 Rodney Bullion Milo Klanke (509) 699-0099
(509) 664-5311 11724 Riverbend Drive 305 Mission Ave. [email protected]
Fax (509) 664-5315 Leavenworth, WA 98826 Cashmere, WA 98815
[email protected] (509) 548-5829 (509) 782-3400 CARPET CLEANING
www.peoplesbank-wa.com Fax (509) 548-6372 Fax (509) 782-3401
rodney.bullion@ [email protected] Clean Air Connection
Washington Federal marsonandmarson.com www.ovenells.com Verl Sutton
Amanda Pearcy www.marsonandmarson.com 10 Fifth Street
830 N Wenatchee Ave Smith Custom Woodworking, Inc. Wenatchee, WA 98801
Wenatchee, WA 98801 Midway Building Supply Jared Smith (509) 663-9562
(509) 662-4429 Chris Wood 3768 N. George St. Fax (509) 662-3199
Fax (509) 664-5476 132 Clarkson Mill Road East Wenatchee, WA 98802 [email protected]
[email protected] Tonasket, WA 98855 (509) 884-3781 www.yourcleanconnection.com
www.washingtonfederal.com (509) 486-2888 jared@
Fax (509) 486-1363 smithcustomwoodworking.com CEMENT / CONCRETE
Washington Trust Bank [email protected] www.smithcustomwoodworking.com ASPHALT
Heidi Myers www.midwaybuilding.com
523 Valley Mall Parkway CARPET & FLOOR Central Washington Concrete
East Wenatchee, WA 98802 Valley Supply Co. COVERINGS Jake Holt
(509) 884-7111 Greg Berman 1351 S. Wenatchee Ave.
Fax (509) 884-9861 404 N Railroad Ave. Inside Design Carpet One Wenatchee, WA 98807
[email protected] Ellensburg, WA 98926 Joel McDonald (509) 662-6375
www.watrust.com (509) 933-1800 2101 N. Duncan Drive Fax (509) 662-6856
Fax (509) 933-1802 Wenatchee, WA 98801 [email protected]
BUILDING PRODUCT / [email protected] (509) 662-9500 www.centralwashingtonconcrete.com
LUMBER SUPPLIERS www.valleysupply.com Fax (509) 663-1010
[email protected]
Builders FirstSource Western Materials, Inc. www.insidedesignc1.com
Dane Strausz / Greg Armstrong Andy Johnston
3628 Chelan Hwy North 5704 Nelpar Drive Committed to your satisfaction...
Wenatchee, WA 98801 East Wenatchee, WA 98802
(509) 662-4407 (509) 886-5182 Dedicated to your safety PROUD MEMBER
Fax (509) 662-1153 Fax (509) 886-5184
[email protected] [email protected] Approved
www.probuild.com www.westernmaterials.com Auto Body

Lake Chelan Building Supply Weyerhaeuser Free Estimates
Brett LaMar Arlyn Anderson
585 Wapato Way 20616 Brown R Lifetime Warranty
Manson, WA 98831 Monroe, WA 98272
(509) 687-9595 (206) 369-7667 Laser Measuring System
Fax (509) 687-9652 [email protected]
[email protected] www.trusjoist.com www.FirstChoicecc.com
www.yourlumberyard.com Allen & Kim Tangeman, Owners
601 N. Wenatchee Ave. • 509-663-7008

75

2018 BNCW Membership Directory

Godbey Red-E-Mix COMPUTER STORES, CONCRETE REPAIR/ Carlisle Classic Homes
David Freels PARTS, SERVICE & MAINTENANCE Chris Groby
505 S.W. Ansel CONSULTING 1567 Alpensee Strasse
Brewster, WA 98812 SlabJack Geotechnical Leavenworth, WA 98826
(509) 689-2415 FastNetSecurity LLC Jerald Sargent (206) 782-7070
Fax (509) 689-2041 Martin Hall East Wenatchee, WA 98802 [email protected]
[email protected] 11419 Hwy 97A #1 (509) 888-4600 www.cchseattle.com
Entiat, WA 98822 [email protected]
Wenatchee Sand & Gravel (509) 423-7884 www.slabjackgeotechnical.com Chelan Cedar Homes
Bob Mikelson [email protected] Rick Reed
1351 S. Wenatchee Ave. www.fastnetsecurity.com CONTRACTOR PO Box 3149
Wenatchee, WA 98801 - RESIDENTIAL Chelan, WA 98816
(509) 663-5141 Firefly BUILDER (509) 682-9783
Fax (509) 662-6856 11 Spokane St., Ste. 102 [email protected]
[email protected] Wenatchee, WA 98801 Beazley Construction www.chelancedarhomes.com
www.wenatcheesandandgravel.com (509) 663-TECH Sam Beazley
[email protected] PO Box 739 Custom Construction &
CLEANING SERVICES www.thinkfirefly.com Manson, WA 98831 Cabinetry by Shane Covey, LLC
- RESIDENTIAL / (509) 687-3805 Shane Covey
COMMERCIAL CONCRETE Fax (509) 687-3805 Wenatchee, Chelan
[email protected] Chelan, WA 98816
Below the Surface Cleaning Black Forest Finishing (509) 885-0961
Kristen Kennedy / Michele John Black Berry Construction [email protected]
Stutzman 790 Black Forest Road 3014 GS Center Road www.wenatcheebuilt.com
PO Box 4949 Wenatchee, WA 98801 Wenatchee, WA 98801 www.chelanbuilt.com
Wenatchee, WA 98807 (509) 630-0660 (509) 888-1961
(509) 670-7072 [email protected] [email protected] Delthor Construction &
[email protected] http://blackforestfoundation.com/ www.berrycon.com Development
www.belowthesurfacecleaning.com Justin Delfino
Industrial Cutting & Coring, Inc. BOA Construction Co. Omak, WA 98841
Clear View Services, Inc. Pat Brown Clark Cooke (509) 846-1111
Marsha Hays 101 S. Roland Ave. East Wenatchee, WA 98802 [email protected]
PO Box 4865 East Wenatchee, WA 98802 (509) 886-7777
Wenatchee, WA 98807 (509) 886-4114 Fax (509) 884-5790 Dream Makers Construction LLC
(509) 663-1931 Fax (509) 886-4111 [email protected] Jose Perez
[email protected] [email protected] www.boaconstruction.net Cashmere, WA 98815
www.clearviewncw.com www.industcutcore.com (509) 423-4969
BTO Construction [email protected]
Karen’s Kleening Jones Concrete, LLC Steve Varrelman http://dreammakersconstruction.net
Karen Holtorf Aaron Jones PO Box 67
East Wenatchee, WA 98802 Wenatchee, WA 98801 Pateros, WA 98846 Eider Construction, LLC
(509) 884-5998 (509) 679-9431 (509) 923-2802 Chad Miller
[email protected] [email protected] Fax (509) 923-0222 PO Box 139
[email protected] Orondo, WA 98843
COMMERCIAL Legion Concrete Services LLC (509) 699-1092
REFRIGERATION Obed Maravilla C & C Investment Properties LLC [email protected]
39 Fisher Lane Randy Cooper www.eiderbuilding.com
North Valley Mechanical, Inc. Orondo, WA 98843 PO Box 2874
Rodney Rumbolz (509) 860-4723 Wenatchee, WA 98807 G.L. White Construction, Inc.
PO Box 1369 [email protected] (509) 670-6706 Greg White
Okanogan, WA 98840 [email protected] Wenatchee, WA 98801
(509) 422-5544 (509) 663-7420
Fax (509) 422-5545 Fax (509) 667-9774
[email protected] [email protected]
www.glwhiteconstruction.com
76

2018 BNCW Membership Directory

Ghiglia Homes LLC Jessup Home Design One-Way Construction NW Inc. Springwater Homes, LLC
Jim Ghiglia Alan Jessup Brandon Littrell Matt Bergey
Wenatchee, WA 98801 East Wenatchee, WA 98802 PO Box 3096 Wenatchee, WA 98801
(509) 679-2505 (509) 679-4030 Leavenworth, WA 98826 (509) 387-0805
[email protected] Fax (509) 884-0598 (509) 679-3256 [email protected]
www.ghigliahomes.com [email protected] [email protected] www.springwaterhomesllc.com
www.onewayconstructionnw.com
Gold Construction, Inc. Lange Construction, LLC Stimac Construction, Inc.
Randy Gold Andrew Lange Phenix Construction, Inc. Vince Stimac
PO Box 2507 Wenatchee, WA 98801 Mel Shiley 630 Valley Mall Pkwy #411
Wenatchee, WA 98807 (509) 860-3604 Chelan, WA 98816 East Wenatchee, WA 98802
(509) 663-4946 [email protected] (509) 670-0270 (509) 884-1873
Fax (509) 662-9694 www.mylangehome.com [email protected] Fax (509) 886-5077
[email protected] [email protected]
www.goldconstruction.org Lenssen Homes Pinnacle Custom Builders, Inc.
Kent Lenssen Travis Hofstetter The Castle Builders
H & H Construction NW, LLC Malaga, WA 98828 25 Beacon Dr. Ken Schober
Travis and Tina Hofstetter (509) 679-1996 East Wenatchee, WA 98802 East Wenatchee, WA 98802
PO Box 3646 Fax (509) 888-6987 (509) 884-1873 (509) 884-2726
Wenatchee, WA 98807 [email protected] Fax (509) 436-0024 [email protected]
(509) 670-8129 www.lenssenhomes.com [email protected]
Fax (509) 667-2508 The Craftsman
[email protected] Lexar Homes Real Homes Tim Resch
www.hhconstructionnw.com Rob Eldred Jon Port 25 N. Wenatchee Ave. Suite 106
147 Easy Way #104 1833 N. Wenatchee Ave. Wenatchee, WA 98801
Hackenmiller Construction LLC Wenatchee, WA 98801 Wenatchee, WA 98801 (509) 860-2168
Dustin Hackenmiller (509) 663-1722 (509) 886-8888 [email protected]
Wenatchee, WA 98801 Fax (509) 663-1717 Fax (509) 662-2449
(509) 860-5331 [email protected] [email protected] Village Life
[email protected] www.lexarhomes.com www.realhomes.info Justin Osborne
788 Grant Road
Hanson Home Construction, LLC McDonald Building, LLC Roberts Construction, LLC East Wenatchee, WA 98802
Dave Hanson Tim McDonald Mike Roberts (425) 531-2364
East Wenatchee, WA 98802 15303 Lakeview St. East Wenatchee, WA 98802 [email protected]
(509) 670-1153 Entiat, WA 98822 (509) 669-3435 www.villagelifehomes.com
[email protected] (509) 784-1602 [email protected]
www.hansonhomesllc.com Fax (509) 271-0059 Wessman Construction, LLC
[email protected] Sadler Construction, Inc. Randy Wessman
Harper Homes, LLC www.mcdonaldbuilding.com Steve Sadler Cashmere, WA 98815
Brian Harper PO Box 2081 (509) 264-9662
East Wenatchee, WA 98802 Olson’s Construction, Inc. Wenatchee, WA 98807 [email protected]
(509) 630-4012 Rob Olson (509) 669-1582
[email protected] PO Box 1653 Fax (509) 663-4926 Yusi Construction, Inc.
Wenatchee, WA 98807 [email protected] Brent Yusi
Helton Builders Inc. (509) 630-3317 www.sadlerluxuryhomes.com PO Box 1670
J. Curtis Helton Fax (509) 888-1956 Okanogan, WA 98840
Wenatchee, WA 98801 [email protected] Sage Homes, LLC (509) 422-3738
(509) 663-6662 www.olsonsconstruction.com Rebecca Hackworth Fax (509) 422-5792
[email protected] Wenatchee, WA 98807 [email protected]
(509) 899-9800
Fax (509) 662-4465 77
[email protected]
www.sagehomellc.com

2018 BNCW Membership Directory

COUNTERTOPS ELECTRICAL - EMPLOYMENT ENVIRONMENTAL
COMMERCIAL AGENCIES, JOB CONSULTING
Moonlight Tile & Stone & RESIDENTIAL TRAINING &
Stacy Carlile CONTRACTORS PLACEMENT Grette Associates LLC
4932 Contractors Drive #B SERVICES Ryan Walker
East Wenatchee, WA 98802 Columbia Valley Electric 151 S. Worthen, Ste. 101
(509) 782-2464 Jeff McDonald Active Employment Solutions Wenatchee, WA 98801
Fax (509) 782-2455 339 9th St. NE #4301 Sabrina Reister (509) 663-6300
[email protected] East Wenatchee, WA 98802 1325 N. Princeton Ave. Fax (509) 664-1882
www.moonlighttileandstone.com (509) 670-5026 Wenatchee, WA 98801 [email protected]
[email protected] (509) 888-2105 www.gretteassociates.com
Precision Waterjet, Inc. Fax (509) 888-3065
Troy Bassett Custom Electric, LLC [email protected] EQUIPMENT RENTAL
207 S. Columbia Jay & Mandy Welch / LEASING
Wenatchee, WA 98801 Wenatchee, WA 98801 Work-Force Solutions, Inc.
(509) 888-7954 (509) 264-9550 Debra Montgomery Pape Material Handling
Fax (509) 888-0581 Fax (509) 665-4964 645 Valley Mall Pkwy. Steve Martinez
[email protected] [email protected] East Wenatchee, WA 98802 3500 Highway 97A
www.precisionwaterjetinc.com (509) 888-7779 Wenatchee, WA 98801
Don Kruse Electric, Inc. Fax (509) 888-6664 (509) 884-2934
DECKS / PORCHES Kevin Diefenbach [email protected] Fax (509) 884-7730
PO Box 2088 www.workforcewa.com [email protected]
Wenatchee Deck & Patio Omak, WA 98841 www.paperents.com
Zack Benson (509) 826-4301 ENGINEERS - CIVIL
Cashmere, WA 98815 Fax (509) 826-2749 / ELECTRICAL / Valley Tractor & Rentals
(509) 322-8554 [email protected] STRUCTURAL / Pete Burke
[email protected] www.dkeinc.net MARINE 4857 Contractors Drive
www.wenatcheedeck.com East Wenatchee, WA 98802
Leavenworth Electric & Torrence Engineering, LLC (509) 886-1566
DOORS / HARDWARE Excavation, Inc. John Torrence Fax (509) 884-5464
LOCKS Mike McComas 6377 Kimber Rd. [email protected]
15353 Hwy 2 Cashmere, WA 98815 www.valleytractor.com
Exterior Solutions Leavenworth, WA 98826 (509) 782-1897
150 1st S.E. (509) 763-2000 Fax (509) 782-3436 EVENT PLANNING
East Wenatchee, WA 98802 [email protected] [email protected]
(509) 886-8547 www.torrence-eng.com Branching Out
Fax (509) 886-1577 Vassar Electric, Inc. Leona Wolk
[email protected] Danny Vassar Z Engineers, PLLC East Wenatchee, WA 98802
www.extsoldoorsandwindows.com Tonasket, WA 98855 Brian Ziesmer (509) 393-4018
(509) 486-1243 1 5th Street, Ste. #150 [email protected]
DRYWALL Fax (509) 486-0192 Wenatchee, WA 98801 www.branchingout.today
[email protected] (509) 888-9364
Crossroads Drywall & www.vassarelectric.com Fax (509) 888-9365 EXCAVATION
Construction, LLC [email protected]
Russ Miller Wenatchee Electric LLC www.z-engineers.com Allemandi Construction, Inc.
Wenatchee Jordan Dovich Mike Allemandi
Malaga, WA 98828 Wenatchee, WA 98801 PO Box 4001
(509) 860-2245 (509) 393-9800 Wenatchee, WA 98807
Fax (509) 470-8041 [email protected] (509) 662-3529
[email protected] Fax (509) 662-0134
[email protected]
www.allemandiconstruction.com

78

2018 BNCW Membership Directory

J & K Earthworks, LLC TYCO Excavation & Grading Paramount Financial Advisors FIREPLACE & STOVE
Kurt Davis Tyler Tastad Greg Lone
5593 Nature Shore Dr. East Wenatchee, WA 98802 616B Valley Mall Pkwy The Fireplace Guys
Rock Island, WA 98850 (509) 699-0036 East Wenatchee, WA 98802 Alan Bentley
(509) 886-5906 [email protected] (509) 662-1100 1205 Walnut St.
Fax (509) 886-4817 www.tycodirt.com greg@ Wenatchee, WA 98801
[email protected] paramountfinancialadvisors.com (509) 885-9034
www.jkearthworks.com FARM EQUIPMENT, www.paramountfinancialadvisors Fax (866) 903-0928
CHEMICALS, SEEDS & [email protected]
Rains Contracting, Inc. FEED FINISH CARPENTRY www.thefireplaceguy.net
Kurt Rains
44 B & O Road Coastal Farm & Ranch Pfluger Craft, LLC FOOD PRODUCTS
Malott, WA 98829 Tammy Cockrill Lee Pfluger & BEVERAGES,
(509) 422-2326 260 Highline Drive East Wenatchee, WA 98802 WHOLESALE &
Fax (509) 422-3435 East Wenatchee, WA 98802 (509) 881-1530 DISTRIBUTION
[email protected] (509) 886-1560 Fax (509) 886-4140
www.rainscontracting.com Fax (509) 886-1649 [email protected] Costco Wholesale #112
[email protected] Jenny Hoffert
Rayfield Bros. Excavating, Inc. www.coastalfarm.com Ponderosa Contracting, LLC 375 Highline Dr. S.
David Rayfield Cris Doré East Wenatchee, WA 98802
9810 Big Y Junction Road FENCING / PERGOLAS Wenatchee, WA 98801 (509) 886-9507
Peshastin, WA 98847 / GAZEBOS (509) 264-9537 Fax (509) 886-9406
(509) 548-5135 [email protected] [email protected]
Fax (509) 548-3102 Eagle Fence Store www.costco.com
[email protected] Alex Lange
735 N. Wenatchee Ave. FIRE SAFETY / FOUNDATIONS
Sligar Excavation Wenatchee, WA 98801 SPRINKLERS
Matt Sligar (509) 860-3603 All American Waterproofing
PO Box 1151 Fax (509) 888-2418 Inland Fire Protection, Inc. and Spray Inc.
Wenatchee, WA 98807 [email protected] Tom Wilson LaNiece Fenton
(509) 881-1351 www.myeaglefence.com 3028 GS Center Road PO Box 3081
[email protected] Wenatchee, WA 98801 Kirkland, WA 98083
www.sligarexcavation.com Fiddler Fencing LLC (509) 884-6717 (425) 488-0500
Shauna Beeman Fax (509) 667-1705 Fax (425) 272-4262
Smith Excavation Omak, WA 98841 [email protected] [email protected]
Gregg Smith (509) 826-0636 www.inlandfireprotection.com www.WaterproofMyHouse.com
PO Box 284 Fax (509) 826-0637
Cashmere, WA 98815 [email protected] Excavation • Trucking • Septic • Demolition
(509) 782-0446
Fax (800) 811-0924 FINANCIAL SERVICES [email protected] • LIC# SLIGAEL854BZ
[email protected] / INVESTMENTS /
www.smithexcavation.com CONSULTANTS LIGAR
XCAVATION, LLC
Tonka Landshaping & Chadderton Tax and Financial
Excavating Services Licensed • Bonded • Insured
Dustin Christensen Victoria Chadderton
PO Box 142 11 Spokane St., Suite #103 Matt Sligar • Owner 509-881-1351
Wenatchee, WA 98807 Wenatchee, WA 98801
(509) 433-7070 (509) 884-2402 79
[email protected] [email protected]

2018 BNCW Membership Directory

JLW Custom Concrete, Inc. GOVERNMENT / Quality Restoration and Repair HEAVY EQUIPMENT
Jon Wood PUBLIC AGENCIES LLC
East Wenatchee, WA 98802 Nicholas Dumas Columbia Crane
(509) 670-2937 Wenatchee Valley Technical Leavenworth, WA 98826 Lance Hansen
Fax (509) 886-1836 Skills Center (509) 531-8164 3575 US 97-A
[email protected] Peter Jelsing [email protected] Wenatchee, WA 98807
327 E Penny Road (509) 888-6671
Riverway Contractors, LLC Wenatchee, WA 98801 HARDWOOD Fax (509) 888-0092
Dave Smith (509) 662-8827 FLOORING SUPPLIER [email protected]
PO Box 809 Fax (590) 662-5993 & INSTALLER www.columbiacrane.com
Wenatchee, WA 98807 [email protected]
(509) 886-7000 www.wenatcheevalleytech.com Artisan Flooring, LLC HOME AUTOMATION
Fax (509) 886-7002 Jason & Jenny Black
[email protected] GUTTERS Serving the Wenatchee Valley Arseneault Automation, LLC
(509) 782-0777 David Arseneault
FRAMING A and V Gutters Fax (509) 782-0777 East Wenatchee, WA 98802
Vicente Rocha [email protected] (509) 679-9309
J & R Framers East Wenatchee, WA 98802 www.artisanflooringllc.com [email protected]
Justin Horton (509) 670-8254 www.arseneaultautomation.com
Wenatchee, WA 98807 [email protected] Design Hardwood Floors
(509) 630-8363 Dean & Angie Pederson HOME MAINTENANCE
[email protected] Downpour Gutters East Wenatchee, WA 98802
Robbe Anson (509) 662-5586 Cascade Tub Repair, LLC
FURNITURE - INDOOR Wenatchee, WA 98801 [email protected] Dana Hazen
& OUTDOOR (509) 630-2797 Wenatchee, WA 98801
[email protected] HEATING, (509) 664-2447
MKW Furniture VENTILATION & AIR Fax (509) 663-7517
Craig Dixon Waterfall Rain Gutters LLC CONDITIONING [email protected]
Peshastin, WA 98847 Leonel Sanchez www.cascadetubrepair.com
(425) 698-5045 1223 N Baker Ave Cozy Comfort Heating & AC
[email protected] East Wenatchee, WA 98802 Craig Brown HOME STAGING
www.mkwfurniture.com (509) 415-9706 PO Box 2347 SERVICES /
[email protected] Wenatchee, WA 98807 CONSULTING
GEOTECHNICAL https://waterfall-rain-gutters-llc. (509) 665-6859
ENGINEERING business.site/ Fax (509) 664-1230 Designs for Living
SERVICES [email protected] Pam Pettit
HANDYMAN SERVICES PO Box 3718
Nelson Geotechnical Dick’s Heating & A/C of Wenatchee, WA 98807
Associates, Inc. HandyFix Wenatchee (509) 630-7712
Sofia Garibay Mark Abplanalp 5533 Nelpar Drive pam@
5526 Industry Lane, #2 1786 5th Street NE East Wenatchee, WA 98802 designsforlivingwenatchee.com
East Wenatchee, WA 98802 East Wenatchee, WA 98802 (509) 884-6444 www.designsforlivingwenatchee.com
(509) 665-7696 (855) 426-3934 Fax (509) 884-2361
Fax (509)665-7692 [email protected] [email protected] HOUSE MOVING
[email protected] www.handyfix.co www.dicksheatingwenatchee.com
www.nelsongeotech.com Davidson’s Building Moving
On Task Services LLC Patriot Plumbing, Heating & Andy Davidson
GOLF COURSES & Marty Bandy Cooling Inc. Cashmere, WA 98815
EQUIPMENT REPAIR Entiat, WA 98822 Sherry Erickson (509) 881-4583
(509) 237-9949 536 S. Chelan Ave. [email protected]
Highlander Golf Club [email protected] Wenatchee, WA 98801 www.davidsonsbuildingmoving.com
Joe Gordon (509) 662-6262
2920 8th St. SE Fax (509) 662-6662
East Wenatchee, WA 98802 [email protected]
(509) 884-4653 www.CallPatriot.net
Fax (509) 884-9567
[email protected]
www.highlandergc.com

80

2018 BNCW Membership Directory

INSPECTION INSURANCE Jake Davison Agency, INTERNET ACCESS &
SERVICES American Family Insurance
AAA Insurance Agency Jake Davison SERVICES
Heritage Home Inspections LLC Joe Gluzinski 38 N. Chelan Ave.
Tanner Gayle 221 N. Mission Wenatchee, WA 98801 LocalTel Communications
Wenatchee, WA 98801 Wenatchee, WA 98801 (509) 888-9007 Debbie Purcell
(509) 679-2317 (509) 665-6286 Fax (855) 366-9334 341 Grant Road
[email protected] Fax (509) 662-1751 [email protected] East Wenatchee, WA 98802
www.wenatcheehomeinspections.com [email protected] www.jakedavisonagency.com (509) 888-8888
Fax (509) 884-5197
NCW Home Inspections, LLC Basin Pacific Insurance & [email protected]
Don Hester Benefits (UBI = Carlo Narduzzi www.localtel.net
Wenatchee, WA 98807 Ins. Svcs.)
(509) 670-9572 Carlo Narduzzi Libke Insurance Associates, Inc. Skyline Networks, LLC
[email protected] 230 Grant Rd, Suite B23 Jeff Rounds Wes Cusick
www.ncwhomeinspections.com East Wenatchee, WA 98802 600 N. Chelan Ave. 123 Ohme Garden Road, Ste. A
(509) 470-6000 Wenatchee, WA 98807 Wenatchee, WA 98801
Pillar to Post Home Inspectors Fax (509) 470-6272 (509) 662-1800 (509) 293-7257
Michael Hamilton [email protected] Fax (509) 662-1375 [email protected]
East Wenatchee, WA 98802 www.insurewenatchee.com [email protected] www.skylin3.net
(509) 393-2525 www.libke.com
[email protected] Country Financial IRRIGATION / SUPPLY
www.pillartopost.com/ Zane Bock Mitchell, Reed & Schmitten SERVICES
michaelhamilton 224 S Mission Street Insurance
Wenatchee, WA 98801 Craig Field H.D. Fowler
Three Cedars Home Inspection (509) 888-5433 124 E. Penny Rd., Ste. 101 PJ Slagle
Alan Erhardt Fax (509) 888-0899 Wenatchee, WA 98801 5544 Nelpar Drive
Leavenworth, WA 98826 [email protected] (509) 665-0500 East Wenatchee, WA 98802
(509) 881-4664 https://representatives. Fax (509) 664-4004 (509) 886-8804
alan@ countryfinancial.com/zane.bock/ [email protected] Fax (509) 886-0304
threecedarshomeinspection.com www.mrandsinsurance.com [email protected]
www. CPW Insurance www.hdfowler.com
threecedarshomeinspection.com Nicole Holderness Velocity Insurance Group
118 N. Chelan Ave. Dave Shoults JANITORIAL SERVICE,
INSULATION Wenatchee, WA 98801 1625 N. Wenatchee Ave. EQUIPMENT &
(509) 664-2929 Wenatchee, WA 98801 SUPPLIES
Gale Contractor Services Fax (509) 293-4402 (855) 299-3800
Ray Perez [email protected] Fax (855) 214-7887 iPro Building Services, LLC
400 S. Worthen www.cpwauto.com [email protected] Edwin Eaton
Wenatchee, WA 98801 www.nationwide.com East Wenatchee, WA 98802
(509) 662-5171 Draggoo Financial (509) 668-1511
Fax (509) 662-5173 Braden Draggoo Fax (509) 662-5953
[email protected] 500 N. Wenatchee Ave., Ste. C [email protected]
www.truteam.com Wenatchee, WA 98801 www.iprobuildingservices.com
(509) 888-4345
Intermountain West Insulation Fax (509) 663-9034 Three
Russ Foresman [email protected] Cedars
813 Benton Way www.draggoofinancial.com Home
Wenatchee`, WA 98801 Inspection
(509) 929-0008 Alan Erhardt
Fax (509) 888-0868
[email protected] Lic# 1306
www.iwinsulation.com
Professional Inspections
Home Maintenance - Listings - New Construction

509-881-4664

PROUD MEMBER [email protected]

81

2018 BNCW Membership Directory

LAND USE Misty Meadows Landscapes, LLC Vita Green, LLC Columbia River Steel
CONSULTING Martin Alvarez Mike Stancil Steve Rimple / Doug Gardner
901 4th St. SE 3774 Iroquois Lane 284 Urban Industrial Ave.
Dan Beardslee Consulting East Wenatchee, WA 98802 Wenatchee, WA 98801 East Wenatchee, WA 98802
Dan Beardslee (509) 667-9538 (509) 663-8670 (509) 886-0180
East Wenatchee, WA 98802 [email protected] Fax (509) 663-8315 Fax (509) 886-8745
(509) 670-4318 www.mistymeadowslandscapes.com [email protected] [email protected]
[email protected] www.vitagreenllc.com http://www.moseslakesteel.
Premium Rock com/home/columbia-river-steel-
LANDSCAPING, Mike Beem Young Bucks Landscaping supply.html
MATERIALS & LAWN 4801 Contractors Drive Angel Avelar
CARE East Wenatchee, WA 98802 Wenatchee, WA 98807 MORTGAGE
(509) 884-2400 (509) 470-5684 COMPANIES
Anderson Landscaping Fax (509) 884-7099 [email protected]
Joe Anderson [email protected] www.youngbuckslandscapingllc.com Caliber Home Loans
Wenatchee, WA 98801 www.premiumrock.com Patrick Davidson
(509) 665-4916 MANAGEMENT 11 Spokane St, Suite 100
Fax (509) 663-0655 Riverview Landscaping Inc. CONSULTANTS Wenatchee, WA 98801
[email protected] Bonnie Jacobs (509) 860-4955
www.landscapebyanderson.com East Wenatchee, WA 98802 Alpha Sales Technologies, LLC Fax (844) 670-9091
(509) 884-1319 Ken Mattson patrick.davidson@
Chuck Strawn Landscape [email protected] Wenatchee, WA 98801 caliberhomeloans.com
Design See Us on Facebook (509) 679-9659 https://www.caliberhomeloans.
Chuck Strawn Fax (866) 206-9226 com/loan-consultant/washington/
Wenatchee, WA 98801 Standard Pallet Co. [email protected] ellensburg/pdavidson
(509) 630-7617 Jim Brock kennethmattson.
[email protected] 5604 Natures Shores Dr. wearelegalshield.com Cashmere Valley Mortgage
Rock Island, WA 98850 Shirley Reyes
Elysian Lawn & Landscape, LLC (509) 670-0632 MASONRY 127 Easy St., Mortgage Dept.
David Andrews Fax (509) 886-8844 Wenatchee, WA 98801
East Wenatchee, WA 98802 [email protected] Chad Shales Masonry, LLC (509) 662-7722
(509) 630-4330 Chad Shales Fax (509) 662-4184
[email protected] TC Slingers, LLC East Wenatchee, WA 98802 [email protected]
facebook.com/ Todd Carter (509) 393-1054 www.cashmerevallybank.com
ElysianLawnLandscape 1869 S. Wenatchee Ave. Fax (509) 884-5727
Wenatchee, WA 98801 [email protected] Cornerstone Home Lending, Inc.
(509) 393-1244 Davis Halle
[email protected] MEDIA - PRINT/ 1111 N. Mission St., Ste. C
RADIO Wenatchee, WA 98801
Lic #ELYSILL832KB (509) 293-4434
Alpha Media Wenatchee Fax (866) 400-8577
Maintenance • Renovation • Irrigation 1124 N. Miller [email protected]
Wenatchee, WA 98807 www.houseloan.com/
Water Features • Hardscapes (509) 663-5186 wenatcheeteam
Fax (509) 663-8779
[email protected] Eagle Home Mortgage
www.kkrv.com Angie Knutson
317 N. Mission Street, Ste. 300
METAL / STEEL Wenatchee, WA 98801
WORK (509) 888-4001
[email protected]
Cascade Welding Services, LLC www.wenatchee.eaglehm.com
Timothy Sparling
PROUD MEMBER East Wenatchee, WA 98802
(509) 701-5040
[email protected]

82

2018 BNCW Membership Directory

Guild Mortgage Company OFFICE EQUIPMENT, CW Painting LLC PETROLEUM /
Traci Dry SUPPLIES & SERVICES Cesar Nieto PROPANE
925 Fifth Street, Ste B 1511 N. Miller St.
Wenatchee, WA 98801 Kelley Imaging Systems Wenatchee, WA 98801 Ag Supply Company
(509) 293-9280 Greg Bruggman (509) 888-2439 Allen Sanow
[email protected] 12 N. Wenatchee Ave [email protected] 1101 N. Wenatchee Ave.
www.guildmortgage.com Wenatchee, WA 98801 http://cwpaintingllc.com/ Wenatchee, WA 98801
(509) 663-6311 (509) 888-3399
NEWSPAPERS & Fax (509) 662-3231 NC Painting Inc. Fax (509) 663-6614
MAGAZINES [email protected] Noe Cornelio [email protected]
www.kelleyimaging.com Wenatchee, WA 98807 www.ag-supply.net
NCW Media, Inc. (509) 860-2387
Bill Forhan PAINT & COATING [email protected] Okanogan County Energy, Inc.
215 14th Street SUPPLIES www.ncpaintinginc.com Lynn Northcott
Leavenworth, WA 98826 PO Box 69
(509) 548-5286 Standard Paint & Flooring, LLC Pesani Genuine Coatings LLC Winthrop, WA 98862
Fax (509) 548-4789 Randy Stuber Pete Sandoval (509) 996-2228
[email protected] 201 S. Mission St., Suite 1 Wenatchee, WA 98801 Fax (509) 996-2241
www.ncwbusiness.com Wenatchee, WA 98801 (509) 860-3426 [email protected]
(509) 662-3428 [email protected] www.okanoganelectriccoop.com
The Wenatchee World Fax (509) 663-5903
Sean Flaherty r.stuber@ Pinnacle Painting PHOTOGRAPHERS &
14 N. Mission St. standardpaintandflooring.com Ron Marotta PHOTOGRAPHY
Wenatchee, WA 98801 www.standardpaintandflooring.com East Wenatchee, WA 98802
(509) 663-5161 (509) 630-2929 Travis Knoop Photography
Fax (509) 663-9110 PAINTERS - [email protected] Travis Knoop
[email protected] COMMERCIAL & 4200 W. Eaglerock Dr.
www.wenatcheeworld.com RESIDENTIAL PARTY SUPPLIES Wenatchee, WA 98801
(509) 860-4321
NONPROFIT American Quality Coatings Trinity Inflatables [email protected]
Charlie Anderson Shane Rinker www.travisknoopphotography.com
Habitat for Humanity of the East Wenatchee, WA 98802 PO Box 3
Greater Wenatchee Area (509) 663-1300 Cashmere, WA 98815 PLASTERING /
Natalie Narby Fax (509) 423-7532 (509) 782-9973 STUCCO
Wenatchee, WA 98801 [email protected] [email protected]
(509) 663-1889 www.aqcpaint.com www.trinityinflatables.com Stucco by Alex, Inc.
Fax (509) 662-9879 Rhonda Reyes
[email protected] 15037 SR 97A
www.wenatcheehfh.org Entiat, WA 98822
(509) 888-3503
Fax (509) 888-3504
[email protected]

Serving Sales • Service • Repair
Wenatchee with
EmSeerrvgiecnecy
Integrity &
Professionalism

Since 1966

Reliable Guaranteed Performance and Follow Up! RESIDENTIAL
COMMERCIAL
Ron Marotta WA CONT. #PEETPP*832L2
662-8626
(509) 630-2929 • (509) 884-1128
1004 N.WESTERN AVE,WENATCHEE,WA
PROUD MEMBER [email protected]
Serving the entire Wenatchee Valley Visit us @ www.wenatcheeplumber.com

83

2018 BNCW Membership Directory

PLUMBING POLE BUILDINGS / Pool to Spa Services PUMPS
STEEL STRUCTURES Rick Specht
CONTRACTORS, 160 S. Worthen St. Irrigation Technology &
Steel Structures America, Inc. Wenatchee, WA 98801 Control, Inc.
FIXTURES & PARTS Shawn Sternberg (509) 662-1590 Julie Hamon
3635 E. Covington Ave. Fax (509) 665-0902 4956 Contractors Drive
Allied Plumbing & Pumps LLC Post Falls, ID 83854 [email protected] East Wenatchee, WA 98802
Jeramie Chisum (208) 777-7290 www.pooltospaservices.com (509) 886-4100
2131 N. Wenatchee Ave. Fax (208) 457-8470 Fax (509) 886-4141
Wenatchee, WA 98801 [email protected] Rookard Custom Pools, LLC [email protected]
(509) 662-6622 www.findssa.net Dan Rookard www.irrigationtech.net
[email protected] East Wenatchee, WA 98802
www.alliedplumbingandpumps.com (509) 679-3840 RADIO STATIONS
[email protected]
Apple Valley Plumbing Western Ranch Buildings LLC www.rookardcustompools.com Icicle Broadcasting, Inc.
Larry Pearson Tanya Davis Elliott Salmon
Rock Island, WA 98850 4968 Contractors Drive PORTABLE TOILETS 32 N. Mission
(509) 884-5102 East Wenatchee, WA 98802 Wenatchee, WA 98807
Fax (509) 884-5102 (509) 884-0555 Apple Valley Pumping Service (509) 667-2400
[email protected] Fax (509) 884-0563 Greg Howland Fax (509) 663-9497
[email protected] 4499 Grant Road [email protected]
Dave’s Plumbing Inc. www.westernbuildings.com East Wenatchee, WA 98802 www.KOHO101.com
David Stufflebeam (509) 884-7960
East Wenatchee, WA 98802 POOL & SPA / Fax (509) 886-0549 REAL ESTATE
(509) 884-5860 CUSTOM CONCRETE [email protected] SERVICES
Fax (509) 884-5037
[email protected] Prestigious Patios, LLC POWDER COATING Berkshire Hathaway Home
Jesus de La Cruz Services - Jessup Real Estate
Great Northern Plumbing East Wenatchee, WA 98802 Cascade Powder Coating NormaJean Jessup
Service (509) 679-0131 Josh Potter 503 Grant Road
Heidi Russ [email protected] 11 Bridge Street East Wenatchee, WA 98802
Leavenworth, WA 98826 www.prestigiouspatios.com Wenatchee, WA 98801 (509) 470-8244
(509) 548-7199 (509) 663-9080 [email protected]
[email protected] Boyer Mountain Pool Inc. Fax (509) 663-9130 www.normajessup.com
Dale McElroy [email protected]
Peet Plumbing Cashmere, WA 98815 www.cascadepowdercoating.com Carol Kavanaugh, Realtor -
Shawn Spencer (509) 670-3555 John L. Scott-Wenatchee Real
1004 N. Western Ave. Fax (509) 782-2013 PROMOTIONAL Estate
Wenatchee, WA 98801 [email protected] PRODUCTS & Carol Kavanaugh
(509) 662-8626 www.boyermountaindoorandpool.com SERVICES 1201 N. Wenatchee Ave
Fax (509) 662-1466 Wenatchee, WA 98801
[email protected] GO USA, Inc. (509) 670-6762
www.wenatcheeplumber.com Kevin Heermann Fax (509) 662-2700
521 S. Columbia [email protected]
Carol Kavanaugh Wenatchee, WA 98801 www.carolk.johnlscott.com
Managing Broker, GRI (509) 662-3387
2013 Realtor® of the Year - NCWAR Fax (509) 663-9513 Century 21 Exclusively
[email protected] Howard Syria
(509) 670-6762 www.gousaquality.com 135 N Mission St.
Wenatchee, WA 98801
[email protected] (509) 662-2100
Fax (509) 662-2112
2015 [email protected]
www.century21exclusively.com

84

2018 BNCW Membership Directory

Christine Douglas, Broker, Windermere Real Estate/NCW Story Construction, LLC Homesley Construction
Realtor @ Laura Mounter Real Adam Williams Jeffrey Story Reed Raymond
Estate & Co. 517 N. Wenatchee Ave. Wenatchee, WA 98801 46 Rock Island Road
Christine Douglas Wenatchee, WA 98801 (509) 782-1317 East Wenatchee, WA 98802
175 East Penny Rd. Suite B (509) 662-7184 [email protected] (509) 884-0224
Wenatchee, WA 98801 Fax (509) 662-2656 facebook.com/ [email protected]
(509) 264-7411 [email protected] storyconstructionllc www.homesley.com
[email protected] www.windermerewenatchee.com
wenatcheevalleyrealestate.com RENTALS - Turner Restoration, LLC
REMODELING / EQUIPMENT & PARTY Travis Turner
John L. Scott - Wenatchee ADDITIONS SUPPLIES 701 Poplar Ave. Unit B1
Real Estate Wenatchee, WA 98801
Karie Rolen A-Team Construction Rent Wenatchee (509) 881-0856
1201 N. Wenatchee Ave. Shane Harrington Darren and Laura Wurl Fax (509) 665-8004
Wenatchee, WA 98801 Wenatchee, WA 98801 630 Valley Mall Parkway #279 [email protected]
(509) 662-4772 (509) 470-0144 East Wenatchee, WA 98802 www.turnerrestoration.net
Fax (509) 662-2700 [email protected] (509) 293-4110
[email protected] [email protected] ROOFING
www.johnlscott.com Courtright Construction LLC www.rentwenatchee.com CONTRACTOR
Zack Courtright
Julz Fowler Realtor - Berkshire Malaga, WA 98828 RESTAURANTS Chavolla Roofing
Hathaway Home Services - (509) 699-0656 Pablo Chavolla
Jessup Real Estate [email protected] Wok About Grill 717 Schons Place
Julz Fowler Shon Smith Wenatchee, WA 98801
1633 Angela Street E.D.Y. Construction Corp. 110 N. Wenatchee Ave. (509) 264-3540
Wenatchee, WA 98801 Ed Gardner Wenatchee, WA 98801
(509) 264-5423 1250 N. Wenatchee Avenue, (509) 662-1154 Lyons Construction & Roofing
[email protected] Suite H-178 Fax (509) 665-7461 Patrick Lyons
www.realtorjulz.com Wenatchee, WA 98801 [email protected] Wenatchee, WA 98801
(509) 293-2921 www.wokaboutgrill.com (509) 387-3407
Laura Mounter Real Estate & Co. [email protected] [email protected]
Laura Mounter www.edyconstruction.com RESTORATION - FIRE
175 E. Penny Rd., Ste. B / FLOOD / WIND Summitt Construction
Wenatchee, WA 98801 Jerry’s Custom Homes, LLC DAMAGE Keith Bennett
(509) 665-9200 Jerry Martinez Leavenworth, WA 98826
Fax (509) 665-9100 Wenatchee, WA 98807 Anytime Restoration LLC (509) 548-7065
[email protected] (509) 393-4892 Ben Knierim Fax (509) 548-7506
www.lauramounter.com [email protected] East Wenatchee, WA 98802 [email protected]
(509) 881-8819
NCW Association of Realtors JLS Custom Woodcraft & Fax (509) 470-7443
610 N. Mission St., Suite 208 Construction, LLC [email protected]
Wenatchee, WA 98801 Jeff Stephens
(509) 663-1211 PO Box 2234 Lic#JLSCSCW840OH REMODELS
Fax (509) 662-0819 Wenatchee, WA 98807 specializing in advanced
[email protected] (509) 886-3020
www.ncwar.realtor [email protected] dust management
www.jlscustomconstruction.com
The John’s Real Estate Jeff Stephens
Corporation P & P Remodeling Services LLC
John J. Corning Rene Perez 509-886-3020
130 Riverview Drive 8591 N Dryden Rd
East Wenatchee, WA 98802 Dryden, WA 98821 jlscustomconstruction.com
(509) 421-4000 (509) 264-4976
Fax (509) 886-5400 [email protected] KITCHENS, BATHROOMS, CUSTOM DECKS & MORE!
[email protected]
www.johnsrealestate.com 85

2018 BNCW Membership Directory

SAND / GRAVEL STORAGE SYSTEMS TIRES UPHOLSTERY -
MARINE / AUTO /
Two Rivers Sand & Gravel, Inc. Cascade Woodcrafters, Inc. Les Schwab Tire Center HOME
Roy Dickinson Tim Ewing Kirk Moser
22750 Lake Wenatchee Hwy 1080 Washington St. 301 Grant Road Wenatchee Upholstery
Leavenworth, WA 98826 Manson, WA 98831 East Wenatchee, WA 98802 Joe Holmes
(509) 763-3280 (509) 881-4730 (509) 884-2414 353 Malaga/Alcoa Hwy
Fax (509) 763-3248 Fax (509) 687-3970 Fax (509) 884-4186 Wenatchee, WA 98807
[email protected] [email protected] [email protected] (425) 876-7303
www.tworiverssandandgravel.com www.chelanclosets.com www.lesschwab.com [email protected]

SECURITY SYSTEMS - SURVEYORS TITLE / ESCROW VACUUM SYSTEMS /
BURGLAR & FIRE COMPANIES CLEANERS
Erlandsen & Associates, Inc.
Keyhole Security Inc. Kris Erlandsen First American Title Ins. Co. Sew-Creative Sewing &
David Langlois PO Box 739 Kristi McPherson Vacuum
708 S. Wenatchee Ave. Brewster, WA 98812 16 South Mission Karen Weaver
Wenatchee, WA 98801 (509) 689-2529 Wenatchee, WA 98801 1139 Princeton Ave. N
(509) 663-5610 Fax (509) 689-2520 (509) 663-8555 Wenatchee, WA 98801
Fax (509) 662-8652 [email protected] Fax (866) 635-0231 (509) 663-5516
[email protected] www.erlandsen.com [email protected] Fax (509) 663-3692
www.keyholesecurity.com www.firstam.com [email protected]
Northwest Geodimensions, Inc. www.sewvacshop.com
SHOPPING - Norm Nelson North Meridian Title & Escrow
CLOTHING & SHOES 15 N Chelan Ave. Jim Blair WELL DRILLING
Wenatchee, WA 98801 701 N. Chelan
Collins Fashions (509) 663-8660 Wenatchee, WA 98807 Tumwater Drilling & Pump, Inc.
Marcy Collins Fax (509) 663-6278 (509) 662-4721 Lance Ballew
2 S. Wenatchee Ave. [email protected] Fax (509) 663-3758 PO Box 249
Wenatchee, WA 98801 www.nwgsurveys.com [email protected] Dryden, WA 98821
(509) 665-7600 www.northmeridiantitle.com (509) 548-5361
Fax (509) 665-0481 Fax (509) 548-1100
[email protected] TELECOMMUNICATIONS TRUSSES [email protected]
www.collinsfashions.com www.tumwaterdrilling.com
Elite Telecomm Louws Truss Inc.
STORAGE SHEDS / Mark Underwood Jeremiah Murphy WINDOW COVERINGS
BUILDINGS PO Box 2158 5485 Mill Road
Pasco, WA 99302 Cashmere, WA 98815 Budget Blinds of NCW, Inc.
Rent-Me Storage, LLC (509) 302-7240 (509) 300-1100 Greg Crisman
Julie Hamon mark.underwood@ Fax (360) 384.8800 PO Box 3062
4968 Contractors Drive elitetelecomm.com [email protected] Wenatchee, WA 98807
East Wenatchee, WA 98802 www.elitetelecomm.com www.louwstruss.com (509) 662-7444
(509) 884-0555 [email protected]
Fax (509) 884-0563 TINY HOUSE - Noble Truss & Lumber, Inc. www.budgetblinds.com
[email protected] CONSTRUCTION, Sarah Erickson
www.rentmestorage.com DESIGN, SALES 355 Malaga Alcoa Hwy Miniblinds & More
Wenatchee, WA 98801 Darin Bobysud
Rock Steel Structures, Inc. Tiny House Cribs, LLC (509) 662-1877 1114 N. Mission St.
Scott Rock Cosme Hernandez Fax (509) 662-5950 Wenatchee, WA 98801
1412 Fairway Drive NE Wenatchee, WA 98801 [email protected] (509) 664-2443
Moses Lake, WA 98837 (559) 551-9478 www.nobletruss.com Fax (509) 663-4408
(509) 764-9700 [email protected] [email protected]
Fax (509) 764-9500 http://tinyhousecribs.com/ www.miniblindsandmore.com
[email protected]
www.rocksteel.com

86

2018 BNCW Membership Directory

WINDOWS / GLASS / Wenatchee, WA 98801 Wenatchee Valley Glass, LLC WINDOWS TINT
MIRRORS - CLEANING (509) 662-8039 Robert Guerin / RESIDENTIAL /
Fax (509) 662-5719 5930 Sunburst Lane, Unit N COMMERCIAL / AUTO
Abarca’s Window & Gutter www.communityglass.com Cashmere, WA 98815
Cleaning (509) 293-0270 Shades Window Tinting
Jaime Abarca THE GLASS WORKS LLC Fax (888) 485-1182 Louie Romero
East Wenatchee, WA 98802 Bill Lane [email protected] 222 1/2 N. Wenatchee Ave.
(509) 630-6127 Wenatchee, WA 98801 www.wenatcheevalleyglass.com Wenatchee, WA 98801
[email protected] (509) 670-4186 (509) 630-5568
Fax (509) 662-7405 [email protected]
Community Glass Company, Inc. [email protected]
Travis Turner www.theglassworks.info
606 N. Wenatchee Ave.

Please visit www.BuildingNCW.org

for more information on current members, upcoming events, consumer resources and how to get involved in your community!

MARK YOUR CALENDARS FOR THE 2019 HOME SHOW

FEBRUARY 8TH, 9TH & 10TH

INTERESTED IN BECOMING A VENDOR? CALL THE BNCW OFFICE
TODAY...THIS SHOW ALWAYS SELLS OUT FAST! 509-293-5840

87

BNCW Health Choice
A Health Insurance Solution that just makes sense

Why settle for one
Health Insurance quote,
when you can choose
from them all?

Building North
Central Washington
offers its members
competitive health
insurance rates from
several insurance
carriers.

Call our office today to
receive your Free Health
Insurance quote!
509-293-5840

   PROPERTY ASSESSMENT CHECKLIST Source: Complete Design, Inc. 

When looking at new property to build on, take into account the following questions to help you  

       assess if the parcel will suit your needs and budget. 
          
  
  
Land characteristics 

 Define in terms of grading and excavation, foundation requirements. 
Earthquake faults: How close and how risky? 
Elevations: Is the property level? Hilly? Marked by canyons? Are there rock 

          formations that will hamper grading? 
Flood plain: Near enough to provide a hazard? 
Is a Geo‐Tech evaluation required? 
Is parcel large enough for your new structure? 
Riparian areas located on site? 
Soil type: Is it sandy, rocky, full of clay? 
Subdivision restrictions i.e. conveniences? 
Vegetation: Are there trees you can incorporate as a noise or sight buffer, or as an 

          open space corridor for common use? Or will you clear everything to provide landscaping? 
Water: Lakes, lagoons, rivers, streams or ponds? 
Water table, percolation rate: Will these affect foundations and drainage? 
Will Snow load affect design of future structure? 
Wind or Sun exposure? 
Zoning limitations? 

  Other ______________________   

 

Services 
       Check those already in place. If not, how much will it cost to provide them, if required? 
 

            Name of Provider  
Cable       _______________________________  
Electricity     _______________________________  
Fiber       _______________________________  
Gas        _______________________________  
Recycling Disposal   _______________________________  
Sewers, storm drains    _______________________________  
Telephone      _______________________________  
Trash disposal      _______________________________  
Water       _______________________________  
Other        _______________________________ 
 
Improvements 
 How much will it cost to install services and improvements? 
 What will I have to build? 
 What will I be assessed for? 
 Power lines or transmission towers: Where are they? Will they interfere with my plans? 
 Roads: Location? Are they adequate to handle increased traffic generated by my project? 
 Traffic loads on major streets and highways? 
 Existing buildings: Will I need to demolish them? 
 Transportation infrastructure: Proximity of railroad lines, ports, freeways? 
 Is a fire sprinkler system required? 
 Purchase price vs. requirements to prepare site for new structure? 
 Other _______________________ 

 

Amenities 

Which of the following are conveniently located or accessible? 
 Grade school 
 Middle school 
 High school 
 Fire protection 
 Law enforcement 

 Recreation 

BNCW and Sangster Motors Home Tour & Remodeling Expo 2018

ADVERTISER INDEX

24 Anderson Landscaping 5 Kelly Imaging Systems
14 Artisan Flooring, LLC 60 Lenssen Homes
12 Banner Bank 66 LocalTel Communications
27 Berkshire Hathaway Home Services – 21 Lopez Design, LLC
9 Marson & Marson Lumber, Inc.
Jessup Real Estate 25 Miniblinds & More
91 BOA Construction Co. 41 Mitchell, Reed & Schmitten Insurance, Inc.
17 Boyer Mountain Pool, Inc. 70 Moonlight Tile & Stone
26 Builders FirstSource 69 NCW Home Inspections, LLC
34 Caliber Home Loans 45 Northwest Geodimensions, Inc.
84 Carol Kavanaugh – John L. Scott Real Estate 30 Numerica Credit Union
23 Cascade Powder Coating 58 Olson’s Construction, Inc.
41 Cashmere Valley Mortgage 62 Patriot Plumbing, Heating & Cooling, Inc.
23 Central Washington Concrete 83 Peet Plumbing
2 Century 21 Exclusively – Betsy Loomis 83 Pinnacle Painting
59 Christine Douglas – Laura Mounter Real Estate 67 Ponderosa Contracting, LLC
36 Clean Air Connection 51 Pool to Spa Services
20 Collins Fashions 55 Rookard Custom Pools, LLC
61 Community Glass Co. 57 Sage Homes, LLC
11 Complete Design, Inc. 7 Sangster Motors, Inc.
62 CPW Insurance 53 Sav-Mart
20 Custom Construction & Cabinetry by Shane Covey 29 Sew-Creative Sewing & Vacuum
61 Deep Water Home & Electronics, LLC 79 Sligar Excavation, LLC
16 E.D.Y. Construction Corp. 15 Standard Pallet Co.
31 Eagle Fence Store 10 The Floor Factory, Inc.
82 Elysian Lawn & Landscape 37 The GLASS WORKS, LLC
91 Erlandsen & Associates 49 The Good Life
75 First Choice Collision Center, Inc. 81 Three Cedars Home Inspection
66 Forte Architects 70 Travis Knoop Photography
69 G.L. White Construction, Inc. 71 Trinity Inflatables
43 Gale Contactor Services 32 Village Life
18 Gold Construction, Inc. 92 Vita Green, LLC
28 Hanson Homes, LLC 33 Washington Federal
3 H & H Construction NW, LLC 26 Wenatchee Valley Glass
13 Icicle Broadcasting, Inc. 58 Western Materials, Inc.
19 Jake Davison Agency, American Family Insurance 35 Young Bucks Landscaping
85 JLS Custom Woodcraft & Construction
36 Julz Fowler – Berkshire Hathaway Home Services –

Jessup Real Estate

90

Builder

Building Dream Homes Since 1987

Proud Builder of Many
Multi-Award Winning

Tour Homes!

www.boaconstruction.net

(509) 886-7777

[email protected]