Vol. 10 No. 19 Visit TapIntoSomers.net for the latest news. Thursday, August 27, 2020
State investigates
storm response
Some residents without power for
more than a week
PHOTO: CAROL REIF BY CAROL REIF the department has “front-loaded” its
STAFF WRITER investigative process with such notices.
The Town Board held the hearing at Reis Park to adhere to social distancing guidelines. And it has “tightened” that process to
e sounds of frustration and an- six months, instead of the usual year to
Residents air sewer ger over the way utilities responded to two years.
district concerns Tropical Storm Isaias are still echo-
Proponents cite environmental bene ts ing up and down the Hudson Val- “ e response to Tropical Storm
ley—from such small communities as Isaias by the electric utilities was com-
BY CAROL REIF dents of these two communities,” Bar- Somers and North Salem to the county pletely unacceptable. Fifteen days later
STAFF WRITER bagallo said. seat in White Plains and all the way to and we are still hearing complaints
the state capital in Albany. from families and businesses,” Cuomo
ere may be some federal dollars in Westchester holds the keys to letting said. “With many weeks remaining in
the pipeline that could help fund the in- Somers send wastewater to its treatment Last week, Gov. Andrew Cuomo an- the hurricane season, we do not have
stallation of sewers in Lake Shenorock plant in Peekskill. nounced that the state Department of the luxury of time—utilities must act
and Lake Lincolndale, Somers o cials re- Public Service had completed the rst immediately to x their broken storm
vealed last week. Until the district is formed, Somers can’t phase of an investigation into the prep- response apparatus, and the Depart-
access the $10 million allocated as part of aration and restoration e orts related ment of Public Service must act more
e town also had other news for resi- the East of Hudson Water Quality Im- to Tropical Storm Isaias. Con Edison swiftly to hold utilities accountable.”
dents at a public hearing on the planned provement Program being funded by New was among four electric service provid-
$62 million project held at Reis Park on York City’s Department of Environmental ers that received letters from the state e governor added that he planned
Protection. notifying them of apparent violations. to propose legislation to speed up
ursday, Aug. 20. and “clarify” the process under which
Consulting engineer Joe Barbagallo of Nor can the town, which has been Also cited was telephone, cable and utilities could lose their franchises.
Woodard & Curran said the county has working on the project for two years, pur- internet provider Altice-Optimum.
agreed not to charge property owners in sue other outside funding. Among those “ ese utility companies predict
the proposed sewer district buy-in fees or sources are the state Water Quality Im- All the entities were told that they when we’re going to have storms and
operation and maintenance fees until con- provement Program and the state Water could face steep penalties and must when we’re going to have emergencies.
struction begins. take immediate corrective actions so
“ is was a substantial win for the resi- SEE SEWER PAGE 24 similar failures aren’t “repeated during at’s the art form of the business
the remainder of hurricane season,” the and what we pay them for. ey need
DPS said. to do better and we are holding them
Cuomo noted that it’s the rst time SEE STORM RESPONSE PAGE 8
SellYour Home forTOP DOLLAR BUSINESS & REAL ESTATE 31 HVUADLSLOEYN Spring GuideAMSpaetorcciaHhlaS2lsu8tpo,pn2leM0me1ed9niat
CLASSIFIEDS 30
with Somers’ Real Estate Specialist HEALTH & WELLNESS 18 SATURDAY, SEPT. 7
LEGAL NOTICES 30 10 A.M. TO 3 P.M.
FREE LEISURE 29
OPINION 10 SOMERS TOWN
Home Evaluation SPORTS 27 SHOPPING CENTER
Anytime — No Cost or Obligation North SalePmHOMTOid: TdAlBeI/THHAigPhEASRcShOoNoMl AgRaSrHdAeLnL
2
Call 914.243.3051 TRACKS
SomersHouseValues.com EVE NT SPONSORED
BY
SPECIAL SUPPLEMENT TO
Illustration by Simone Kurtz
NYPA AWARDS
Better Newspaper
Contest winners
pg 3
CLASSIC REALTY Michael Trinchitella
LicensedAssociate Real Estate Broker
Visit: SomersHouseValues.com
or Email: [email protected]
Page 2 – The Somers Record Thursday, August 27, 2020
and Deli
291 Route 100, Somers • 914.277.8539 • route100market.com
Let Route 100 Market
take the stress
out of your evening!
Route 100 Market
and Deli App!
and Deli
Available for IOS & Android.
Dinners to Go!
Made fresh route100market.com
everyday in
our kitchen! Food, Fuel, Fast, Friendly.
Thursday, August 27, 2020 The Somers Record – Page 3
NEW YORK PRESS ASSOCIATION SATURDAY, SEPT. 7
BETTER NEWSPAPER CONTEST 10 A.M. TO 3 P.M.
SHOSPOPMINEGRSCTEONWTENR
CONGRATS
TO OUR TEAM ON
THEIR AWARDS!
BY BRETT FREEMAN whose stories and photography were EV ENT SPONSORED
PUBLISHER submitted as entries in this category. BY
SPECIAL SUPPLEMENT TO
Results came in ve months late due Mahopac News also did well in Illustration by Simone Kurtz
to the pandemic, but I am extremely this category, winning third place for
pleased with the outcome of the 2019 Best Front Page. Congratulations to shot the photo for the beautifully Katonah-Lewisboro Times.
Better Newspaper Contest hosted by Mahopac News Editor Bob Dumas, designed front page of our Hudson Finally, Simone Kurtz received an
the New York Press Association. and again to Marshall and Rose. Dumas Valley Spring Guide, which won rst
also received an Honorable Mention place for Best Special Section Cover. Honorable Mention for her creative
Our Halston Media team did for Best Column. Each Halston Media newspaper has graphic illustration of the front page
exceptionally well in some impressive its own membership in the New York of our Celebrate Somers special
categories. Halston Media is the Halston Media sta nearly swept the Press Association, and we submitted supplement. Congrats to Kurtz. is
publisher of Mahopac News, e most competitive category in the entire our entry in this category through e also means that all ve Halston Media
Somers Record, Yorktown News, contest: Best Feature Story. Yorktown newspapers won awards this year.
North Salem News and e Katonah- News Editor Brian Marschhauser won
Lewisboro Times. Congratulations to the Halston
rst place for his investigative piece Media team!
North Salem News won First Place about a shoddy plumbing business
for Best Front Page. Congratulations fraudulently using the name in
to Editor Jodi Weinberger, Creative Google search results of another well-
Director Tabitha Pearson Marshall respected legitimate Yorktown business.
and Assistant Production Manager Meanwhile, Weinberger won second
Christina Rose for winning this place on her fun reporting of a TV show
impressive category.Also,a special thank investigating whether there were extra-
you and congratulations are in order terrestrial roots to the iconic Balanced
for our dedicated team of freelancers, Rock landmark in North Salem.
Sarah Gayden and Benjamin Allen,
On top of being our Creative
North Salem’s only weekly newspaper mailed to every home and business. Director, Tabitha Pearson Marshall also VOL. 10 NO. 12
Vol. 5 No. 11 Visit TapIntoNorthSalem.net for the latest news. serves as our sta photographer, so Perfection!Visit TapIntoMahopac.net for the latest news. THURSDAY, MAY 16, 2019
it was doubly pleasing that Marshall
Thursday, June 13, 2019
HVUADLSLOEYN Spring GuideAMSpaetocricHahlaSl2sut8po,pnl2eM0me1ed9niat
PHOTO: BEN ALLEN Shannon
North SalePmHOMTOid: TdAlBeI/THHAigPhEASRcShOoNoMl AgRaSrHdAeLnL batters
iBnepckeerrfefcatngsaamlle21
2 SBPYORGTSAEBDRITIOERLLE BILIK
TRACKS
“wpaeMsrnfe’atchhtoapppeaprcfyecvwtai.rt”shitjyusgt iprlesrfseocft.tbalel spoiptchhoemr oSrheahnunrolenr Becker Thursday, January 31, 2019
wanted
ptsoehfplcianorwssoIeolrSnptnt“uoevteulehuatIBiohdaersdhwtnottielbovsihcOicuafsfeoaeaphndahoCtai,ttolrsnncniii,edlllnndtaBrkudaslbudach2eehmogeMrrecehpfta1hemsaefekrcos,vopreohreboanukpCeiBeanirritmeynorepntelttthddiateeersefgrecgw8etraco,’afdsreNahhmtt,enkrnseendhlhsrtoactBteldeaeeoeuuioieettnrhnrnttwelcgmbrihgdpasgkcesotcbioeaoannhokrrrasYeenafufmeortmfpedsgeoortfostwtcssrtcuost.r.rebareeced”oekrsoststarertbutv.ioRhtenishlhdrmCoynerloaBeaeheeiirutmkntnrtpirNdauhoReteneigogytnenidtettadean,etrhhivmtdtwiromit,ombgeeheteniaawrnnruensgYaeo8gymaftghtctsBaeou-gbpahgtfcao0stesrancapreoastetukvuomcotdcabmvmteposfnlmekrSieaooreemeccvdeenrlpytnsmntrales,ra.olEos”p,gnnbatittaoetsrlRelgSaiywSnhiybtboatsmPshi—dhtehaioneprebsnoNleaitmnloorakgantspasnystremthltsedefnta.atsrhtrtrtnrscsan:hoeoriferltnbhticneeSwmasochfleuocia’rssahkasleitgittsosnctahydeleteotplemrclgood.,llerdaewsoy“wmaayoatlr—Ittle.rlffomhtnolTieueSe--’zsnaocnkcVah,erttfk.oie’.s-
Visit TapIntoYorktown.net for the latest news.
WainlldthHeeraetainlgYoprlekatoswe nstPalnudmubpin?gVol.7No.44
Stolen identity creates nightmare for local business
iSsuinsttahieniarbfiiblietyr SEE BECKER PAGE 16 Becker’s fastball is ePsHtOimTOa: TtAeBdITtHoAbPeEAaRbSoOuNtM6A0RSmHApLhL. BEpmttdPGDpochtYyiPsdolPhpIJaeslPoGoeiiaTpoSuuanlyeBnBodleelaOptuuielmousmv’oinoccUt.ivRiRssrmaweyaegpm,ntleboaeOkrebouutrIplepaioglegbuiuseeanmAbiuadrsridronynlgi.rllpespo’ieDeknoNsv.oblpnoogaywedtynhcegiuuaseoengs’a,anaAMtuasdasinsnnhbthulaissamrtwaahsatldudoepnsiesnAresitnnnnseaep.ehsnlrbalebsdbdRdiuidorayvhsnyaoerenedprotmiitHorSrsockoeecoenlcuycsHmueuCtafnnwh’sbhsuheoeorH.psbmoiogHniameuonngoedfriwYtomaeCaowbmoreiiguiH-b“toarlgvnfnfnisrJiiostYoieotnuemcuhnsago,AYseilrYnJotrogntunlltg..eb:oaimUteerolmtmndpgdusumitrkdheprnS.ogke”aYtanatkpiersteecEratotiHrooomhtaymoyysitewoRfdonu,aooeowateaow-nuearhylfndnnuslywaonxpldn-a-,d.ar--teabaJwatatvciacntesoaHhslunYechesomtalec“dwGswnCotheornr“oiamaeaWB,eodeeyuJneimSnidHtlnlrOooatanlasls.omkp“gcoh’eeheeottsolmswpNgYetnohlianr,dygiDenbhaaewnoroiwhneettmelestneegtohtweruysJifaiwheniardhd,kviac,utneodlt,n”estaap,chdonis”seethisYrogtdsyttuos.ohotteneme.hbesi.oChhswbdonoenttfuetrst1bttpoiieohnvonhlnookanhoisttan6yuwuanernyimeemltdbesaous,snrlgoirlJerhepoiasjfmyeeoiaohelocwYnPometoleoeuinmCrareun,sonebisbownlowwtutsstprutsgsrsoiepeniwe?.masnkliiammnndtsrsrontlePcioatoeeenghopoadbyogoebsrfrlllnaaboreeudsmawtivdietmnmtsedborornuismaihighttanwdcspuddpgnYiioeeitoetenbsas,ysthsitdeofr”ctnhioNtanhoigCNelenarneeinlatonasmyeakrkrrhleehogh.ntedtiessytiee-eswseolfeee.ewedpds-n-dns-rpeiwbsetntmfmnhewchihyHsbsorogJtdnwnWoopoeCaee“aaauseplArCeenmtilIneeipeyatmnkhrsSlondJofg,aUrletoneuhireoeaa”efwepfg,alntaeedydtmdnmgleonhlipChvtata”tseeale-nbineirdieua“eosnoesdtHvueevefomugryrdeisrnnoneyYstesepohatle.atnnoselronheteolosnsaeareaNshapdlst.fktierefwvtesDagewdw”thttiehikhaeventioillaeft.Yhienedaytiatoidi’ehrrtaeAmdtoehioasyosgnnhmledwwlawrscersot.aloieeceinhkiooceonwfunptasndsmgoaasrtemchwcg,sdolg.nooosmtwnacydoPeiihtsaerowrmpslslnormahClaoteplcklawdarreasd,eu,omsnaifeark.atefnoprtweomitcpttnl“ytfwalrytasihefohdPryhlysehhgbnseeenefciedoaibleseteiesaosydcroiumlnnouwiesehfnaesihrtmmnolgnbdgeonti,isgatentew-htataaesptubhahenhiiaapsvhiarcnevnnad-taenehk-neteyeaeaentsgd-irsetiedronrytto.,
Little CrfeaerkmFmaramnaingeNmoerntht. SSaeleemthelefaudllsstthoerywoany in environmentally Now S ERVin Putna Count
pages 14 and 15.
sound Restoration: UsFREEAsk
Our About
BALANCED ROCK 4 Is is the Right Time to Sell?lgchoAooowriremnrmegyecoootvulrnaytw,gltuyhaoeoegnsuedmhmeraaaravirtnekyegsehr.teia.fVbAvitsoheniuidtsmn,midiusfyeltyadiwopgualeeon’brodbesduialtoyterieoemtrkoseiontsfetgefoaeetdrsoscielyuulclpr?ocrgmleIinrmnaintodbgtueirnre,tghinat.r’drsoIesfuamyfgoowohrureewym’oraietuafhfrrsiokneareerddteianaaabyg.nlsedaotpmhfrayiacnoreukeertvhtpeewrrohwhpoeeimtrrhetey BOX CAR DERBY••••••••CDEMCMWFlooeiaoronccatevutlatted,eremsonSrtMOnretmsoRincuipeCottsitmhsgLkDla&ieao&criiytmvk&iESioaCnqtenloISgoun&roni&vmpoteieDmttnRnReteeteohsmnnsrutpRyemeeodSsinivdetasorieetfirvioacircnatSieSOoOtMiLPLCeGnoPCBEBOEHnAIOLIIvUNGRSTOAHVSATUeIUOSOOESILAR•N•nS•RLN•P•CERNSINAEDCFClBAISeOCIEM&ehieaEioaSSToriDrMlEhaCnIdpiD&CnSaNAioeUpnugEztrTMRcSSgsia&pzt,EAI:srPNaAdWTeUSt,GiLopWanCSEnhllrSOeosimTlR&sdAteKeTH.rSCEE®yacOMrePdMnRREeFEMORlo&AFGEoDIVErLRsaYNECn!CIdAYaLl22i11s93530m18343568879Dwi7rwseLbcwOewti.olslsSlwdroeafwortMaRv8f.etspACttear4opoeron@hmvho5opn6sfmanrpep-,goe2wrgna&rpOveCscc2pui2wteieaart0CdnrSn8olruea-an&Bumrtcc-2mwsc1bRyo1ehsce.eee0oltSlssdluitcNod9suneocttfYnc0Soyua.htuctimeant1soslttm0ysAi.o.tcc5ccoho1ommu2nts James D’Alessio, the owPnHeOrTOo:fFYAoCErkBtOoOwKn/YPORluKmTObWinNgPLaUnMdBHINeGaAtNinDgHEATING
CLASSIFIEDS
LEGAL NOTICES 26 gBpsaoruiivdsveianrtnesemhsseeiBnnwtvueaarsesgtaeiugnr,aectpiaoeetsrtas,ot.terhndeeClyyBoseltlatoetneleddnr, wegrrayonbutontddoystkafkeoeerplisetg,s”aaylCianocgltlieowenen, hasnaavdidee.nv“o-I
LEISURE ere’s nothing we can do.” SEE PLUMBING/HEAPTAIGNEG5
25 “ “You don’t know how bad we
OPINION
24
SCHOOLS & CAMPS 8 SPRING HORSE
SPORTS 20 SHOWS
23 Old Salem hosts Grand Prix.
HOULIHAN LAWRENCE
pg 16-17
Is 2019 Your Year?
MARCIE NOLLETTI Call or text John for a free and confidential real estate consultation. JOHN KINCART
Associate Real Estate Broker
MCSCoeVOlmNlL: oeD(9rllWs1e4t|Et)[email protected]•mmOR|f•RfPimcuEetaSn:rIac(D9mie1EOn4NRpo)eTe2lrlagIe7tAeit7otdL-in.5bcBay0bla0RiO0nsOutfbofKiscuiEdeciRahrAy.coGof EmNRT LLC REAL ESTATE, REAL LOCAL™ Yorktown Brokerage
M 914.384.3385
SaLliecsepnesresdoRneinalNEYst&atCeT Yorktown’s #1 Selling Agent – Consistently [email protected]
2013, 2014, 2015, 2016, 2017 and 2018
MrYorktown.com
AIN STREET ROUTE N , JE FFERSON VA L L E Y
EAST M 2013, 2014, 2015, 2016, 2017 & 2018, total units, Single Family homes sold by
Source: HGMLS, & Yorktown School District.
Agent, Yorktown
BUSINESS & REAL ESTATE 21
CLASSIFIEDS
LEGAL NOTICES 22
LEISURE 23
OPINION
SCHOOLS & CAMPS 20
SPORTS 8 SCHOOLS & CAMPS
TOWN GREEN 6
Gold sh Swim
16 School opens.
2 pg 7
Gary Forbes Chris Radding HOME, AUTO, BUSINESS, LIFE & HEALTH Lions Club Car Raffle
914-232-7750 • www.forbesinsurance.com Labor Day
The Forbes Insurance Team Drawing
Support an
Organization
That Supports Our
Community
https://somerslionsclub.org/2020/06/27/somers-lions-charity-raffle/
Page 4 – The Somers Record Thursday, August 27, 2020
The Staff Businesses should check Color me
for missing copper wire happy
EDITORIAL TEAM
JODI WEINBERGER BY CAROL REIF While the wire appears to have PHOTO COURTESY OF JANET MACDONALD
STAFF WRITER been stolen, “normal owners such
EDITOR: 914-302-5830 are electric and utility shops said Phoebe Carr, 7, from Brooklyn, filled in the coloring book
[email protected] Anyone missing some copper they are not missing any,” he page in a recent paper. She has been staying with the
wire? added. MacDonald family in Somers during the pandemic.
BRIAN MARSCHHAUSER
SPORTS EDITOR: 914-302-5628 State police in Somers are ask- Authorities are also asking Family-Run Since 1975
[email protected] ing local businesses to check their members of the public to call
storage containers or sheds for them if they have video surveil- Your Labor Day BBQ Headquarters
ADVERTISING TEAM broken locks or other “evidence lance are have seen someone cart-
of a crime.” If they nd some- ing copper wire around. For The BEST QUALITY Food...
ADVERTISING TEAM thing suspicious, they should not
PAUL FORHAN touch the lock or damaged area Stolen copper is a hot com- Anywhere!
914-202-2392 until state police can investigate modity as scrap metal because
the scene. it can be used for such things as Prime Meats • Fresh Local Produce
[email protected] plumbing, electrical systems and Fresh Fish Delivered Daily • Prepared Foods
BRUCE HELLER According to press information
914-202-2941 o cer A.J. Hicks, a local state ber optics. Fresh Baked Cakes, Pies, Cookies
trooper recently noticed someone It also is hard to trace and re-
[email protected] riding an ATV on the old IBM selling it brings in big bucks, ex- We Are Now Open To The Public!
LISA KAIN campus, which is closed. perts say. We Welcome You Back!
914-351-2424 When the trooper arrived ose who suspect their cop- We Will Continue To Offer
[email protected] at the Route 100 site, the ATV per wire was stolen are asked to Curbside Delivery
operator took o . at’s when a contact NYSP Somers at 914-
CORINNE STANTON bunch of copper wire was found, 769-2600. ey should be pre- PH: 914-232-9444 • FX: 914-301-5474
845-621-4049 Hicks said ursday, Aug. 20. pared to provide a full description Mon. - Sat. - 9am-5pm • Sun. - 9am-3pm
of the missing wire. 127 Katonah Avenue, Katonah, NY 10536
[email protected]
SHELLEY KILCOYNE Remember last year?
CO-FOUNDER
914-924-9122 Stay warm this winter!
[email protected] Visit today to take advantage of our
JENNIFER CONNELLY
917-446-7757 ANNUAL PRE-SEASON SALE
[email protected] August 22nd – 29th
GABRIELLE BILIK
10%SAVE
ACCOUNT EXECUTIVE/DESIGNER
[email protected] on Quadra-Fire
PRODUCTION TEAM Fireplaces
TABITHA PEARSON MARSHALL Stoves
Chimneys
CREATIVE DIRECTOR Hearth Accessories
PHOTOGRAPHER
914.248.7775
[email protected]
CHRISTINA ROSE www.fire-glow.com
fireglow@fire-glow.com
ASST PRODUCTION MANAGER 2989 Navajo St., Yorktown Heights, NY 10598
DESIGNER Store Hours: Tues.-Sat. 9am-5pm
[email protected]
EXECUTIVE TEAM
BRETT FREEMAN
CEO & PUBLISHER
845-208-8151
[email protected]
Deadlines
THE SOMERS RECORD DEADLINE
THE DEADLINE FOR ADVERTISEMENTS
AND EDITORIAL SUBMISSIONS FOR
SOMERS RECORD IS THE THURSDAY
BEFORE THE NEXT PUBLICATION DATE.
FOR MORE INFORMATION,
CALL JODI WEINBERGER AT
914-302-5830 OR EMAIL
[email protected].
Subscribe
TO REQUEST THE SOMERS RECORD
WEEKLY DELIVERY, CALL 845-208-8503
OR EMAIL [email protected].
SUBSCRIPTIONS ARE COMPLIMENTARY FOR
RESIDENTS AND BUSINESSES IN THE TOWN.
OUT OF TOWN MAIL SUBSCRIPTIONS ARE
$150 PER YEAR FOR FIRST CLASS MAIL.
PERIODICALS POSTAGE PAID AT
SOMERS, NY AND AT
ADDITIONAL MAILING OFFICES.
POSTMASTER:
SEND ADDRESS CHANGES TO
THE SOMERS RECORD AT
BAILEY COURT
334 ROUTE 202, UNIT C1S
SOMERS, NY 10589
(ISSN 2330-1597)
PUBLISHED WEEKLY BY
HALSTON MEDIA, LLC AT
BAILEY COURT
334 ROUTE 202, UNIT C1S
SOMERS, NY 10589
©2020 HALSTON MEDIA, LLC
Thursday, August 27, 2020 The Somers Record – Page 5
JOBOcean State We’re open &
here to serve you!
LOT Mahopac® 1001 US Rt. 6 (former Kmart in Lake Plaza)
Come visit us for your hand sanitizers, masks, wipes, cleaning items,
disinfectants, thermometers, face shields, disposable gloves and all your
personal protective items.
9959
Sale Dates: Thurs. Aug. 2Fr7ee- !SeFrpete. !2F,r2e0e2! 0 Ocean State 12 2442 Ct.
SHWaaitnnhidAtilzWoieni2pg0esct. FOMoixnexygaigmseeurnreePtsseauprtlusurelasetion
99Serve
New
29Brew Price!
*
1CIInnlSisfnertiaacconraentl-ddGReTrhaaeddremometer
Madison Hexagonal 13’x11.5’ Gazebo
99999 JOBSale! 99 Choice DBreaiatgtdeoriytuati,nlmclTuedmheoedr,ry6mr0ecosaemlcl.onedter
Your Fashion
3Pistachios 16 ozSingle GAWFrneeestrhtimbsWcaoeciunptttee4r0siactl.
Coffee OPCrRleoaAfenssienspigosnoWailpes 32 ct. WashaMblea&skRseusable
Cups
99
5 499Sale!
4NCaasthuerewtoHaGloves
99 ®16 oz
99 49 LOTWalnuts 16oz
Your Choice
California Grown Insider Exclusive Swhiitphsinto10s-t1o4re LAWifneettbibWuaociypteersia4l8 ct.
Chopped Walnuts days!
Buy for $499 $499 99
GCerat zay$D4e9a9l Gift Card Free!
EAWvneitpribegsarecLeetemnroian l- 100 ct.
9M’aArlkuemt iUnummbrTeilllta 99 New
4 COMMERCIAL GRADE 19Sale! Price !
SFaucrgeiMcaal sSktys le
$ WINTER POOL COVERS!1st Quality
19Dept. Store Label
Closeout Box of 50 Our company started
Polos & Shorts 43 years ago. We know
99 New that you work hard for
Price ! your money & we want
to help stretch your
234WFMSS&CatrhoteowammtoMcWBiFDPmClkhlpMPkrCle,ooaLoeo.aneotdomet161ciaus2$13emetntr55nrn40mMkH8pQ72nne964stQesmpnGQ.tQiGt’nLtcQmtyr0ee.’.s.t,Cs$etatahB.S’lsS..tee$lVnl.3SlhFLas.ha.wnHsSlaFw&1S0c-liTooT’pntknnvouf5’ceos&eeooaoaFheTts-alloyepprBoica$slTpptp.oko-.LwLeeY4d.wtZTW.ipixTor.dsd0&o.ooSe.pi.fTB.h.Ttum.pTo.r.eTetd.oo.coo.rotoi...ot.3ee.Sl.xrtt.e..ai.eC.e..mn.m....t.gr..t......s....h...5..Pa4as787285ohi9oe49ca992x99gi999999cv99tfnceeoeCkS1r61’r35120734rBs600m7wP0D1QGaQ6GkGoeGQt5at.Ta.acu.n6UaeltxlLClN...kenl.QaHro.LS&dSareWattetaleenec.pretairhcaSshobtnvcfhtshwepenTyslikodeToggo&aLDolepwiebpdun/BmdoTtFwTToyosxTToohxiotTe.!teteor.o.etee...e.tl..e..s..e...t..........1..1..1e...9112.94L1212s319119199o19292939299996966D819990g1510’’’’’x’’x’’xe’’xxxxxxxx223l33444u58E4154626676SR0C5L’40’lx’0’06’0’i’t’aoh”’”(’”(tSa”(D’(ei(1(2(we2auS(2MSn(2M2icX373D1o1nm1ni35k0LAWc5’dn’ds’tSx’u’ogx’.’dx’lxx.ex.xYx2a2PuC3Pe4b45ulM4Pb5PPao9r9er75Fhd10rLe1r5rlebun’e’e’i’et.’mo’o’am’ooierr.mccmeclcce.cc.ceouoewid.oioiCs.oouoi.ouirr.vovvsuv.vupvn.v.hmv.meve.e.meeewma.eCe..oreiTg.rrer..rClrt.rr.L.ir$2oLF2.Wu3c.1e.L1Liir1io1C0ig1i5egn3iC0Cv2r65g6bg6’6doh’8GeohC’xa’xohce’xh’xt’4o4x’teso4x992w5xotvFwtxhrv2wtt2w039d539093as.reeeviYe4R9e’4.e’2ve’6.r6iraio.&p’roegpi’dgip.r’t’g’u.”eg.opeoho.e.pno.hrp.rp.h.phoW.o.ot.ruo.ot.o..Fot.dCl.to..lI.P)olr.PDPu.)Po4.C)o.4..Poh..P.ooa..co...ln.o..l..l.hs)oo.’.lo.).l.’)ci.oo..l)..e.nle)..x..b.i.y..l..ay.txl.....c...ya..lyd.......e....ee8......or.e..e..re..2.d..s.5....sb.c..’...Es....s1.t.i&..4t.A..oO.e.p.tP.le.tA.cB.’H1l.e.We..qr..ar.eC..u.r..r.n..P.o.S.e...RtlG..nr...).u.....M..s.G..b.O..at..i..i.io.t....t..2n.o.i9n.2l2a.9.2a9.v.pR.9i.9f9.x.l9.9a.l.g.9fa..9r4.yr9o.te.9.l494P.9T4.oE.l9$9.r..s.e.iell&.4a...rx.t$r.9$ee$wz.De$99o95n3rcU5eL95ic69R96.9phekueinti.tPwgiSz.aiaszo1t2l9.2kVrzh2/iey.nnnpet18oe.1111t.y1421128988ee.2gA.2(eARw-.’0Ea2.’52018’18i’29r15.’5e3ru46.10x58xs8..ne’2R’s0’’s’R’’0.R1cx’’sR.x’xat.12’l..h..-’.’xcoºt2x..R1o6pxRv1o3l0xR2R4oa29R.F4Rx2er.l2u6onu’oo1u079o9uu9o89o19P9g’f99o’n1i90nu9o’’nuun’2eRufd9uUp6r9d’dn9gdnuu’dnnnV’aersdtdo3d(hdd3t1(d11(2r-21(6tsm1122WS21ard23p21206302(e102(64(mpe87n13(1r5112(’2320a’’w1’’2otd’4’’x3x’’e0.’’xst8..0x104c.oixe0toco7x6ct.21sx.s7c24xo3na6.od’f.it’o6’,9o,re’5,29’02n6vn,200pv9e02v9p9csv03vcct9’e0cdet’n9c5e9eo0’oee0c9o09oe0r0orr0ega’or’lra’pyvy’hvv’1tr0v20v2rrh02-1e3dee18ec812.er42i-e82r3rT12rae4a’02rEg54G3’rz02)G1’36G)5)’100s)r0a.)p.ra.5fp005irp’.Pb0n.F’p1.1tW1.aisw.9’’Hs9x.a’7o.x.a.o.’a.xt.o’yono’.da.Pi.09x.r9i.odh9x.4r.o.4ix..o.d.r.nlox5.o.lTtxntel19.iol..99log.l9h.l0le,l)la0te..pl9.)3t.y0.o)4..oe..)4oat0..5a.199..9L’c6.tpc...oa’9pg.P90.Y9’.e.99.0....5.wnlfr0.n..n0..raesr0.P.iKoi’099.o’ra.’rpagora’a.qp’.e.%G!bu0y.sir.npyy.gn.iot!..wl!r.u.1mtelh.lmi.aennaeiBss.eCasnS.esmi9al9d9s)9neh!T9d9Pl9bdtv99e9t9rt9loo9iU9lte9Ra9uteeu9o9st.isrp.a9c9rirAsr&t9poenppptr999rlrpaosleigsasreelKKHDV34181NN31i6.2i6.sa4no9922399-4op1yz85.59n9So6oz8oOo6.loF...MzMz9.dso.pGz”a..zBvT...a5.1oR.z5..P..a5Bac..4..M..lS.’.eez....bo.0.e.oSo..5is..esc...Pr.c..c.tN....Pr..c..klN3k”rvci..t.t.aic.untSareeio..ctxceist1..s2ew3cM1hk.eetr.ncw-F7e4..W9n!199s9..k5lRri0i!la1”.d9.’”9e0el9.s.i7999/Psiue1n9scsl2Pi”1kt0idhrhrktn.e”.tim20.is..aze.iirc..C9C”goc9nt.C9.kme.t..o9oi.i.n.o.919S..c..mmnrA..9./m.satV....722.a.2..Spp32.l.g.p.”t.’.’r.t.’n..’$$i$a2$’9.o23&d$xee4$21M43i4”$””n”9p517a1xcx94xwaaxB0e”..&rh.999dr’s7,9dr140.9e’9oi.’fs1a9.6z0’aR7.q...1’oi...Bn.e”0d.”.n...21....1u....esdsmR..”R..”piT...2.uu.!e....s.u.nrneo.n...g......e”n..nrt..i....e..ee...nks.f.d....r$r.s..i...r.eJ..tr.....s..s......$y$u.t.o..$$$$e$am354mnrtKAbs$oOCiDS1dW3dBSD3Co22aTTFidFQQPusue8li40winwsu2MuonS2epogis9Suruaun11l.c027r9oloila7i4afehB.etinltilet7.9fe.ic0azSp4rln.n.”.5ai.ns5..eelca.efT.1n.o”oz...2e”c30x.h..m.e”W/.Den.rcp.o.hn8x.n..nt.ieenx...nx%GtX.c.eonr.20rSa.s..rSdSar..e2oy.tta..24..3a.ek4ge...9ucfaL.1...uSnru4....astt.4e..SS.9i5”.Ca.t....69nl.e.b...b”t.Mb.PskK.b..”.r.l”...e.to.dSNP....dt1....o.jd.u.ej...i6ja..C..e.05t.4n.tee...z1ePw..20$.tosC$.$rd00..0cgad.tcoo.1c11.0a./.co.st..cc.etPct..2.ll4n0.t.sRdtt.0$tute1$y$..1.n2k2e22e0nn5%t0Cs0.55t00dbpCYP0aFoicacCrloaolcutataerr.to.b.otsvnCnCoCt,hCorondtrekoomm.ioSmi.eaccp.prste.np..r..ru..$.$.$.3Bd57..99o.e999999..on9.....9......tk....$$$ hard earned dollars!
15 In Ground Pool Co3v569e44rs AbPoovoel CGorvoeurns35d99 94 11 23Your Choice
$12 116972599999 681234999797 22357 314CAoSmm7eA5prOi.c%Va$u’E4s+r#01-B$De6es0sigtnSerep8lSlue0sAc-89tmVi0ooE%rne FaEmvSoeeuSpsrwaL!riamabteelss NEW Job Lot
$25 $10 $5 59 12 1279 3Compare Location!
$100-$200
Compare
$50-$100
$10 $7 SPLASH $75137 PSOHOO11849CLK 13333155050Men’s
99Bully Stick HQSPgeohrlffoo, rbrmetalstnedce
solid twill,
19ripstop,
or plaid
$5 $10 $6 399 299 $ 99 99 1299MLoenng’sSleeve
Grill & 2 3 5Knit
FuCronvieturrse Choose from over 300 School Supplies!TPoirogwmpaefnsfltedkyneidt
Comp. $20
PVleansttiilcated
Shelving
3999 $2Heavy Duty
5 Tier
72”H x 36”W x18”D
1999 7999 18 99$4 Tier
179 $48”Hx24”W
$ 3BToawthel x12”D
$5 6 3HToawndel 6’ Bath
$2 $7 799Wash Sheet
1 Cloth
you’ll find... •clothing & accessories •gourmet food Become a Job Lot Insider!
•kayaks •patio furniture
•household chemicals •health & beauty care •garden supplies Smart shoppers join the Job Lot Insider® Club. It’s quick and easy
•kitchen pantry staples •cosmetics •outdoor planters to sign up at the store. Then, simply show your Insider card every
•solar lighting •bedding & bath items •watering items time you shop, and unlock exclusive benefits
•gazebos •indoor & outdoor rugs •wild bird seed including Insider Exclusive Deals, Insider Sneak Peeks,
•hardware & batteries •pool supplies •pet supplies Paperless coupons & Receiptless returns.
•housewares •fans & air conditioners •grills & firepits Ocean State Job Lot currently operates
•seasonal merchandise 142 stores in the Northeast.
•heaters & dehumidifiers
Page 6 – The Somers Record Thursday, August 27, 2020
Astorino announces new ballot line
BY ABBY LUBY ate District that spans Dutchess, PHOTO: ABBY LUBY
CONTRIBUTING WRITER Putnam and Westchester coun-
ties. Volunteers sought signa- Rob Astorino announcing his new ballot line in Somers Commons Shopping Center on Thursday, August
New York State Senate candi- tures at various shopping cen- 20. From left to right, Assemblyman Kevin Byrne (R94 AD), Rob Astorino, center, and Somers Town
date Rob Astorino, a Republican, ters; some went door to door, Supervisor Rick Morrissey.
last week announced the creation others encouraged voters to sign
of a new ballot line, Rebuild Our the petition at Astorino’s cam- said Astorino’s Rebuild Our rino’s scal polices as Westchester no’s strong support of President
State, that will appear on the No- paign headquarters in Mount State ballot line provides no clear County executive. Trump. Astorino is a CNN con-
vember ballot. Pleasant, Yorktown, Brewster and path for any action that could be tributor and commentator who
Somers. Astorino said the new taken in Albany. “He left Westchester with oper- usually supports the president;
Astorino made his public an- ballot line appeals to those in all ating de cits totaling $81 million he currently serves on President
nouncement about the new bal- political parties because it pro- “People can vote on it, but it’s the last ve years he was county Trump’s 2020 campaign advisory
lot line on ursday, August 20, vides an approach to restructuring not a structural change, it’s not a executive, and the county’s debt board.
outside the Penny Lane Dance the state budget, taxes, spending political movement. e line will had grown to $1.6 billion under
Academy at the Somers Com- and borrowing. be at the very bottom of the bal- his watch,” Harckham said. Byrne faces a challenge in the
mons Shopping Center in Bald- lot and hard to nd. People won’t upcoming election from Demo-
win Place. Joining him were “It’s a true collation of people know what it is.” Harckham said the real pur- crat Stephanie Keegan for the
some 30 residents and local of- who are fed up and really con- pose of the new ballot line was 94th District seat.
cerned about what is happening Harckham criticized Asto- to distract voters from Astori-
cials, including Assemblyman right now in Albany,” he said.
Kevin Byrne and Somers Town “We’re looking at how we treat
Supervisor Rick Morrissey. As- businesses, big and small, local
torino said the impetus of the municipalities and taxpayers. It’s
move was “the state’s grim eco- time for legislators to adopt a new
nomic outlook.” mindset.”
“Our businesses have been Astorino, 53, served as West-
battered. We have 750,000 regu- chester County executive from
lations on the books that batter 2010-2017. He was unseated by
our businesses day in and day George Latimer in 2017.Astorino
out. So many people are leaving formally announced his intention
this state—a million people in to unseat incumbent Sen. Pete
the last 10 years alone.” Harckham in June. Harckham
was elected in 2018 in a defeat of
e petition to place the new incumbent Terrence Murphy.
ballot line garnered over 5,000
signatures, an e ort achieved by In an interview after the for-
some 100 volunteers who can- mal announcement, Harckham
vassed 15 towns in the 40th Sen-
ExOeAucsurktNiavebewoMuJetumniboerrship MODERN
MASTERPIECE
JOIN FOR 2021 AND ENJOY
THE REST OF 2020 FOR FREE!
GOLF DIGEST’S 16TH BEST IN NY (1999) 914-245-5588
MGA’S MODERN DREAM 18 (2017) www.anglebrookgc.com
Complimentary green fees at over 250 clubs with Anglebrook Signature Gold Unlimited* Robert Trent Jones Sr’s
Final Design
Cost-e ective Weekday-plus Annual Membership • Non-Equity—No Assessments
Six Membership Categories—Corporate, Individuals, Couples & Families
Outings, Banquets, Receptions • Liberal Guest Policy
*Restrictions apply
Thursday, August 27, 2020 The Somers Record – Page 7
Open,
Monday, Labor Day!
0% Financing Options Available!
*See store for details.
Exclusive Rebate Opportunities!
Labor Day Savings WAS $899 4.5 Cu. Ft. Smart
Start Now! Front Load Washer
$629 ea.
Save On Major SAVE $270 WM3500CW
Appliances, Grills
7.4 Cu. Ft. Smart
and More! Electric Dryer
DLE3500W
Optional Pedestals
Available
SPIRIT® II E-210 $ Save On $1049 WAS $749 30” Electric
Weber Range with
379Gas Grill Grills! GENESIS® II $675 Steam Clean
Many S-335™ Gas Grill
Models SAVE $74 WFE505W0JS
In Stock! • 669 sq. in. total cooking area
61006001 - 30” Gas Range
Stainless Steel LP with Sealed
Burners
WFG320M0BS
• 26,500 BTU-per- WAS $699
hour input main burners $469
• 360 sq. in. total cooking area SAVE $230
44010001 - Black - LP
www.appliancesalesplus.com We Make Your Next Purchase... Instantly Affordable!™
Sears Customers: You Are Welcome 3 Lovell Street
At Appliances Sales Plus Somers, N.Y. 10589
(914) 248-5800
(845) 628-5241
Mon.-Fri. 9AM-6PM, Thurs. 9AM-8PM
Sat.9AM-5PM, CLOSED SUNDAYS
Page 8 – The Somers Record Thursday, August 27, 2020
STORM RESPONSE After making landfall as a Cat- Harckham also met with elected Harckham added that “whole- power or phone, cable, and inter-
egory 1 hurricane in North Car- o cials and utility representa- sale reformation of the business net service.
FROM PAGE 1
olina, taking the lives of at least tives, and heard from residents. model and real systemic changes “Cellphone calls were all but
accountable,” Cuomo said. nine people as it traveled up the “Power and communications in the way that the utilities plan impossible to make throughout
More than 2 million homes East Coast. outages from down wires lasted for storms, their incident com- the county,” Latimer said.
and businesses were left with- Meanwhile, state Sen. Pete in some part of the 40th Senate mand structure (and) their com- He called the situation “outra-
out power after Isaias slammed Harckham reported that he had District for more than a week, munication” are needed to restore geous” at any time, “but today, in
the mid-Atlantic and Northeast spoken at a public hearing held and a number of residents are credibility. an age of working from home,
on Tuesday, Aug. 4. Most of the by the state Legislature on the still without electricity and com- Con Ed’s storm response was distance learning, and ever-in-
outages were concentrated in the emergency storm response. munication services,” Harckham “dreadful,” the senator testi ed. creasing reliance on having ad-
tristate area; some 634,000 of A member of Senate com- said on Friday, Aug. 21. “You may have met 90 or 95 equate power—not to mention
them in New York. e damage mittees on energy and telecom- He also entered into the record percent of your (outage response) the scorching temperatures—
from wind gusts of 75 mph and munications, environmental con- a letter signed by 22 town and benchmarks when you wanted to, thousands of Westchester resi-
higher was severe in some places. servation, and local government, village leaders castigating Altice but in my district, that was thou- dents were left, and still are left,
USA, Inc., corporate parent of sands of families and thousands in the dark or without telecom-
BEDFORD GRAVEL Optimum, “for its poor response of customers without service and munications for over a week at
& LANDSCAPE SUPPLY to storm outages and poor com- adequate communication,” he the hands of Con Edison, NY-
munications with customers told a Con Ed executive. SEG, Altice and Verizon.”
• Gravel • Topsoil • Mulches whose service was a ected by the
• Sweet Peet • Unilock Pavers storm.” He was less harsh about NY- Latimer called for a new ne
SEG’s response, thanking its structure aimed at putting a “true
• Sand • Stonedust e numerous storm-related president, Carl Taylor, for moni-
nancial pain that would not be
problems has hurt the credibility toring power restoration “on the shifted to ratepayers.”
of state and elected o cials who ground” and maintaining close He also called for the creation
oversee utilities, Harckham said. personal contact with o cials
during storm cleanup. of a “utility reserve corps” recruit-
“ ere have been hearings, ed from among utility worker
there have been letters, there have Harckham said that utilities retirees so “storm recovery does
• Item #4 • Drainage Pipe been reports…there are stacks of should compensate customers for not take ve to 10 days due to
• Flagstone • Fieldstone plans, there have been table-top all their losses because of the time logistics.”
drills, and the only thing that it took to get the power back on. “ e formula is this–take the
• Belgian Block changes is both these utilities He also as cosponsored a bill that total number of customers with-
• Cobblestones • Wallstone
(Con Ed and New York State requires them to do so. out power times the number of
Electric and Gas) get worse ev- County Executive George outage days and multiply that by
• Fire Pits • Stepping Stones • Soil/Fill ery storm,” Harckham said at the Latimer testi ed at the joint $1,000. Meaning, 10 customers
hearing. “ ey forget the lessons Senate and Assembly hearing in out of power for 10 days would
27 Norm Ave., Mt. Kisco (next to Kohl’s)
learned about make-safe crews Albany, as well. levy a ne of $100,000. e nes
www.bedfordgravel.com and communication, both with In a statement released urs- would be directly tied to the
municipalities and within their community impact, would not
914-241-3851 own companies, (about) critical day, Aug. 20, Latimer said that correlate with a rate increase and
infrastructure, and on and on.” roughly 100,000 Westchester have some teeth,” Latimer said.
customers had been left without
Lab Day is This weekend use our Persian
around the c ner! Lime Olive Oil in a unique take on
guacamole that will surely become
Fire up those grills and celebrate a new favorite!
the end of summer with our August
Featured Flavors: Persian Lime Olive Ingredients
Oil and Coconut White Balsamic • 4 ripe avocados, peeled and mashed
Vinegar. Get 10% off when bought as • 1 tomato, diced
a same sized pair! • 1/2 cup red onion, diced
• 1 jalapeño, minced
Shop Local. Shop Phat Olive. • Salt and pepper
• 1 tbsp Phat Olive Persian Lime Olive Oil
phatoliveoil.com | 914.232.7428 • Juice of 1 lime
87 Katonah Avenue, Katonah, NY 10536
Instructions
Follow us on Facebook and Instagram @phatoliveoil In a mixing bowl, combine avocado,
tomato, onion and chili pepper. Mix until
blended. Add salt and pepper to taste.
Stir in olive oil and lime juice Serve with
warmed tortilla chips, fresh vegetables or
as a side to your favorite Mexican dish.
Thursday, August 27, 2020 The Somers Record – Page 9
Ready For Some Sale valid: 8/28/20 - 9/3/20 SAVE BI
Mouthwatering BBQ?
PRICES VALID AT With Your Uncle G’s
Place Your Catering Order at Yorktown Heights Savings Card!
UncleG.com/Catering
LOCATION ONLY BACK BY POPULAR DEMAND!
WOW!
WOW!
Limit 2
With an
additional
$25 purchase.
Top Crop $499Snapple ea
British Columbia
Blueberries Iced Tea
12 Pack
Pint
Select Varieties, 192 oz
3 $5
for WOW!
Limit 2
With an
additional
$25 purchase.
Sterling Silver $188Hellmann's ea
NY Strip Steaks or Mayonnaise
Porterhouse Steaks
Select Varieties, 30 oz
Family Pack
WOW!
$1299
/ lb Thomas' 99¢
English ea
Muffins
Plain White Only
12 oz
Limit 3 with an additional purchase.
WOW!
Kabobs with Pepper Chicken Steak Our Gourmet Cheese
& Onions & Parsley Sausage Rings
99 99
5 8 4 16Plain or Marinated$ $ 99 $ 99
$ SWhilrdimJpumCobcokCtoaoilked Pepsi
/ lb / lb Pork or Chicken / lb / lb 1.25 Liter
Soda
Select Varieties, 42.26 oz
79¢Grab and Go - Just Heat and Eat! ea
INTEEMW! INTEEMW! Gulden's
Mustard
Select Varieties
2 312 oz
$
FOR
99SPaepupsaegrse & $ Soy Vay
ea 32 oz, Serves 2 Marinade
EPgegnpnleanatllaToVwoedrkwaith$
Select Varieties
10 14 14 1620oz,Serves1
99 GanridlleAdrtLicehmookneChicken$ 99 COhveicrkReinceMPairlsaafla$ 99 3 1020-22 oz
ea 20 oz, Serves 1 ea 30 oz, Serves 2 $
ea for
or $3.99 ea
Visit UncleG.com for our Marketplace locations and to view all our weekly specials! Limit 2
Photographs and illustrations do not necessarily depict sale items. We reserve the right to limit quantities. Not responsible for typographical errors. Prices Valid at Yorktown Location Only.
Page 10 – The Somers Record Thursday, August 27, 2020
Opinion
Happily
Ever
After
What color shingles? Why do we listen?
Sorry people, these shingles are not WHATWAS Iam really appalled at how we allow THE
for sale and they’re certainly not the I THINKING? ourselves to be exploited by drug SEASONED
kind you’d want to purchase, believe manufacturers, politicians, vitamin CITIZEN
me! RUTHANN hucksters, designers and sundry others.
SCHEFFER As long as it’s repeated often enough, ADRIENNE
According to the brochure from the we line up like lemmings and naively KAVELLE
American Academy of Dermatology: September. I pled my case for an earlier follow the loudest and most persistent
“Shingles is a painful skin rash that often appointment and got no where. voices. Today’s politicians have not changed
blisters.” ey sometimes call it Herpes these tactics. ey call their opponents
Zolster. Anyone who has had chickenpox I nally was able to get an appointment Let’s start with medicinal substances cheats and liars, deriding each other’s
can get shingles. e virus that causes with Hudson Dermatology. After com- advertised on television and periodicals, deeds, and the last ones to speak still
chickenpox stays in the body. After hav- pleting tons of paper work, I went into the advising us to “ask our physicians about hold the ears of the people. ey keep
ing chickenpox, the virus travels to nerve exam room. Upon rst look, the PA said them”. Isn’t it supposed to be the other repeating their accusations until every
cells where it lies dormant. If something “Shingles!” She prescribed an antibiotic way around; isn’t it our doctors who lie becomes true because of repetition.
reactivates or wakes up the virus, the and set up an appointment for the follow- should be telling us what will help or If there had been television in 1860
person gets shingles.” And, yes, stress can ing week. harm us, not we telling them? Looks Abraham Lincoln would never have
trigger the onset of shingles. Half of us like it works though, because manufac- been elected. He was nervous and
folks over the age of 60 get shingles. I understand now that one can get turers have been buying time and ads gangly and didn’t look the part. Frank-
shingles more than once and that it can be for many years. lin Delano Roosevelt never allowed
Years ago, I had a case of shingles. is dangerous. My rash is not spreading; how- himself to be seen in a wheel chair
rash decided to rear its ugly head around ever, I am contagious at this point and have Understanding our bodies and how because he was savvy enough to know
my waist. What discomfort, and it was been advised to go to the ER if it should they work is exceedingly important; it would frighten the masses to have a
during the summer! Once I healed, I spread near my mouth, nose or eyes. understanding drug interactions is not physically challenged president. e
our job but our doctors and pharma- advent of television has given politicians
gured they wouldn’t come back again. Being quarantined is “old hat”for me. cists. We are, of course, warned by the a broader audience and computers even
Sometimes we just assume too much! As long as I have books to read, can talk manufacturer that using their suggested more so. e computer has also made
to family and friends on the phone or drug might end in severe disease or misinformation easier to obtain so we’re
Recently, I noticed a pinkish splotch on Skype, I’ll just addle along. e very death…so, as long as we’re warned, why surrounded on all sides by innuendo.
my chest. I didn’t think too much about disappointing fact is that I can’t go to worry!?
it until I noticed more splotches the next the beauty salon. Now that is a serious Now let’s talk about being cajoled
day. ey had invaded my territory: across inconvenience! Listening to politicians is just as bad. into using vitamins and essential oils.
my chest, up the left side of my neck and Shakespeare proved that to us in Julius It is very important for all of us to
eventually across the back of my neck along e rash is healing and discomfort has Caesar when the crowd cheered Brutus take certain vitamins. e best way, of
the hairline. What a mess! eased. My sister had suggested to me a for having wielded the knife that nally course, is in the food we eat, but many
long time ago to get the shingles shot. I ended Caesar’s life until Antony spoke, of us do need certain supplements to
Trying to get an appointment with ignored her advice because I’d had them choosing to speak after Brutus, because maintain healthy bodies. is should be
a doctor was near to impossible! Even before and didn’t think I needed the he knew the last words we hear are the
though I was so uncomfortable with the vaccine. is time, along with sympathy ones we remember. He pretends not to SEE KAVELLE PAGE 11
pain and itching, doctors couldn’t see me from Roe, I got: “See, I told you to get praise Caesar when all the while telling
until the following week or some time the shot!” the growing mob how much (true or
in September. What really made this so not) Caesar had loved them. Guess
stressful is that my primary care physician who the people backed…
had left the medical group on July 31, and
I wouldn’t be seeing a new doctor until
Proudly keeping Karen Merritt
Somers in 914-276-3400
Good Hands 366 Route 22
Somers, NY 10589
© 2018 Allstate Insurance Co. [email protected]
10472320
Thursday, August 27, 2020 OPINION The Somers Record – Page 11
the Shrink Wrapping
Protects Your
Est. 1987 Investments!
shrinkwrapmystuff.com | (203) 740-0175
P.O. Box 774, Brookfield CT 06804
Before After
KAVELLE Which nally brings us to design- • Boats • Jet Skis •
ers. Every year we’re told by designers • RVs • Motorcycles •
FROM PAGE 10 what to wear. My favorite ads are those
for grade school kids. Why should six • Patio Furniture •
ascertained by our medical professionals. year olds care whether the style of their • Grills • Fountains •
When we hear about ‘essential oils’ and clothes are ‘in’? I guess this year the
‘creams and lotions’ that cure every- biggest change will have to be in their • Landscaping &
thing from beriberi to metastatic cancer, mask designs. Won’t be able to get Construction Equipment •
we become ecstatic. According to some close enough for any other stu .
ads if used diligently and correctly for Call 203-740-0175
weeks or months they will not only Sometimes out of bad comes some-
reduce illness, but add health, longevity, thing good. Perhaps 2021 will see to schedule your wrap today!
clear skin, weight loss, and cause us to grade schoolers paying more attention
be more lovable. Doesn’t it make you to learning science and history than shrinkwrapmystuff.com
wonder why these brilliant innovators di erentiating between human genes
were never named Nobel recipients? and designer jeans.
When did you
last update your
last will and
testament and
power of attorney?
WHITE PLAINS • SOMERS • WWW.ESSLAWFIRM.COM
• Asset Protection • Elder Law • Wills, Trusts & Estates
• Medicaid Applications (Nursing Home/Home Care) • Past Chair of Elder Law Section of NYS Bar Association
• Guardianships (Contested/Non-Contested) • “Super Lawyer” In Elder Law for 10 consecutive years
Contact ANTHONY J. ENEA, ESQ.
Managing Member • Fluent in Italian
914.948.1500
Page 12 – The Somers Record OPINION Thursday, August 27, 2020
Listed By
e itsy-bitsy snack
Irecently read that the average person will ingest my diet that day.
eight spiders in his or her lifetime.
Apparently, this happens when we are sleep- Still, it’s one TRACY
ing, which would make sense, because I don’t know
anyone in their right mind who would choose to thing to inad-
eat a spider when they’re conscious, except maybe
my dog, although he prefers slugs to spiders. Ap- vertently inhale BECKERMAN
parently slugs taste like chicken and spiders just
taste like… spiders. a beetle, and
While this might explain that full feeling I quite another to
sometimes have when I wake up, I was reluctant
to believe that even one spider would willingly nd out that an
climb into bed with me and take a kamikaze dive
into my mouth. I’ve smelled my morning breath. It army of spiders
would kill anything smaller than an elephant upon
impact. are playing tonsil
Moreover, being a light sleeper, I’m pretty sure hockey with you on their way down to your stomach.
I would wake up if I felt someone or something
tickling my tongue. It’s just not the kind of thing Since I do not believe everything I read on the internet,
you can continue to sleep through. I have to
imagine that somewhere in the deep recesses of my I decided to do a little research into the matter to help allay
sleeping mind, it would register that a spider was
crawling into my mouth, and before you could say my fears.
“Charlotte’s Web,” I’d be wide awake and spitting
that sucker across the bedroom oor. e rst site I checked said we swallow four spiders in
is is not to say that I haven’t eaten a few bugs our lifetime. at was better, but still not great news.
accidentally over the years. I distinctly remember
the joy of ying down a big hill on my bike when e second site I checked said the number was closer to
I was kid, and then the feeling of pure horror as
a bug ew into my mouth and down my throat. 20. After reading that, I felt compelled to wash my mouth
I had no idea what kind of bug it was, other than
the knowledge that it buzzed and crunched before out with Listerine and lay down with a cool washcloth
it went down. Distraught, I told my mother, who
responded that it was just a little extra protein in across my head. But then I was worried I might fall asleep
and swallow a spider, so I got up and went back on the
internet.
Another site said we swallow a pound of spiders over our
lifetime. According to the site, that would be about 20,000
average-sized house spiders. I decided this information
must be awed. If we had 20,000 spiders in our house, I
wouldn’t BE in the house long enough to swallow them.
I nally decided to check out Snopes.com, the go-to site
for veri cation of urban myths. According to them, the
whole thing is a made-up crock of arachnids.
Flies, however, are another story.
If you’d like to nd something to laugh about EVERY DAY,
come join my Lost in Midlife community on Facebook at
facebook.com/groups/lostinmidlife.
MY TEAM IS HERE FOR YOU
Amazing 4 Bedroom, 4 Bath Contemporary Home! Stunning Center Island Granite Serving Somers over 35 years
Kitchen w/Stainless Appliances & Sliding Glass Doors to Incredible Wrap-Around
Deck! Entertain in Style - Open Bright Floor Plan, Kitchen to Dramatic 2-Story Cell: 914-282-6440
Family Room w/Fireplace & Wet Bar. Wonderful Outdoor Living Area - complete Email: [email protected]
w/Pool & Large Private Yard. Gorgeous Hardwood Floors. Spacious Formal
Dining Room. Master Suite w/His & Hers Closets + Master Bath w/Jacuzzi Tub
& Separate Shower. Large Lower Level w/Potential Home O ce Space + Rec/
Exercise Rooms! . . . $659,900
CALL NOW FOR A SHOWING 914 282 6440
RE/MAX Classic Realty • 249 Rt 202 Suite 3 • Somers, NY
STRESS FREE LISTING PROCESS SAFE SHOWING PRACTICES FREE MARKET ANALYSIS
Thursday, August 27, 2020 The Somers Record – Page 13
One-stop shopping
for homeowners
Honey-Do-Men contractors can do it all
When Darrell Babboni started a small and remodeling company is somewhat of in supporting the local community, as well Winner,and named Business of the Year by
business out of his mom’s house in 1997 a disservice. It would probably be easier to as the Honey-Do-Men Entrepreneurial the Somers Chamber of Commerce.
doing home repairs, he had no idea it list what they don’t do than what they can Scholarship Program, which awards up to “ ere was a hole in the market, we
would grow to the size it is today.It’s now a do, but let’s give it a try. Exterior services four graduates $1,000 each who show an found it, and lled it,” Babboni said. “My
multi-million-dollar business with 38 em- include roo ng, gutters, siding, windows, entrepreneurial spirit. goal was to become a one-stop-shop for
ployees and 21 trucks. ey complete over doors, driveways, deck, patios, and fenc- Babboni also created the Holiday Light homeowners to call for anything they
1,000 jobs each year. ing, to name a few. Interior services include Show, which is an event he does every year need. And that’s what we have done.”
His company, Honey-Do-Men, a home bathroom and kitchen remodeling, oor- at his o ce with over 40,000 LED lights In addition to providing an extensive selec-
improvement and repair company, has a ing installation, tiling, painting, re nish- all timed to music just to raise the spirits of tion of remodeling, repair, and maintenance
brick-and-mortar headquarters in Carmel ing, custom carpentry, plumbing, electric, the local community services, Honey-Do-Men also ensures each
where Babboni spends most of his days fo- diagnostic repairs, new additions, and a full Babboni went to college and got a de- customer has an outstanding experience.
cusing on customer service, the one thing array of small handyman services. Babboni gree in the performing arts. He was acting “I stand behind my work and every job
he said is missing most in this industry. calls it one-stop shopping for homeowners. and singing, but quickly discovered people my company does,” Babboni said. “I think
Babboni says his pillars of success are But it’s not just about the quantity of the were willing to pay more for those self- it’s that commitment to the job and to the
ve simple things; 1) Answer the phone work or the quality of the jobs it performs; taught home-improvement skills than the customer that has ultimately propelled the
when it rings. 2) Show up on time. 3) it’s mostly about customer service. Maybe ones he learned in school. success of the company.”
Give a written estimate, not a number on that’s why more than 68 percent of the “It was the late ’90s, and I was work- Babboni says diagnostics is his strong
the back of a business card. 4) Do the job jobs they do each year come from repeat ing out of a Honda Civic stripped-down suit, noting it doesn’t help to x something
right,don’t cut corners.5) If there is a prob- customers and direct referrals. If you talk hatchback with the seats folded down, a if you don’t know what caused it to break
lem, go back and x it, no questions asked. to Babboni, who also aspires to become a milk crate full of tools, gutter parts, and a in the rst place. “It seems [other contrac-
Honey-Do-Men services all of West- motivational speaker, you can feel his pas- backpack blower,” he said. “I was working tors] just want to replace everything; they
chester and Putnam counties. However, sion for the work, his company, and for the out of my mom’s house, using her com- don’t want to x it,” he explained. “ ey
Babboni is now in the process of devel- industry he works in. puter and my ladder was strapped to the just want to tear it all out, charge a ton of
oping a franchise model that will take it Babboni, who graduated from Somers roof of my car with no roof rack because I money, and put in all new instead of taking
national as early as next year and will be High School in 1996, and then West- couldn’t a ord one. But I was working out- the time to see what the problem is and if
lming a pilot for a possible series on cable chester Community College in 1998, was doors; I was my own boss, and I loved it.” it can be repaired.”
TV this fall. raised by a single mom. He began by doing Babboni was the typical one-man shop In fact,the company’s mission statement
To simply call Honey-Do-Men a repair simple home repairs to help out around the until a horri c accident where he broke his is, “Raising the expectation level between
house because his mom couldn’t a ord to neck and back in 2004, followed by another the homeowner and their contractor.”
pay someone to make home repairs. traumatizing accident only two years later “I also have a personal motto,‘ ink fast,
“I probably broke more things than I where he broke both his legs, which forced move faster,’”Babboni adds. “Without it, I
xed,” he said with a laugh. But that strug- him to start hiring people to do the work wouldn’t be where I am today.”
gle would lead to the creation of Honey- he couldn’t. Over the next 14 years, Bab- Call 914-837-0411 to nd out more or
Do-Men and several programs Babboni boni started hiring people, bought more to get a free estimate.
would create such as the Good Samaritan trucks, and started building an o ce sta ,
Program, which gives home repair and im- and began winning awards. He was named Article provided by Darrell Babboni/
provement jobs away for free to a home- one of the Top 500 Quali ed Remodelers Honey-Do-Men
owner who can’t a ord it and to nonpro t in America,Top 3 Percent of Roo ng Con-
organizations that show extensive goodwill tractors, Angie’s List Super Service Award
Honey Do Men
1995 Route 6, Carmel NY | 914-837-0411 | www.honeydomen.com
ADVERTORIAL
Page 14 – The Somers Record OPINION Thursday, August 27, 2020
Capers from the Cape
It’s true that vacations are the wind for too long before they eat through our ears. Like New e next couple days were MAN
scaled down these days, and chime in and help you carry it York, the rule is that you have to great for lounging at the shore, OVERBOARD
you can’t visit everywhere somewhere unharmed. eat a convincing amount of food and our dog Gidget proved to
and do everything that a robust in order to purchase drinks from be a carefree beach bunny. We RICK
agenda might have on it. But that About 99 percent of the the bar. I had been fasting since took a walk along the sand bar at MELÉN
doesn’t mean that we can’t have people walking on Commercial breakfast, knowing that I can only low tide, basking in the frequent
a good time. After being cooped Street were wearing a mask, drink as much as I can eat.To praise of dog lovers unfamiliar to a country music station. If I
up in my house for ve months, so it felt very safe to shop and my chagrin there was a one-hour with her breed. Gidget took it listen to country music for too
doing my taxes in a hotel room people-watch. I noticed that I table limit, and I almost had a in furry stride, and even dipped long I start to say “babuh” a lot
in Patterson would seem like a couldn’t yawn with my mask on, panic attack. What if it’s Daylight her paws into the water (she’s and talk about my truck, even
romantic getaway. And right now so I made a point of not going Savings Time and they set the fussy about her paws). On the though I don’t own a truck, and
it’s important to show that we anywhere boring. ere were clocks ahead and I have to leave bay beach in Provincetown at it takes two days to get it out of
can wear a mask when we need a ton of pretty girls and ladies before I get there? ankfully no low tide you can stroll for 15 my system. But it sounds good
to, stay apart and work it into the walking around, at least I assume one was keeping 4/4 time, and I minutes into the water and barely at the beach, and when Gidget
plan without a whole lot of fuss. there were, I couldn’t see much of ate an entire pizza’s worth of beer. get your shins wet. If you keep settled onto her own towel for a
We rented a house in Provinc- their faces. e era of coronavirus Covid-era government is making walking and you see signs for nice nap, it seemed like a pretty
etown, Massachusetts for a few has been a boon for girls with us fat. Faneuil Hall, you went too far. good idea.
nights and had a great time. nice eyes. I remember back in
high school, when one of my girl As we got on our bikes to ere were no lifeguards, but e next day it was already
It wasn’t exactly the same ex- friends said, “I know the perfect go home we saw a fox running with 80-degree water, no waves, time to go home, and before
perience as it used to be, when we girl for you.”Which meant that across the street, of all things. I no alcohol, no depth and tiny we hit the tra c on Route 6, I
used to hang out at the Governor they knew someone so desperate could see how foxy it was because little sh, you’d really have to wished I could take a piece of
Bradford until one o’clock in the that they would possibly put up it wasn’t wearing a mask like a expend some e ort to get into paradise with me. And there it
morning, listening to the drag with me for one evening. And I’d racoon does, and you could tell it any trouble. It seemed much was: a rest area with a sign that
queens run Karaoke night. ey shallowly ask if they were good- wasn’t a housecat because of the more dangerous to check my said, “Adopt Me.” Before I could
had some chess boards built into looking, and my friend would say, tail. A fox has a tail that looks emails from work. ere was jot the number down we were
the tables near the window, and “She has great eyes,” which meant like it was ordered from Etsy and a girl who found a nice-sized already into the rotary. It’s just as
we used to play, even though the rest of her looked like a Goya hastily fastened on with a safety horseshoe crab, and I told her well, we don’t have room for it in
there would always be a piece or painting. It was one step up from pin. en we saw another one, that an upside down horseshoe is the garage, but wouldn’t it be nice
two missing. If you happened “She has a fantastic personality,” so I guess foxes are in and cats good luck, although maybe not to have an area like that for the
to capture my queen, there were which was a guarantee, if true, are SO last year. In fact we didn’t for the crab. rest of the summer.
always plenty more where that that she de nitely wouldn’t like see any cats at all, and usually
came from onstage. Female me. the place is brimming with them We got back to our chairs Say hello at: [email protected]
impersonators have a short fuse because of all the seafood, but this before the tide rolled in and
for people who can’t carry a tune, When we sat down at the time there isn’t as much Chenin swallowed up the sand bar, and I
and they won’t let you twist in restaurant we could relax and take Blanc left over to go with it. picked up the crossword puzzle
our masks o so we didn’t have to and turned on the AM radio
D ODNONNANOA’ COO’ CNONNENL LE L L I F YIOF UYOHUAVHEAVCEOCNOS INDSEIRDEEDR E D
P U RPCUHRACSHIANSGI NOGR OS ERLSLEI NL LGI N, PGL,EPALSEEA S E
11# # AGAGENETNTININ F E EFLEFERL EFER TE EO TCOOCNOTANCTTACMTE MAEN YATNIYMTEI .M E .
SOSOMMERESRS
As thAes#t1haeg#en1 at ginenStoimneSrosmanerdsHanerditHageeriHtaiglles,HIibllrsi,nIgborivnegr o2v4er 24
yearsyoeaf ersxopfeerxiepnecreieanncdeuannmd uatncmheadtcdheevdodtieovnottoioenactoheaancdh and
everyevpeerrysopnerIswonorIkwwoirtkh.with.
D O NDNOANON’ AC OON’ CNOENL LN E L L
AssocAiastesoRceiaalteERsteaatleEBsrtoakteerBroker
M M. . . .
DoconDnoecllo@[email protected]
donnadoocnonnanoecllo.hnonuellilh.haonullaiwharnenlacwe.rceonmce.com
SOMERS BROKERAGE
S O M E R S B RVOI LKLEARGAEGSEQ U A R E , S O M E R S, N Y
VILLAGE SQUARE, SOMERS, NY
Source: HGMLS, 1/1/19-12/31/19, total dollar volume of Single Family homes and Condominiums sold by agent, Somers
Source: HscGhMooLlSd,i1s/t1r/ic19t;-H12G/3M1/L1S9,1t/o1t/a9l-d12o/ll3a1r/1v9o,ltuomtael ovfoSluinmgeleCFoanmdoilymhinoimuiemssasnodldCboyndaogemnitn, iSuommsesros.ld by agent, Somers
school district; HGMLS 1/1/9-12/31/19, total volume Condominiuims sold by agent, Somers.
Thursday, August 27, 2020 The Somers Record – Page 23
Replacing scores of
Allstate | State Farm | Geico
Policies Everyday!
September events at ONE CALL… MULTIPLE QUOTES
the Somers Library So You Can Get The Best Buy!
Due to coronavirus, all events will families of their relationships and Come See We Offer Many
Hy Reichbach, Susan Rohrig & Carmen A. Ritter A-Rated Companies
be virtual and require registration their wealth - two things we work so
For Experience, Knowledge and Service Travelers • Foremost
in order to receive an invitation to hard to preserve. At this special pre- Progressive • Safeco
Aardvark Insurance Kemper • Hartford
participate. To register, visit somer- sentation, we’ll discuss: Alzheimer’s Mercury • 1st American
600 Rt. 6 | Mahopac NY Main Street America
slibrary.org or call 914-232-5717. disease risk factors, warning signs, 845.208.3707 • 845.225.1007
Utica Mutual
Events are made possible by e resources and how you can join the [email protected]
Friends of the Somers Library. ght, protecting your nances and
Important note about the Se- family with designated bene ciaries,
nior Benefits Information Center legacy and estate strategies,life insur-
(SBIC): SBIC program coordina- ance, and knowing the red ags of
tors are still providing Medicare nancial scams.
counseling by phone and by email. Virtual Presentation: Decorat-
Clients can leave a question and their ing Your Home to Sell (or Dwell).
preferred contact method and coun- Monday, Sept. 21, 6:30 - 8 p.m. If The Carmel Aardvark Insurance office is merged with the Mahopac office
effective November 25, 2015.
selors will get back to them within you want to learn the tricks of the
two business days or sooner. e staging trade to sell your home or
SBIC hotline information: 914-231- listings faster and for more money,
3260 or [email protected]. or you just want to revitalize your
Virtual Workshop: Painting in home’s appearance, join home
Autumn/w Judika: Mondays, Sept. staging expert Susan Atwell as she
14 and 21, and Oct. 5 and 19 from teaches you:
11 a.m. to 12:30 p.m. It’s fall, an in- • e 3 keys to outshining the
spirational season to create more art. competition when selling your
We can draw from nature’s colors home.
using acrylic paints, watercolors or • Our top 10 Do-It-Yourself
watercolor oil pencils. is class of- home staging tips guaranteed to sell
fers you the time and space to make homes faster.
new artwork to express yourself. • How to accentuate your home’s
Judika Lieberman is a local artist, most attractive features using what
well-versed in all disciplines and you already have.
will demonstrate the advantages of • Tips to ditch the stress, mess,
each medium. Be a novice or expert, and overwhelm and get it all done
you’re all welcome! Please have your at lightning speed!
supplies for class: canvases, paper, Whether you are a home seller,
brushes, water cup, palette, and your real estate professional,or just some-
favorite medium. en the fun will one who enjoys interior decorating,
begin! Class is limited to 25 people. this workshop is for you!
Race Amity of Northern West- is program is presented by Su- In these uncertain times,
ONE THING IS CERTAIN,
chester & Putnam: Sunday, Sept. san Atwell,home staging expert and Joe Tock and his team are
ready to help you.
13, 2 - 4 p.m. Please join us for our president of AtWellStagedHome.
LAW OFFICES OF JOSEPH J. TOCK
monthly discussion as we work to ad- com.
963 Route 6, Mahopac, NY 10541
vance cross-racial and cross-cultural Virtual Presentation: 1968.
TOCKLAW.COM • 800-869-8080
amity to impact the public discourse ursday, Sept. 24, 6:30 - 8 p.m.
on race. Our monthly meetings fea- e year 1968 was the most tur-
ture speakers, screenings and presen- bulent year of the Swinging 60s
tations where discussions are aimed and America seemed to be coming
at educating one another on who we apart: e Vietnam War becoming
really are. We are all One Human increasingly unpopular, both Mar-
Family! is event may be virtual; tin Luther King and Robert Ken-
check the status on our online calen- nedy were assassinated, and a riot
dar at somerslibrary.org to register or occurred during the Democratic
call 914-232-5717. If it is a live pre- National Convention in Chicago.
sentation, no registration is necessary, ere were trouble spots around
and refreshments will be served. the world, in Czechoslovakia,
Alzheimer’s Conversations: France and Mexico. Lyndon John-
Protecting Your Health and son decided to not seek re-election
Wealth: Wednesday, Sept. 16, 1 - as president and both women’s lib
2:30 p.m. Please join us for this we- and the civil rights movement were
binar presentation hosted by Judi major issues. After all these stressful
McAnaw,Financial Advisor,Edward events, 1968 ends with man circling
Jones and featuring a special guest the moon. is program may be
speaker from the Alzheimer’s Associ- virtual; please check our online cal-
ation.Alzheimer’s is one of the costli- endar at somerslibrary.org to check
est diseases; a lifetime cost of care can the status as well as register, or call
be over $350,000. is disease robs 914-232-5717.